page	:SeedViewerServeFeature:
fid	:fig|93062.19.peg.1581:
show_prot_sequence	:1:

>fig|93062.19.peg.1581
MKRFKYALDGLKILIQKDYKFLLHVFAMIVAIVFGLVLNINRIEWIFILIAIALVLTVEA
LNTAIEYVVDLVTVEYHDLAKYAKDIAAFSVLIVSILAFIIGLIVFLPHFIALF


PEGs with Identical Sequence
PEG Genome Function
fig|1028799.3.peg.1413 Staphylococcus aureus subsp. aureus VC40 Diacylglycerol kinase (EC 2.7.1.107)
fig|1074252.3.peg.1516 Staphylococcus aureus subsp. aureus HO 5096 0412 Diacylglycerol kinase (EC 2.7.1.107)
fig|1075076.3.peg.1433 Staphylococcus aureus ST228/10388 Diacylglycerol kinase (EC 2.7.1.107)
fig|1075077.3.peg.1438 Staphylococcus aureus ST228/10497 Diacylglycerol kinase (EC 2.7.1.107)
fig|1075078.3.peg.1436 Staphylococcus aureus ST228/15532 Diacylglycerol kinase (EC 2.7.1.107)
fig|1075079.3.peg.1432 Staphylococcus aureus ST228/16035 Diacylglycerol kinase (EC 2.7.1.107)
fig|1075082.3.peg.1438 Staphylococcus aureus ST228/18412 Diacylglycerol kinase (EC 2.7.1.107)
fig|1112349.3.peg.1713 Staphylococcus aureus subsp. aureus NN50 Diacylglycerol kinase (EC 2.7.1.107)
fig|1116214.3.peg.1443 Staphylococcus aureus subsp. aureus VRS1 Diacylglycerol kinase (EC 2.7.1.107)
fig|1116215.3.peg.1496 Staphylococcus aureus subsp. aureus VRS2 Diacylglycerol kinase (EC 2.7.1.107)
fig|1116216.3.peg.1406 Staphylococcus aureus subsp. aureus VRS3a Diacylglycerol kinase (EC 2.7.1.107)
fig|1116217.3.peg.1469 Staphylococcus aureus subsp. aureus VRS4 Diacylglycerol kinase (EC 2.7.1.107)
fig|1116218.3.peg.1447 Staphylococcus aureus subsp. aureus VRS5 Diacylglycerol kinase (EC 2.7.1.107)
fig|1116219.3.peg.1425 Staphylococcus aureus subsp. aureus VRS6 Diacylglycerol kinase (EC 2.7.1.107)
fig|1116220.3.peg.1518 Staphylococcus aureus subsp. aureus VRS7 Diacylglycerol kinase (EC 2.7.1.107)
fig|1116221.3.peg.1428 Staphylococcus aureus subsp. aureus VRS8 Diacylglycerol kinase (EC 2.7.1.107)
fig|1116222.3.peg.1526 Staphylococcus aureus subsp. aureus VRS9 Diacylglycerol kinase (EC 2.7.1.107)
fig|1116223.3.peg.1531 Staphylococcus aureus subsp. aureus VRS10 Diacylglycerol kinase (EC 2.7.1.107)
fig|1116224.3.peg.1524 Staphylococcus aureus subsp. aureus VRS11a Diacylglycerol kinase (EC 2.7.1.107)
fig|1116225.3.peg.1497 Staphylococcus aureus subsp. aureus VRS11b Diacylglycerol kinase (EC 2.7.1.107)
fig|1123523.3.peg.1566 Staphylococcus aureus subsp. aureus 11819-97 Diacylglycerol kinase (EC 2.7.1.107)
fig|1134842.3.peg.730 Staphylococcus aureus subsp. aureus CM05 Diacylglycerol kinase (EC 2.7.1.107)
fig|1137129.3.peg.474 Staphylococcus aureus subsp. aureus 091751 Diacylglycerol kinase (EC 2.7.1.107)
fig|1137130.3.peg.1073 Staphylococcus aureus subsp. aureus 103564 Diacylglycerol kinase (EC 2.7.1.107)
fig|1137131.3.peg.81 Staphylococcus aureus subsp. aureus 122051 Diacylglycerol kinase (EC 2.7.1.107)
fig|1137132.3.peg.1201 Staphylococcus aureus subsp. aureus 112808A Diacylglycerol kinase (EC 2.7.1.107)
fig|1137133.3.peg.2419 Staphylococcus aureus subsp. aureus MRGR3 Diacylglycerol kinase (EC 2.7.1.107)
fig|1144271.3.peg.1358 Staphylococcus aureus subsp. aureus 118 Diacylglycerol kinase (EC 2.7.1.107)
fig|1155079.3.peg.203 Staphylococcus aureus subsp. aureus DR10 Diacylglycerol kinase (EC 2.7.1.107)
