page	:SeedViewerServeFeature:
fid	:fig|93062.19.peg.862:
show_prot_sequence	:1:

>fig|93062.19.peg.862
MNNSLDIKDVTTFYEEDKHLIFGYTPTCGTCKVSERMLDIANEILQLPLLKIDLNFYPQF
CKDMQIMSTPILLLMNKDKEVKRIYAFKSVTDLLENLK


PEGs with Identical Sequence
PEG Genome Function
fig|1006543.3.peg.838 Staphylococcus aureus subsp. aureus T0131 Thioredoxin
fig|1028799.3.peg.736 Staphylococcus aureus subsp. aureus VC40 Thioredoxin
fig|1074252.3.peg.747 Staphylococcus aureus subsp. aureus HO 5096 0412 Thioredoxin
fig|1075076.3.peg.769 Staphylococcus aureus ST228/10388 Thioredoxin
fig|1075077.3.peg.773 Staphylococcus aureus ST228/10497 Thioredoxin
fig|1075078.3.peg.768 Staphylococcus aureus ST228/15532 Thioredoxin
fig|1075079.3.peg.765 Staphylococcus aureus ST228/16035 Thioredoxin
fig|1075082.3.peg.770 Staphylococcus aureus ST228/18412 Thioredoxin
fig|1116214.3.peg.709 Staphylococcus aureus subsp. aureus VRS1 Thioredoxin
fig|1116215.3.peg.736 Staphylococcus aureus subsp. aureus VRS2 Thioredoxin
fig|1116216.3.peg.742 Staphylococcus aureus subsp. aureus VRS3a Thioredoxin
fig|1116217.3.peg.739 Staphylococcus aureus subsp. aureus VRS4 Thioredoxin
fig|1116218.3.peg.742 Staphylococcus aureus subsp. aureus VRS5 Thioredoxin
fig|1116219.3.peg.725 Staphylococcus aureus subsp. aureus VRS6 Thioredoxin
fig|1116220.3.peg.774 Staphylococcus aureus subsp. aureus VRS7 Thioredoxin
fig|1116221.3.peg.746 Staphylococcus aureus subsp. aureus VRS8 Thioredoxin
fig|1116222.3.peg.770 Staphylococcus aureus subsp. aureus VRS9 Thioredoxin
fig|1116223.3.peg.771 Staphylococcus aureus subsp. aureus VRS10 Thioredoxin
fig|1116224.3.peg.793 Staphylococcus aureus subsp. aureus VRS11a Thioredoxin
fig|1116225.3.peg.2711 Staphylococcus aureus subsp. aureus VRS11b Thioredoxin
fig|1118959.3.peg.780 Staphylococcus aureus subsp. aureus M013 Thioredoxin
fig|1123523.3.peg.842 Staphylococcus aureus subsp. aureus 11819-97 Thioredoxin
fig|1134842.3.peg.1127 Staphylococcus aureus subsp. aureus CM05 Thioredoxin
fig|1137129.3.peg.2029 Staphylococcus aureus subsp. aureus 091751 Thioredoxin
fig|1137130.3.peg.1695 Staphylococcus aureus subsp. aureus 103564 Thioredoxin
fig|1137133.3.peg.664 Staphylococcus aureus subsp. aureus MRGR3 Thioredoxin
fig|1144271.3.peg.462 Staphylococcus aureus subsp. aureus 118 Thioredoxin
fig|1144272.3.peg.1130 Staphylococcus aureus subsp. aureus GR1 Thioredoxin
fig|1147034.3.peg.1933 Staphylococcus aureus PM1 Thioredoxin
fig|1156994.3.peg.319 Staphylococcus aureus HI049 Thioredoxin
fig|1156995.3.peg.1480 Staphylococcus aureus HI010 Thioredoxin
fig|1156996.3.peg.320 Staphylococcus aureus HI049B Thioredoxin
fig|1156997.3.peg.836 Staphylococcus aureus HI010B Thioredoxin
fig|1156998.3.peg.317 Staphylococcus aureus HIF003_B2N-C Thioredoxin
fig|1156999.3.peg.771 Staphylococcus aureus HI022 Thioredoxin
fig|1157000.3.peg.810 Staphylococcus aureus HI049C Thioredoxin
fig|1157001.3.peg.1374 Staphylococcus aureus HI168 Thioredoxin
fig|1157002.3.peg.529 Staphylococcus aureus HI111 Thioredoxin
fig|1157003.3.peg.1382 Staphylococcus aureus HI013 Thioredoxin
fig|1157004.3.peg.1417 Staphylococcus aureus M0001 Thioredoxin
fig|1157005.3.peg.294 Staphylococcus aureus M0029 Thioredoxin
fig|1157006.3.peg.300 Staphylococcus aureus M0035 Thioredoxin
