page	:SeedViewerServeFeature:
fid	:fig|93062.19.peg.2479:
show_prot_sequence	:1:

>fig|93062.19.peg.2479
MEAIKVQLSHSVKVAISIYLALIFITFTSYLVIILYTSMTGHDVSHFVLDSQHSHHGSLT
QKHLSLPEISFK


PEGs with Identical Sequence
PEG Genome Function
fig|359787.11.peg.2660 Staphylococcus aureus subsp. aureus JH1 FIG01107948: hypothetical protein
fig|418127.6.peg.2582 Staphylococcus aureus subsp. aureus Mu3 FIG01107948: hypothetical protein
fig|426430.8.peg.2641 Staphylococcus aureus subsp. aureus str. Newman FIG01107948: hypothetical protein
fig|546342.3.peg.965 Staphylococcus aureus subsp. aureus str. JKD6008 FIG01107948: hypothetical protein
fig|553574.3.peg.2237 Staphylococcus aureus A8117 FIG01107948: hypothetical protein
fig|553590.4.peg.1702 Staphylococcus aureus A9754 FIG01107948: hypothetical protein
fig|553596.3.peg.1198 Staphylococcus aureus A9781 FIG01107948: hypothetical protein
fig|585147.3.peg.2162 Staphylococcus aureus subsp. aureus A017934/97 FIG01107948: hypothetical protein
fig|585159.3.peg.9 Staphylococcus aureus subsp. aureus M899 FIG01107948: hypothetical protein
fig|585161.3.peg.2402 Staphylococcus aureus subsp. aureus WW2703/97 FIG01107948: hypothetical protein
fig|644279.4.peg.2683 Staphylococcus aureus subsp. aureus 132 FIG01107948: hypothetical protein
fig|680649.3.peg.299 Staphylococcus aureus subsp. aureus MR1 FIG01107948: hypothetical protein
fig|762962.3.peg.1972 Staphylococcus aureus subsp. aureus ATCC 51811 FIG01107948: hypothetical protein
fig|93062.19.peg.2479 Staphylococcus aureus subsp. aureus COL FIG01107948: hypothetical protein