fig|1155084.3.peg.1384 Staphylococcus aureus subsp. aureus 71193 Diacylglycerol kinase (EC 2.7.1.107)
fig|1156996.3.peg.1074 Staphylococcus aureus HI049B Diacylglycerol kinase (EC 2.7.1.107)
fig|1156997.3.peg.1592 Staphylococcus aureus HI010B Diacylglycerol kinase (EC 2.7.1.107)
fig|1156998.3.peg.988 Staphylococcus aureus HIF003_B2N-C Diacylglycerol kinase (EC 2.7.1.107)
fig|1156999.3.peg.1524 Staphylococcus aureus HI022 Diacylglycerol kinase (EC 2.7.1.107)
fig|1157000.3.peg.1563 Staphylococcus aureus HI049C Diacylglycerol kinase (EC 2.7.1.107)
fig|1157001.3.peg.2109 Staphylococcus aureus HI168 Diacylglycerol kinase (EC 2.7.1.107)
fig|1157002.3.peg.1283 Staphylococcus aureus HI111 Diacylglycerol kinase (EC 2.7.1.107)
fig|1157003.3.peg.2137 Staphylococcus aureus HI013 Diacylglycerol kinase (EC 2.7.1.107)
fig|1157004.3.peg.2230 Staphylococcus aureus M0001 Diacylglycerol kinase (EC 2.7.1.107)
fig|1157006.3.peg.1093 Staphylococcus aureus M0035 Diacylglycerol kinase (EC 2.7.1.107)
fig|1157008.3.peg.2130 Staphylococcus aureus M0060 Diacylglycerol kinase (EC 2.7.1.107)
fig|1157009.3.peg.2176 Staphylococcus aureus M0066 Diacylglycerol kinase (EC 2.7.1.107)
fig|1157011.3.peg.2137 Staphylococcus aureus M0103 Diacylglycerol kinase (EC 2.7.1.107)
fig|1157013.3.peg.2365 Staphylococcus aureus M0173 Diacylglycerol kinase (EC 2.7.1.107)
fig|1157016.3.peg.2446 Staphylococcus aureus M0221 Diacylglycerol kinase (EC 2.7.1.107)
fig|1157018.3.peg.973 Staphylococcus aureus M0239 Diacylglycerol kinase (EC 2.7.1.107)
fig|1157021.3.peg.1117 Staphylococcus aureus M0328 Diacylglycerol kinase (EC 2.7.1.107)
fig|1157022.3.peg.1556 Staphylococcus aureus M0329 Diacylglycerol kinase (EC 2.7.1.107)
fig|1157024.3.peg.2311 Staphylococcus aureus M0340 Diacylglycerol kinase (EC 2.7.1.107)
fig|1157025.3.peg.1522 Staphylococcus aureus M0347 Diacylglycerol kinase (EC 2.7.1.107)
fig|1157026.3.peg.1475 Staphylococcus aureus M0364 Diacylglycerol kinase (EC 2.7.1.107)
fig|1157030.3.peg.1508 Staphylococcus aureus M0450 Diacylglycerol kinase (EC 2.7.1.107)
fig|1157031.3.peg.668 Staphylococcus aureus M0467 Diacylglycerol kinase (EC 2.7.1.107)
fig|1157032.3.peg.1141 Staphylococcus aureus M0468 Diacylglycerol kinase (EC 2.7.1.107)
fig|1157035.3.peg.1023 Staphylococcus aureus M0494 Diacylglycerol kinase (EC 2.7.1.107)
fig|1157036.3.peg.1476 Staphylococcus aureus B53639 Diacylglycerol kinase (EC 2.7.1.107)
fig|1157038.3.peg.1459 Staphylococcus aureus B40950 Diacylglycerol kinase (EC 2.7.1.107)
fig|1157039.3.peg.1490 Staphylococcus aureus B147830 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158461.3.peg.993 Staphylococcus aureus M0628 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158463.3.peg.2376 Staphylococcus aureus M1063 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158464.3.peg.1123 Staphylococcus aureus M1076 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158465.3.peg.2194 Staphylococcus aureus M1064 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158468.3.peg.1555 Staphylococcus aureus M1095 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158469.3.peg.2386 