fig|1157007.3.peg.1816 Staphylococcus aureus M0045 Thioredoxin
fig|1157008.3.peg.1337 Staphylococcus aureus M0060 Thioredoxin
fig|1157009.3.peg.1322 Staphylococcus aureus M0066 Thioredoxin
fig|1157010.3.peg.742 Staphylococcus aureus M0102 Thioredoxin
fig|1157011.3.peg.1335 Staphylococcus aureus M0103 Thioredoxin
fig|1157012.3.peg.1583 Staphylococcus aureus M0150 Thioredoxin
fig|1157013.3.peg.1650 Staphylococcus aureus M0173 Thioredoxin
fig|1157014.3.peg.730 Staphylococcus aureus M0192 Thioredoxin
fig|1157015.3.peg.1491 Staphylococcus aureus M0197 Thioredoxin
fig|1157016.3.peg.1623 Staphylococcus aureus M0221 Thioredoxin
fig|1157017.3.peg.825 Staphylococcus aureus M0237 Thioredoxin
fig|1157018.3.peg.300 Staphylococcus aureus M0239 Thioredoxin
fig|1157019.3.peg.1732 Staphylococcus aureus M0252 Thioredoxin
fig|1157020.3.peg.300 Staphylococcus aureus M0326 Thioredoxin
fig|1157021.3.peg.294 Staphylococcus aureus M0328 Thioredoxin
fig|1157022.3.peg.778 Staphylococcus aureus M0329 Thioredoxin
fig|1157023.3.peg.1429 Staphylococcus aureus M0330 Thioredoxin
fig|1157024.3.peg.1485 Staphylococcus aureus M0340 Thioredoxin
fig|1157025.3.peg.791 Staphylococcus aureus M0347 Thioredoxin
fig|1157026.3.peg.741 Staphylococcus aureus M0364 Thioredoxin
fig|1157027.3.peg.1361 Staphylococcus aureus M0391 Thioredoxin
fig|1157029.3.peg.723 Staphylococcus aureus M0427 Thioredoxin
fig|1157030.3.peg.722 Staphylococcus aureus M0450 Thioredoxin
fig|1157031.3.peg.2592 Staphylococcus aureus M0467 Thioredoxin
fig|1157032.3.peg.330 Staphylococcus aureus M0468 Thioredoxin
fig|1157033.3.peg.685 Staphylococcus aureus M0478 Thioredoxin
fig|1157034.3.peg.827 Staphylococcus aureus M0489 Thioredoxin
fig|1157035.3.peg.297 Staphylococcus aureus M0494 Thioredoxin
fig|1157036.3.peg.740 Staphylococcus aureus B53639 Thioredoxin
fig|1157037.3.peg.746 Staphylococcus aureus B40723 Thioredoxin
fig|1157038.3.peg.724 Staphylococcus aureus B40950 Thioredoxin
fig|1157039.3.peg.694 Staphylococcus aureus B147830 Thioredoxin
fig|1158461.3.peg.328 Staphylococcus aureus M0628 Thioredoxin
fig|1158462.3.peg.1487 Staphylococcus aureus M0529 Thioredoxin
fig|1158463.3.peg.1517 Staphylococcus aureus M1063 Thioredoxin
fig|1158464.3.peg.332 Staphylococcus aureus M1076 Thioredoxin
fig|1158465.3.peg.1352 Staphylococcus aureus M1064 Thioredoxin
fig|1158466.3.peg.1423 Staphylococcus aureus M1092 Thioredoxin
fig|1158467.3.peg.516 Staphylococcus aureus M1093 Thioredoxin
fig|1158468.3.peg.699 Staphylococcus aureus M1095 Thioredoxin
fig|1158469.3.peg.1570 Staphylococcus aureus M1103 Thioredoxin
fig|1158470.3.peg.1282 Staphylococcus aureus M1119 Thioredoxin
fig|1158471.3.peg.731 Staphylococcus aureus M1167 Thioredoxin
fig|1158472.3.peg.1600 Staphylococcus aureus M1170 Thioredoxin
fig|1158473.3.peg.293 Staphylococcus aureus M1188 Thioredoxin
fig|1158474.3.peg.2610 Staphylococcus aureus M1198 Thioredoxin
fig|1158475.3.peg.1863 Staphylococcus aureus M1199 Thioredoxin
fig|1158476.3.peg.2612 Staphylococcus aureus M1215 Thioredoxin
fig|1158477.3.peg.291 Staphylococcus aureus M1216 Thioredoxin
fig|1158478.3.peg.2580 Staphylococcus aureus M1229 Thioredoxin
fig|1158479.3.peg.736 Staphylococcus aureus M1248 Thioredoxin
fig|1158480.3.peg.1610 Staphylococcus aureus M1253 Thioredoxin
fig|1158481.3.peg.732 Staphylococcus aureus M1255 Thioredoxin