Staphylococcus aureus M1103 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158470.3.peg.2092 Staphylococcus aureus M1119 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158471.3.peg.1440 Staphylococcus aureus M1167 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158472.3.peg.2394 Staphylococcus aureus M1170 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158473.3.peg.1092 Staphylococcus aureus M1188 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158474.3.peg.661 Staphylococcus aureus M1198 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158476.3.peg.662 Staphylococcus aureus M1215 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158477.3.peg.1012 Staphylococcus aureus M1216 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158478.3.peg.662 Staphylococcus aureus M1229 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158479.3.peg.1447 Staphylococcus aureus M1248 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158480.3.peg.2406 Staphylococcus aureus M1253 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158481.3.peg.1584 Staphylococcus aureus M1255 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158482.3.peg.1458 Staphylococcus aureus M1257 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158483.3.peg.1025 Staphylococcus aureus M1277 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158484.3.peg.1470 Staphylococcus aureus M1291 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158485.3.peg.1661 Staphylococcus aureus M1311 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158488.3.peg.682 Staphylococcus aureus M1322 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158489.3.peg.2362 Staphylococcus aureus M1359 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158490.3.peg.1093 Staphylococcus aureus M1367 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158495.3.peg.1602 Staphylococcus aureus M1462 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158496.3.peg.1265 Staphylococcus aureus M1463 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158497.3.peg.1006 Staphylococcus aureus M1481 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158498.3.peg.2034 Staphylococcus aureus M1520 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158499.3.peg.1145 Staphylococcus aureus M1521 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158501.3.peg.1069 Staphylococcus aureus M1533 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158503.3.peg.1438 Staphylococcus aureus M1556 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158503.3.peg.1446 Staphylococcus aureus M1556 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158504.3.peg.1658 Staphylococcus aureus M1563 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158505.3.peg.2559 Staphylococcus aureus M1565 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158508.3.peg.1497 Staphylococcus aureus M0055 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158510.3.peg.1517 Staphylococcus aureus M0108 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158512.3.peg.1498 Staphylococcus aureus M0154 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158513.3.peg.1078 