fig|1158482.3.peg.729 Staphylococcus aureus M1257 Thioredoxin
fig|1158483.3.peg.292 Staphylococcus aureus M1277 Thioredoxin
fig|1158484.3.peg.735 Staphylococcus aureus M1291 Thioredoxin
fig|1158486.3.peg.331 Staphylococcus aureus M1320 Thioredoxin
fig|1158487.3.peg.736 Staphylococcus aureus M1321 Thioredoxin
fig|1158488.3.peg.2581 Staphylococcus aureus M1322 Thioredoxin
fig|1158489.3.peg.1616 Staphylococcus aureus M1359 Thioredoxin
fig|1158490.3.peg.299 Staphylococcus aureus M1367 Thioredoxin
fig|1158491.3.peg.1268 Staphylococcus aureus M1373 Thioredoxin
fig|1158492.3.peg.1625 Staphylococcus aureus M1394 Thioredoxin
fig|1158493.3.peg.299 Staphylococcus aureus M1450 Thioredoxin
fig|1158494.3.peg.749 Staphylococcus aureus M1451 Thioredoxin
fig|1158495.3.peg.774 Staphylococcus aureus M1462 Thioredoxin
fig|1158496.3.peg.556 Staphylococcus aureus M1463 Thioredoxin
fig|1158497.3.peg.295 Staphylococcus aureus M1481 Thioredoxin
fig|1158498.3.peg.1314 Staphylococcus aureus M1520 Thioredoxin
fig|1158499.3.peg.334 Staphylococcus aureus M1521 Thioredoxin
fig|1158500.3.peg.674 Staphylococcus aureus M1531 Thioredoxin
fig|1158501.3.peg.334 Staphylococcus aureus M1533 Thioredoxin
fig|1158502.3.peg.735 Staphylococcus aureus M1544 Thioredoxin
fig|1158503.3.peg.730 Staphylococcus aureus M1556 Thioredoxin
fig|1158504.3.peg.991 Staphylococcus aureus M1563 Thioredoxin
fig|1158505.3.peg.1724 Staphylococcus aureus M1565 Thioredoxin
fig|1158506.3.peg.731 Staphylococcus aureus M1578 Thioredoxin
fig|1158507.3.peg.1568 Staphylococcus aureus M0006 Thioredoxin
fig|1158508.3.peg.722 Staphylococcus aureus M0055 Thioredoxin
fig|1158509.3.peg.1317 Staphylococcus aureus M0077 Thioredoxin
fig|1158510.3.peg.727 Staphylococcus aureus M0108 Thioredoxin
fig|1158511.3.peg.1545 Staphylococcus aureus M0144 Thioredoxin
fig|1158512.3.peg.754 Staphylococcus aureus M0154 Thioredoxin
fig|1158513.3.peg.329 Staphylococcus aureus M0177 Thioredoxin
fig|1158514.3.peg.351 Staphylococcus aureus M0200 Thioredoxin
fig|1158515.3.peg.733 Staphylococcus aureus M0212 Thioredoxin
fig|1158516.3.peg.295 Staphylococcus aureus M0216 Thioredoxin
fig|1158517.3.peg.1321 Staphylococcus aureus M0235 Thioredoxin
fig|1158518.3.peg.1723 Staphylococcus aureus M0250 Thioredoxin
fig|1158520.3.peg.2718 Staphylococcus aureus M0280 Thioredoxin
fig|1158521.3.peg.733 Staphylococcus aureus M0306 Thioredoxin
fig|1158522.3.peg.1572 Staphylococcus aureus M0334 Thioredoxin
fig|1158523.3.peg.1340 Staphylococcus aureus M0350 Thioredoxin
fig|1158524.3.peg.781 Staphylococcus aureus M0351 Thioredoxin
fig|1158525.3.peg.671 Staphylococcus aureus M0363 Thioredoxin
fig|1158526.3.peg.1616 Staphylococcus aureus M0367 Thioredoxin
fig|1158527.3.peg.2619 Staphylococcus aureus M0374 Thioredoxin
fig|1158528.3.peg.1317 Staphylococcus aureus M0375 Thioredoxin
fig|1158529.3.peg.964 Staphylococcus aureus M0396 Thioredoxin
fig|1158530.3.peg.1377 Staphylococcus aureus M0424 Thioredoxin
fig|1158531.3.peg.730 Staphylococcus aureus M0438 Thioredoxin
fig|1158533.3.peg.303 Staphylococcus aureus M0510 Thioredoxin
fig|1158535.3.peg.729 Staphylococcus aureus M0562 Thioredoxin
fig|1158536.3.peg.1803 Staphylococcus aureus M0571 Thioredoxin
fig|1158537.3.peg.731 Staphylococcus aureus M0584 Thioredoxin