Staphylococcus aureus M0177 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158514.3.peg.1147 Staphylococcus aureus M0200 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158516.3.peg.1041 Staphylococcus aureus M0216 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158517.3.peg.2055 Staphylococcus aureus M0235 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158518.3.peg.2518 Staphylococcus aureus M0250 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158524.3.peg.1514 Staphylococcus aureus M0351 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158525.3.peg.1472 Staphylococcus aureus M0363 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158526.3.peg.2420 Staphylococcus aureus M0367 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158527.3.peg.658 Staphylococcus aureus M0374 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158529.3.peg.1700 Staphylococcus aureus M0396 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158530.3.peg.2223 Staphylococcus aureus M0424 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158531.3.peg.1522 Staphylococcus aureus M0438 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158533.3.peg.1144 Staphylococcus aureus M0510 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158534.3.peg.89 Staphylococcus aureus M0513 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158536.3.peg.2651 Staphylococcus aureus M0571 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158537.3.peg.1532 Staphylococcus aureus M0584 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158539.3.peg.1596 Staphylococcus aureus M0633 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158682.3.peg.1564 Staphylococcus aureus M0528 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158686.3.peg.2373 Staphylococcus aureus M0547 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158687.3.peg.1461 Staphylococcus aureus M0565 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158688.3.peg.655 Staphylococcus aureus M0580 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158689.3.peg.1153 Staphylococcus aureus M0602 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158690.3.peg.1460 Staphylococcus aureus M0622 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158691.3.peg.1478 Staphylococcus aureus M0676 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158692.3.peg.1350 Staphylococcus aureus M0687 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158693.3.peg.2191 Staphylococcus aureus M0692 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158694.3.peg.2265 Staphylococcus aureus M0719 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158696.3.peg.2645 Staphylococcus aureus M0770 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158700.3.peg.2215 Staphylococcus aureus M0844 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158702.3.peg.1438 Staphylococcus aureus M0943 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158703.3.peg.1420 Staphylococcus aureus M0944 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158707.3.peg.2220 Staphylococcus aureus M1007 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158708.3.peg.1070 Staphylococcus aureus M1010 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158709.3.peg.1676 Staphylococcus aureus M1015 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158710.3.peg.1103 Staphylococcus aureus M1016 Diacylglycerol kinase (EC 2.7.1.107)
fig|1158711.3.peg.1176 Staphylococcus aureus M1036 Diacylglycerol kinase (EC 2.7.1.107)
fig|1163749.3.peg.1047 Staphylococcus aureus subsp. aureus LCT-SA112 Diacylglycerol kinase (EC 2.7.1.107)
fig|1169255.3.peg.1670 Staphylococcus aureus M0946 Diacylglycerol kinase (EC 2.7.1.107)
fig|1169257.3.peg.1189 Staphylococcus aureus M0978 Diacylglycerol kinase (EC 2.7.1.107)
fig|1169258.3.peg.1094 Staphylococcus aureus M0994 Diacylglycerol kinase (EC 2.7.1.107)
fig|1169259.3.peg.1436 Staphylococcus aureus M1034 Diacylglycerol kinase (EC 2.7.1.107)
fig|1169260.3.peg.1541 Staphylococcus aureus M1044 Diacylglycerol kinase (EC 2.7.1.107)
fig|1169261.3.peg.2139 Staphylococcus aureus M1061 Diacylglycerol kinase (EC 2.7.1.107)
fig|1169264.3.peg.1428 Staphylococcus aureus M1083 Diacylglycerol kinase (EC 2.7.1.107)
fig|1169268.3.peg.2193 Staphylococcus aureus M1223 Diacylglycerol kinase (EC 2.7.1.107)
fig|1169269.3.peg.1463 Staphylococcus aureus M1224 Diacylglycerol kinase (EC 2.7.1.107)
fig|1169270.3.peg.1599 Staphylococcus aureus M1244 Diacylglycerol kinase (EC 2.7.1.107)
fig|1169271.3.peg.1606 Staphylococcus aureus M1256 Diacylglycerol kinase (EC 2.7.1.107)
fig|1169275.3.peg.1437 Staphylococcus aureus M1374 Diacylglycerol kinase (EC 2.7.1.107)
fig|1169277.3.peg.1557 Staphylococcus aureus M1510 Diacylglycerol kinase (EC 2.7.1.107)
fig|1213721.3.peg.2221 Staphylococcus aureus M0648 Diacylglycerol kinase (EC 2.7.1.107)
fig|1213722.3.peg.2139 Staphylococcus aureus M0660 Diacylglycerol kinase (EC 2.7.1.107)
fig|1213724.3.peg.1465 Staphylococcus aureus M0673 Diacylglycerol kinase (EC 2.7.1.107)
fig|1213725.3.peg.1469 Staphylococcus aureus M0695 Diacylglycerol kinase (EC 2.7.1.107)
fig|1213727.3.peg.1440 Staphylococcus aureus M0822 Diacylglycerol kinase (EC 2.7.1.107)
fig|1213728.3.peg.1153 Staphylococcus aureus M0831 Diacylglycerol kinase (EC 2.7.1.107)
fig|1213729.3.peg.1435 Staphylococcus aureus M0871 Diacylglycerol kinase (EC 2.7.1.107)
fig|1213730.3.peg.1591 Staphylococcus aureus M0877 Diacylglycerol kinase (EC 2.7.1.107)
fig|1213732.3.peg.1538 Staphylococcus aureus M0892 Diacylglycerol kinase (EC 2.7.1.107)
fig|1213733.3.peg.1535 Staphylococcus aureus M0900 Diacylglycerol kinase (EC 2.7.1.107)
fig|1213734.3.peg.1448 Staphylococcus aureus M0927 Diacylglycerol kinase (EC 2.7.1.107)
fig|1214901.3.peg.2642 Staphylococcus aureus M0646 Diacylglycerol kinase (EC 2.7.1.107)
fig|1221451.3.peg.462 Staphylococcus aureus subsp. aureus 120 Diacylglycerol kinase (EC 2.7.1.107)
fig|1221452.3.peg.1293 Staphylococcus aureus subsp. aureus 333 Diacylglycerol kinase (EC 2.7.1.107)
fig|1221453.3.peg.1837 Staphylococcus aureus subsp. aureus 3989 Diacylglycerol kinase (EC 2.7.1.107)
fig|1224919.3.peg.2309 Staphylococcus aureus M0104 Diacylglycerol kinase (EC 2.7.1.107)
fig|1224920.3.peg.2150 Staphylococcus aureus M0171 Diacylglycerol kinase (EC 2.7.1.107)