fig|1158538.3.peg.1452 Staphylococcus aureus M0586 Thioredoxin
fig|1158539.3.peg.757 Staphylococcus aureus M0633 Thioredoxin
fig|1158682.3.peg.789 Staphylococcus aureus M0528 Thioredoxin
fig|1158683.3.peg.303 Staphylococcus aureus M0531 Thioredoxin
fig|1158684.3.peg.788 Staphylococcus aureus M0536 Thioredoxin
fig|1158685.3.peg.1564 Staphylococcus aureus M0539 Thioredoxin
fig|1158686.3.peg.1553 Staphylococcus aureus M0547 Thioredoxin
fig|1158687.3.peg.735 Staphylococcus aureus M0565 Thioredoxin
fig|1158688.3.peg.2604 Staphylococcus aureus M0580 Thioredoxin
fig|1158689.3.peg.319 Staphylococcus aureus M0602 Thioredoxin
fig|1158690.3.peg.749 Staphylococcus aureus M0622 Thioredoxin
fig|1158691.3.peg.771 Staphylococcus aureus M0676 Thioredoxin
fig|1158692.3.peg.556 Staphylococcus aureus M0687 Thioredoxin
fig|1158693.3.peg.1327 Staphylococcus aureus M0692 Thioredoxin
fig|1158694.3.peg.1423 Staphylococcus aureus M0719 Thioredoxin
fig|1158695.3.peg.736 Staphylococcus aureus M0769 Thioredoxin
fig|1158696.3.peg.1800 Staphylococcus aureus M0770 Thioredoxin
fig|1158697.3.peg.734 Staphylococcus aureus M0780 Thioredoxin
fig|1158698.3.peg.1555 Staphylococcus aureus M0799 Thioredoxin
fig|1158699.3.peg.735 Staphylococcus aureus M0823 Thioredoxin
fig|1158700.3.peg.1425 Staphylococcus aureus M0844 Thioredoxin
fig|1158701.3.peg.1794 Staphylococcus aureus M0934 Thioredoxin
fig|1158702.3.peg.732 Staphylococcus aureus M0943 Thioredoxin
fig|1158703.3.peg.695 Staphylococcus aureus M0944 Thioredoxin
fig|1158704.3.peg.331 Staphylococcus aureus M0953 Thioredoxin
fig|1158705.3.peg.332 Staphylococcus aureus M0998 Thioredoxin
fig|1158706.3.peg.751 Staphylococcus aureus M0999 Thioredoxin
fig|1158707.3.peg.1379 Staphylococcus aureus M1007 Thioredoxin
fig|1158708.3.peg.293 Staphylococcus aureus M1010 Thioredoxin
fig|1158709.3.peg.877 Staphylococcus aureus M1015 Thioredoxin
fig|1158710.3.peg.330 Staphylococcus aureus M1016 Thioredoxin
fig|1158711.3.peg.398 Staphylococcus aureus M1036 Thioredoxin
fig|1158712.3.peg.732 Staphylococcus aureus M1037 Thioredoxin
fig|1161392.3.peg.2392 Staphylococcus aureus NN54 Thioredoxin
fig|1169256.3.peg.735 Staphylococcus aureus M0964 Thioredoxin
fig|1169257.3.peg.340 Staphylococcus aureus M0978 Thioredoxin
fig|1169258.3.peg.296 Staphylococcus aureus M0994 Thioredoxin
fig|1169260.3.peg.739 Staphylococcus aureus M1044 Thioredoxin
fig|1169261.3.peg.1332 Staphylococcus aureus M1061 Thioredoxin
fig|1169262.3.peg.737 Staphylococcus aureus M1062 Thioredoxin
fig|1169263.3.peg.732 Staphylococcus aureus M1068 Thioredoxin
fig|1169264.3.peg.731 Staphylococcus aureus M1083 Thioredoxin
fig|1169265.3.peg.1420 Staphylococcus aureus M1109 Thioredoxin
fig|1169266.3.peg.734 Staphylococcus aureus M1126 Thioredoxin
fig|1169267.3.peg.293 Staphylococcus aureus M1142 Thioredoxin
fig|1169268.3.peg.1366 Staphylococcus aureus M1223 Thioredoxin
fig|1169269.3.peg.730 Staphylococcus aureus M1224 Thioredoxin
fig|1169270.3.peg.786 Staphylococcus aureus M1244 Thioredoxin
fig|1169272.3.peg.791 Staphylococcus aureus M1275 Thioredoxin
fig|1169273.3.peg.735 Staphylococcus aureus M1286 Thioredoxin
fig|1169274.3.peg.732 Staphylococcus aureus M1309 Thioredoxin
fig|1169275.3.peg.732 Staphylococcus aureus M1374 Thioredoxin
fig|1169276.3.peg.734 Staphylococcus aureus M1405 Thioredoxin
fig|1169277.3.peg.771 Staphylococcus aureus M1510 Thioredoxin
fig|1213721.3.peg.1430 Staphylococcus aureus M0648 Thioredoxin
fig|1213722.3.peg.1331 Staphylococcus aureus M0660 Thioredoxin
fig|1213723.3.peg.726 Staphylococcus aureus M0663 Thioredoxin
fig|1213724.3.peg.738 Staphylococcus aureus M0673 Thioredoxin
fig|1213725.3.peg.802 Staphylococcus aureus M0695 Thioredoxin
fig|1213726.3.peg.732 Staphylococcus aureus M0792 Thioredoxin
fig|1213727.3.peg.732 Staphylococcus aureus M0822 Thioredoxin
fig|1213728.3.peg.307 Staphylococcus aureus M0831 Thioredoxin
fig|1213729.3.peg.732 Staphylococcus aureus M0871 Thioredoxin
fig|1213732.3.peg.740 Staphylococcus aureus M0892 Thioredoxin
fig|1213733.3.peg.707 Staphylococcus aureus M0900 Thioredoxin
fig|1213734.3.peg.736 Staphylococcus aureus M0927 Thioredoxin
fig|1214901.3.peg.1791 Staphylococcus aureus M0646 Thioredoxin
fig|1216363.3.peg.871 Staphylococcus aureus subsp. aureus 06BA18369 Thioredoxin
fig|1221451.3.peg.1082 Staphylococcus aureus subsp. aureus 120 Thioredoxin
fig|1221452.3.peg.229 Staphylococcus aureus subsp. aureus 333 Thioredoxin
fig|1221453.3.peg.604 Staphylococcus aureus subsp. aureus 3989 Thioredoxin
fig|1224919.3.peg.1472 Staphylococcus aureus M0104 Thioredoxin
fig|1224920.3.peg.1358 Staphylococcus aureus M0171 Thioredoxin
fig|1224921.3.peg.2388 Staphylococcus aureus M0210 Thioredoxin
fig|1224922.3.peg.1623 Staphylococcus aureus M0213 Thioredoxin
fig|1224923.3.peg.708 Staphylococcus aureus M0240 Thioredoxin
fig|1224924.3.peg.1311 Staphylococcus aureus M0270 Thioredoxin
fig|1224925.3.peg.1600 Staphylococcus aureus M0273 Thioredoxin
fig|1224926.3.peg.300 Staphylococcus aureus M0279 Thioredoxin
fig|1224927.3.peg.297 Staphylococcus aureus M0288 Thioredoxin
fig|1224928.3.peg.345 Staphylococcus aureus M0312 Thioredoxin
fig|1224929.3.peg.506 Staphylococcus aureus M0404 Thioredoxin
fig|1224930.3.peg.1411 Staphylococcus aureus M0415 Thioredoxin
fig|1224931.3.peg.328 Staphylococcus aureus M0455 Thioredoxin
fig|1224932.3.peg.293 Staphylococcus aureus M0460 Thioredoxin
fig|1224933.3.peg.1608 Staphylococcus aureus M0493 Thioredoxin
fig|1226740.3.peg.769 Staphylococcus aureus subsp. aureus VH60 Thioredoxin
fig|1231382.3.peg.2032 Staphylococcus aureus KT/Y21 Thioredoxin
fig|1231383.3.peg.1345 Staphylococcus aureus KT/314250 Thioredoxin
fig|1235275.3.peg.913 Staphylococcus aureus PPUKM-261-2009 Thioredoxin
fig|1235276.3.peg.899 Staphylococcus aureus PPUKM-332-2009 Thioredoxin
fig|1235277.3.peg.801 Staphylococcus aureus PPUKM-377-2009 Thioredoxin
fig|1241616.3.peg.303 Staphylococcus aureus subsp. aureus DSM 20231 Thioredoxin
fig|1242970.3.peg.807 Staphylococcus aureus CN79 Thioredoxin
fig|1258575.3.peg.717 Staphylococcus aureus subsp. aureus H29 Thioredoxin
fig|1265302.3.peg.2330 Staphylococcus aureus subsp. aureus PB32 Thioredoxin
fig|1278071.4.peg.1480 Staphylococcus aureus 3957 Thioredoxin
fig|1278072.4.peg.2216 Staphylococcus aureus LVP2 Thioredoxin
fig|1278074.4.peg.2358 Staphylococcus aureus VH221 Thioredoxin
fig|1278075.4.peg.899 Staphylococcus aureus LVP5 Thioredoxin
fig|1283278.3.peg.744 Staphylococcus aureus KLT6 Thioredoxin
fig|1288493.3.peg.1427 Staphylococcus aureus subsp. aureus S1800 Thioredoxin