fig|1224923.3.peg.1469 Staphylococcus aureus M0240 Diacylglycerol kinase (EC 2.7.1.107)
fig|1224924.3.peg.2181 Staphylococcus aureus M0270 Diacylglycerol kinase (EC 2.7.1.107)
fig|1224926.3.peg.1095 Staphylococcus aureus M0279 Diacylglycerol kinase (EC 2.7.1.107)
fig|1224929.3.peg.1308 Staphylococcus aureus M0404 Diacylglycerol kinase (EC 2.7.1.107)
fig|1224930.3.peg.2232 Staphylococcus aureus M0415 Diacylglycerol kinase (EC 2.7.1.107)
fig|1224931.3.peg.1059 Staphylococcus aureus M0455 Diacylglycerol kinase (EC 2.7.1.107)
fig|1224933.3.peg.2359 Staphylococcus aureus M0493 Diacylglycerol kinase (EC 2.7.1.107)
fig|1226740.3.peg.1977 Staphylococcus aureus subsp. aureus VH60 Diacylglycerol kinase (EC 2.7.1.107)
fig|1229492.3.peg.1529 Staphylococcus aureus 08BA02176 Diacylglycerol kinase (EC 2.7.1.107)
fig|1231382.3.peg.322 Staphylococcus aureus KT/Y21 Diacylglycerol kinase (EC 2.7.1.107)
fig|1231383.3.peg.582 Staphylococcus aureus KT/314250 Diacylglycerol kinase (EC 2.7.1.107)
fig|1233245.3.peg.2029 Staphylococcus aureus M2 Diacylglycerol kinase (EC 2.7.1.107)
fig|1235275.3.peg.1624 Staphylococcus aureus PPUKM-261-2009 Diacylglycerol kinase (EC 2.7.1.107)
fig|1235276.3.peg.1686 Staphylococcus aureus PPUKM-332-2009 Diacylglycerol kinase (EC 2.7.1.107)
fig|1235277.3.peg.1556 Staphylococcus aureus PPUKM-377-2009 Diacylglycerol kinase (EC 2.7.1.107)
fig|1235278.3.peg.1557 Staphylococcus aureus PPUKM-775-2009 Diacylglycerol kinase (EC 2.7.1.107)
fig|1241616.3.peg.1034 Staphylococcus aureus subsp. aureus DSM 20231 Diacylglycerol kinase (EC 2.7.1.107)
fig|1258575.3.peg.2508 Staphylococcus aureus subsp. aureus H29 Diacylglycerol kinase (EC 2.7.1.107)
fig|1265302.3.peg.1133 Staphylococcus aureus subsp. aureus PB32 Diacylglycerol kinase (EC 2.7.1.107)
fig|1278071.4.peg.531 Staphylococcus aureus 3957 Diacylglycerol kinase (EC 2.7.1.107)
fig|1278072.4.peg.1026 Staphylococcus aureus LVP2 Diacylglycerol kinase (EC 2.7.1.107)
fig|1278074.4.peg.567 Staphylococcus aureus VH221 Diacylglycerol kinase (EC 2.7.1.107)
fig|1278075.4.peg.427 Staphylococcus aureus LVP5 Diacylglycerol kinase (EC 2.7.1.107)
fig|1283278.3.peg.1433 Staphylococcus aureus KLT6 Diacylglycerol kinase (EC 2.7.1.107)
fig|1288493.3.peg.524 Staphylococcus aureus subsp. aureus S1800 Diacylglycerol kinase (EC 2.7.1.107)
fig|1303781.3.peg.2364 Staphylococcus aureus M0294 Diacylglycerol kinase (EC 2.7.1.107)
fig|1303784.3.peg.2352 Staphylococcus aureus M1193 Diacylglycerol kinase (EC 2.7.1.107)
fig|1303785.3.peg.2172 Staphylococcus aureus M1228 Diacylglycerol kinase (EC 2.7.1.107)
fig|1303786.3.peg.2208 Staphylococcus aureus M1407 Diacylglycerol kinase (EC 2.7.1.107)
fig|1303787.3.peg.1610 Staphylococcus aureus M1466 Diacylglycerol kinase (EC 2.7.1.107)
fig|1305598.3.peg.1556 Staphylococcus aureus M1 Diacylglycerol kinase (EC 2.7.1.107)
fig|1323661.3.peg.1536 Staphylococcus aureus CA-347 Diacylglycerol kinase (EC 2.7.1.107)
fig|1331008.3.peg.1283 Staphylococcus aureus subsp. aureus CBD-635 Diacylglycerol kinase (EC 2.7.1.107)
fig|158878.1.peg.1569 Staphylococcus aureus subsp. aureus Mu50 Diacylglycerol kinase (EC 2.7.1.107)