fig|1303780.3.peg.2616 Staphylococcus aureus M0075 Thioredoxin
fig|1303781.3.peg.1577 Staphylococcus aureus M0294 Thioredoxin
fig|1303782.3.peg.1455 Staphylococcus aureus M1060 Thioredoxin
fig|1303783.3.peg.289 Staphylococcus aureus M1078 Thioredoxin
fig|1303784.3.peg.1621 Staphylococcus aureus M1193 Thioredoxin
fig|1303785.3.peg.1412 Staphylococcus aureus M1228 Thioredoxin
fig|1303786.3.peg.1459 Staphylococcus aureus M1407 Thioredoxin
fig|1303787.3.peg.752 Staphylococcus aureus M1466 Thioredoxin
fig|1305598.3.peg.799 Staphylococcus aureus M1 Thioredoxin
fig|1331008.3.peg.2465 Staphylococcus aureus subsp. aureus CBD-635 Thioredoxin
fig|158878.1.peg.836 Staphylococcus aureus subsp. aureus Mu50 Thioredoxin
fig|158878.14.peg.861 Staphylococcus aureus subsp. aureus Mu50 Thioredoxin
fig|158879.1.peg.790 Staphylococcus aureus subsp. aureus N315 Thioredoxin
fig|158879.11.peg.822 Staphylococcus aureus subsp. aureus N315 Thioredoxin
fig|196620.1.peg.789 Staphylococcus aureus subsp. aureus MW2 Thioredoxin
fig|196620.5.peg.832 Staphylococcus aureus subsp. aureus MW2 Thioredoxin
fig|282459.1.peg.771 Staphylococcus aureus subsp. aureus MSSA476 Thioredoxin
fig|282459.5.peg.811 Staphylococcus aureus subsp. aureus MSSA476 Thioredoxin
fig|359786.13.peg.906 Staphylococcus aureus subsp. aureus JH9 Thioredoxin
fig|359786.3.peg.2174 Staphylococcus aureus subsp. aureus JH9 Thioredoxin
fig|359787.11.peg.894 Staphylococcus aureus subsp. aureus JH1 Thioredoxin
fig|359787.3.peg.2518 Staphylococcus aureus subsp. aureus JH1 Thioredoxin
fig|367830.3.peg.2467 Staphylococcus aureus subsp. aureus USA300 Thioredoxin
fig|418127.4.peg.779 Staphylococcus aureus subsp. aureus Mu3 Thioredoxin
fig|418127.6.peg.852 Staphylococcus aureus subsp. aureus Mu3 Thioredoxin
fig|426430.6.peg.761 Staphylococcus aureus subsp. aureus str. Newman Thioredoxin
fig|426430.8.peg.847 Staphylococcus aureus subsp. aureus str. Newman Thioredoxin
fig|450394.6.peg.34 Staphylococcus aureus subsp. aureus USA300_TCH959 Thioredoxin
fig|451515.3.peg.882 Staphylococcus aureus subsp. aureus USA300_FPR3757 Thioredoxin
fig|451516.9.peg.888 Staphylococcus aureus subsp. aureus USA300_TCH1516 Thioredoxin
fig|452948.4.peg.2604 Staphylococcus aureus 930918-3 Thioredoxin
fig|455227.3.peg.2519 Staphylococcus aureus D30 Thioredoxin
fig|505321.3.peg.2418 Staphylococcus aureus subsp. aureus str. CF-Marseille Thioredoxin
fig|543539.3.peg.1365 Staphylococcus aureus subsp. aureus CGS01 Thioredoxin
fig|543540.3.peg.2027 Staphylococcus aureus subsp. aureus CGS03 Thioredoxin
fig|546342.3.peg.370 Staphylococcus aureus subsp. aureus str. JKD6008 Thioredoxin
fig|546342.4.peg.886 Staphylococcus aureus subsp. aureus str. JKD6008 Thioredoxin
fig|546343.3.peg.1239 Staphylococcus aureus subsp. aureus str. JKD6009 Thioredoxin
fig|548475.3.peg.1134 Staphylococcus aureus subsp. aureus TCH70 Thioredoxin
fig|553565.3.peg.663 Staphylococcus aureus A5937 Thioredoxin
fig|553567.3.peg.1645 Staphylococcus aureus A5948 Thioredoxin
fig|553568.3.peg.1860 Staphylococcus aureus A6224 Thioredoxin
fig|553571.3.peg.752 Staphylococcus aureus A6300 Thioredoxin
fig|553573.3.peg.122 Staphylococcus aureus A8115 Thioredoxin
fig|553574.3.peg.1975 Staphylococcus aureus A8117 Thioredoxin