fig|158878.14.peg.1615 Staphylococcus aureus subsp. aureus Mu50 Diacylglycerol kinase (EC 2.7.1.107)
fig|158879.1.peg.1444 Staphylococcus aureus subsp. aureus N315 Diacylglycerol kinase (EC 2.7.1.107)
fig|158879.11.peg.1504 Staphylococcus aureus subsp. aureus N315 Diacylglycerol kinase (EC 2.7.1.107)
fig|196620.1.peg.1521 Staphylococcus aureus subsp. aureus MW2 Diacylglycerol kinase (EC 2.7.1.107)
fig|196620.5.peg.1587 Staphylococcus aureus subsp. aureus MW2 Diacylglycerol kinase (EC 2.7.1.107)
fig|282458.1.peg.1559 Staphylococcus aureus subsp. aureus MRSA252 Diacylglycerol kinase (EC 2.7.1.107)
fig|282458.4.peg.1650 Staphylococcus aureus subsp. aureus MRSA252 Diacylglycerol kinase (EC 2.7.1.107)
fig|282459.1.peg.1492 Staphylococcus aureus subsp. aureus MSSA476 Diacylglycerol kinase (EC 2.7.1.107)
fig|282459.5.peg.1567 Staphylococcus aureus subsp. aureus MSSA476 Diacylglycerol kinase (EC 2.7.1.107)
fig|359786.3.peg.290 Staphylococcus aureus subsp. aureus JH9 Diacylglycerol kinase (EC 2.7.1.107)
fig|359787.11.peg.1695 Staphylococcus aureus subsp. aureus JH1 Diacylglycerol kinase (EC 2.7.1.107)
fig|359787.3.peg.1504 Staphylococcus aureus subsp. aureus JH1 Diacylglycerol kinase (EC 2.7.1.107)
fig|367830.3.peg.146 Staphylococcus aureus subsp. aureus USA300 Diacylglycerol kinase (EC 2.7.1.107)
fig|418127.6.peg.1593 Staphylococcus aureus subsp. aureus Mu3 Diacylglycerol kinase (EC 2.7.1.107)
fig|426430.8.peg.1600 Staphylococcus aureus subsp. aureus str. Newman Diacylglycerol kinase (EC 2.7.1.107)
fig|451515.3.peg.1670 Staphylococcus aureus subsp. aureus USA300_FPR3757 Diacylglycerol kinase (EC 2.7.1.107)
fig|451516.9.peg.1660 Staphylococcus aureus subsp. aureus USA300_TCH1516 Diacylglycerol kinase (EC 2.7.1.107)
fig|452948.4.peg.208 Staphylococcus aureus 930918-3 Diacylglycerol kinase (EC 2.7.1.107)
fig|505321.3.peg.1559 Staphylococcus aureus subsp. aureus str. CF-Marseille Diacylglycerol kinase (EC 2.7.1.107)
fig|543538.3.peg.204 Staphylococcus aureus subsp. aureus CGS00 Diacylglycerol kinase (EC 2.7.1.107)
fig|543539.3.peg.117 Staphylococcus aureus subsp. aureus CGS01 Diacylglycerol kinase (EC 2.7.1.107)
fig|543540.3.peg.1248 Staphylococcus aureus subsp. aureus CGS03 Diacylglycerol kinase (EC 2.7.1.107)
fig|546342.3.peg.860 Staphylococcus aureus subsp. aureus str. JKD6008 Diacylglycerol kinase (EC 2.7.1.107)
fig|546342.4.peg.1623 Staphylococcus aureus subsp. aureus str. JKD6008 Diacylglycerol kinase (EC 2.7.1.107)
fig|546343.3.peg.15 Staphylococcus aureus subsp. aureus str. JKD6009 Diacylglycerol kinase (EC 2.7.1.107)
fig|548470.3.peg.2368 Staphylococcus aureus subsp. aureus MN8 Diacylglycerol kinase (EC 2.7.1.107)
fig|548473.3.peg.1705 Staphylococcus aureus subsp. aureus TCH60 Diacylglycerol kinase (EC 2.7.1.107)
fig|548473.6.peg.1532 Staphylococcus aureus subsp. aureus TCH60 Diacylglycerol kinase (EC 2.7.1.107)
fig|548474.3.peg.741 Staphylococcus aureus subsp. aureus TCH130 Diacylglycerol kinase (EC 2.7.1.107)
fig|548475.3.peg.558 Staphylococcus aureus subsp. aureus TCH70 Diacylglycerol kinase (EC 2.7.1.107)
fig|553565.3.peg.267 Staphylococcus aureus A5937 Diacylglycerol kinase (EC 2.7.1.107)