fig|553577.3.peg.1340 Staphylococcus aureus A8796 Thioredoxin
fig|553580.3.peg.1682 Staphylococcus aureus A8819 Thioredoxin
fig|553581.3.peg.2319 Staphylococcus aureus A9299 Thioredoxin
fig|553588.3.peg.1798 Staphylococcus aureus A9719 Thioredoxin
fig|553590.4.peg.2221 Staphylococcus aureus A9754 Thioredoxin
fig|553592.3.peg.2507 Staphylococcus aureus A9763 Thioredoxin
fig|553594.3.peg.2417 Staphylococcus aureus A9765 Thioredoxin
fig|553596.3.peg.1774 Staphylococcus aureus A9781 Thioredoxin
fig|553601.3.peg.2617 Staphylococcus aureus A10102 Thioredoxin
fig|561307.5.peg.93 Staphylococcus aureus subsp. aureus RN4220 Thioredoxin
fig|585152.3.peg.748 Staphylococcus aureus subsp. aureus D139 Thioredoxin
fig|585891.3.peg.860 Staphylococcus aureus subsp. aureus Mu50-omega Thioredoxin
fig|644279.4.peg.911 Staphylococcus aureus subsp. aureus 132 Thioredoxin
fig|663951.4.peg.941 Staphylococcus aureus subsp. aureus TW20 Thioredoxin
fig|680649.3.peg.1942 Staphylococcus aureus subsp. aureus MR1 Thioredoxin
fig|681288.4.peg.783 Staphylococcus aureus subsp. aureus ED98 Thioredoxin
fig|685039.3.peg.881 Staphylococcus aureus subsp. aureus ED133 Thioredoxin
fig|703339.3.peg.807 Staphylococcus aureus 04-02981 Thioredoxin
fig|754025.3.peg.876 Staphylococcus aureus subsp. aureus MRSA131 Thioredoxin
fig|754026.3.peg.1502 Staphylococcus aureus subsp. aureus MRSA177 Thioredoxin
fig|762962.3.peg.1165 Staphylococcus aureus subsp. aureus ATCC 51811 Thioredoxin
fig|862516.3.peg.2454 Staphylococcus aureus subsp. aureus ATCC BAA-39 Thioredoxin
fig|869816.3.peg.812 Staphylococcus aureus subsp. aureus JKD6159 Thioredoxin
fig|889933.4.peg.743 Staphylococcus aureus subsp. aureus ECT-R 2 Thioredoxin
fig|904313.3.peg.1561 Staphylococcus aureus subsp. aureus VCU006 Thioredoxin
fig|904723.3.peg.1973 Staphylococcus aureus subsp. aureus 21172 Thioredoxin
fig|904724.3.peg.656 Staphylococcus aureus subsp. aureus 21178 Thioredoxin
fig|904725.3.peg.1990 Staphylococcus aureus subsp. aureus 21189 Thioredoxin
fig|904726.3.peg.61 Staphylococcus aureus subsp. aureus 21193 Thioredoxin
fig|904729.3.peg.2146 Staphylococcus aureus subsp. aureus 21196 Thioredoxin
fig|904731.3.peg.1521 Staphylococcus aureus subsp. aureus 21201 Thioredoxin
fig|904735.3.peg.1524 Staphylococcus aureus subsp. aureus 21209 Thioredoxin
fig|904737.3.peg.758 Staphylococcus aureus subsp. aureus 21232 Thioredoxin
fig|904738.3.peg.1677 Staphylococcus aureus subsp. aureus 21235 Thioredoxin
fig|904739.3.peg.1525 Staphylococcus aureus subsp. aureus 21236 Thioredoxin
fig|904745.3.peg.379 Staphylococcus aureus subsp. aureus 21262 Thioredoxin
fig|904747.3.peg.1683 Staphylococcus aureus subsp. aureus 21266 Thioredoxin
fig|904749.3.peg.1036 Staphylococcus aureus subsp. aureus 21269 Thioredoxin
fig|904750.3.peg.1562 Staphylococcus aureus subsp. aureus 21272 Thioredoxin
fig|904753.3.peg.2393 Staphylococcus aureus subsp. aureus 21282 Thioredoxin
fig|904754.3.peg.386 Staphylococcus aureus subsp. aureus 21283 Thioredoxin
fig|904759.3.peg.176 Staphylococcus aureus subsp. aureus 21305 Thioredoxin
fig|904760.3.peg.846 Staphylococcus aureus subsp. aureus 21310 Thioredoxin
fig|904763.3.peg.1840 Staphylococcus aureus subsp. aureus 21318 Thioredoxin
fig|904767.3.peg.1922 Staphylococcus aureus subsp. aureus 21333 Thioredoxin
fig|904768.3.peg.158 Staphylococcus aureus subsp. aureus 21334 Thioredoxin
fig|904771.3.peg.486 Staphylococcus aureus subsp. aureus 21340 Thioredoxin
fig|904773.3.peg.906 Staphylococcus aureus subsp. aureus 21343 Thioredoxin
fig|904775.3.peg.2735 Staphylococcus aureus subsp. aureus IS-3 Thioredoxin
fig|904776.3.peg.2441 Staphylococcus aureus subsp. aureus IS-24 Thioredoxin
fig|904777.3.peg.272 Staphylococcus aureus subsp. aureus IS-55 Thioredoxin
fig|904778.3.peg.1621 Staphylococcus aureus subsp. aureus IS-88 Thioredoxin
fig|904779.3.peg.657 Staphylococcus aureus subsp. aureus IS-91 Thioredoxin
fig|904780.3.peg.120 Staphylococcus aureus subsp. aureus IS-99 Thioredoxin
fig|904781.3.peg.2488 Staphylococcus aureus subsp. aureus IS-105 Thioredoxin
fig|904782.3.peg.1232 Staphylococcus aureus subsp. aureus IS-111 Thioredoxin
fig|904783.3.peg.145 Staphylococcus aureus subsp. aureus IS-122 Thioredoxin
fig|904784.3.peg.1063 Staphylococcus aureus subsp. aureus IS-125 Thioredoxin
fig|904785.3.peg.1149 Staphylococcus aureus subsp. aureus IS-157 Thioredoxin
fig|904786.3.peg.1322 Staphylococcus aureus subsp. aureus IS-160 Thioredoxin
fig|904787.3.peg.119 Staphylococcus aureus subsp. aureus IS-189 Thioredoxin
fig|904792.3.peg.1994 Staphylococcus aureus subsp. aureus IS-M Thioredoxin
fig|904795.7.peg.2796 Staphylococcus aureus subsp. aureus CO-23 Thioredoxin
fig|908247.3.peg.42 Staphylococcus aureus 16K Thioredoxin
fig|93061.3.peg.818 Staphylococcus aureus subsp. aureus NCTC 8325 Thioredoxin
fig|93061.5.peg.764 Staphylococcus aureus subsp. aureus NCTC 8325 Thioredoxin
fig|93062.19.peg.862 Staphylococcus aureus subsp. aureus COL Thioredoxin
fig|93062.4.peg.1826 Staphylococcus aureus subsp. aureus COL Thioredoxin
fig|931432.3.peg.1312 Staphylococcus aureus subsp. aureus CIG1057 Thioredoxin
fig|931433.3.peg.1365 Staphylococcus aureus subsp. aureus CIG1114 Thioredoxin
fig|931434.3.peg.1277 Staphylococcus aureus subsp. aureus CIG1165 Thioredoxin
fig|931439.3.peg.1240 Staphylococcus aureus subsp. aureus CIG1750 Thioredoxin
fig|931440.3.peg.1439 Staphylococcus aureus subsp. aureus CIG1769 Thioredoxin
fig|931441.3.peg.990 Staphylococcus aureus subsp. aureus CIG1835 Thioredoxin
fig|931442.3.peg.1486 Staphylococcus aureus subsp. aureus CIG547 Thioredoxin
fig|931443.3.peg.1316 Staphylococcus aureus subsp. aureus CIG1096 Thioredoxin
fig|931444.3.peg.1350 Staphylococcus aureus subsp. aureus CIG1150 Thioredoxin
fig|931446.3.peg.1334 Staphylococcus aureus subsp. aureus CIG1213 Thioredoxin
fig|931448.3.peg.1394 Staphylococcus aureus subsp. aureus CIG1612 Thioredoxin
fig|931449.3.peg.1372 Staphylococcus aureus subsp. aureus CIG1770 Thioredoxin
fig|931450.3.peg.1148 Staphylococcus aureus subsp. aureus CIG2018 Thioredoxin
fig|931455.3.peg.1284 Staphylococcus aureus subsp. aureus CIGC340D Thioredoxin
fig|931457.3.peg.1299 Staphylococcus aureus subsp. aureus CIGC345D Thioredoxin
fig|931458.3.peg.1442 Staphylococcus aureus subsp. aureus CIGC348 Thioredoxin
fig|931459.3.peg.1260 Staphylococcus aureus subsp. aureus CIGC128 Thioredoxin
fig|931460.3.peg.947 Staphylococcus aureus subsp. aureus CIGC93 Thioredoxin
fig|948561.3.peg.2526 Staphylococcus aureus O11 Thioredoxin
fig|985006.4.peg.746 Staphylococcus aureus subsp. aureus LGA251 Thioredoxin