fig|553568.3.peg.1045 Staphylococcus aureus A6224 Diacylglycerol kinase (EC 2.7.1.107)
fig|553571.3.peg.1850 Staphylococcus aureus A6300 Diacylglycerol kinase (EC 2.7.1.107)
fig|553573.3.peg.1399 Staphylococcus aureus A8115 Diacylglycerol kinase (EC 2.7.1.107)
fig|553574.3.peg.413 Staphylococcus aureus A8117 Diacylglycerol kinase (EC 2.7.1.107)
fig|553577.3.peg.1796 Staphylococcus aureus A8796 Diacylglycerol kinase (EC 2.7.1.107)
fig|553580.3.peg.1830 Staphylococcus aureus A8819 Diacylglycerol kinase (EC 2.7.1.107)
fig|553581.3.peg.1437 Staphylococcus aureus A9299 Diacylglycerol kinase (EC 2.7.1.107)
fig|553588.3.peg.464 Staphylococcus aureus A9719 Diacylglycerol kinase (EC 2.7.1.107)
fig|553590.4.peg.657 Staphylococcus aureus A9754 Diacylglycerol kinase (EC 2.7.1.107)
fig|553592.3.peg.1366 Staphylococcus aureus A9763 Diacylglycerol kinase (EC 2.7.1.107)
fig|553596.3.peg.500 Staphylococcus aureus A9781 Diacylglycerol kinase (EC 2.7.1.107)
fig|561307.5.peg.1124 Staphylococcus aureus subsp. aureus RN4220 Diacylglycerol kinase (EC 2.7.1.107)
fig|585143.3.peg.2103 Staphylococcus aureus subsp. aureus 55/2053 Diacylglycerol kinase (EC 2.7.1.107)
fig|585144.3.peg.2129 Staphylococcus aureus subsp. aureus 58-424 Diacylglycerol kinase (EC 2.7.1.107)
fig|585145.3.peg.1832 Staphylococcus aureus subsp. aureus 65-1322 Diacylglycerol kinase (EC 2.7.1.107)
fig|585146.3.peg.2101 Staphylococcus aureus subsp. aureus 68-397 Diacylglycerol kinase (EC 2.7.1.107)
fig|585147.3.peg.1175 Staphylococcus aureus subsp. aureus A017934/97 Diacylglycerol kinase (EC 2.7.1.107)
fig|585149.6.peg.1740 Staphylococcus aureus subsp. aureus C101 Diacylglycerol kinase (EC 2.7.1.107)
fig|585151.3.peg.786 Staphylococcus aureus subsp. aureus C427 Diacylglycerol kinase (EC 2.7.1.107)
fig|585152.3.peg.1560 Staphylococcus aureus subsp. aureus D139 Diacylglycerol kinase (EC 2.7.1.107)
fig|585153.3.peg.1847 Staphylococcus aureus subsp. aureus E1410 Diacylglycerol kinase (EC 2.7.1.107)
fig|585154.3.peg.1268 Staphylococcus aureus subsp. aureus EMRSA16 Diacylglycerol kinase (EC 2.7.1.107)
fig|585155.3.peg.1788 Staphylococcus aureus subsp. aureus H19 Diacylglycerol kinase (EC 2.7.1.107)
fig|585156.3.peg.1121 Staphylococcus aureus subsp. aureus M1015 Diacylglycerol kinase (EC 2.7.1.107)
fig|585157.3.peg.1300 Staphylococcus aureus subsp. aureus M809 Diacylglycerol kinase (EC 2.7.1.107)
fig|585158.3.peg.2088 Staphylococcus aureus subsp. aureus M876 Diacylglycerol kinase (EC 2.7.1.107)
fig|585159.3.peg.1644 Staphylococcus aureus subsp. aureus M899 Diacylglycerol kinase (EC 2.7.1.107)
fig|585160.3.peg.1109 Staphylococcus aureus subsp. aureus WBG10049 Diacylglycerol kinase (EC 2.7.1.107)
fig|585161.3.peg.1288 Staphylococcus aureus subsp. aureus WW2703/97 Diacylglycerol kinase (EC 2.7.1.107)
fig|585891.3.peg.1612 Staphylococcus aureus subsp. aureus Mu50-omega Diacylglycerol kinase (EC 2.7.1.107)
fig|663951.4.peg.1673 Staphylococcus aureus subsp. aureus TW20 Diacylglycerol kinase (EC 2.7.1.107)
fig|680649.3.peg.1158 Staphylococcus aureus subsp. aureus MR1 Diacylglycerol kinase (EC 2.7.1.107)
fig|681288.4.peg.1559 Staphylococcus aureus subsp. aureus ED98 Diacylglycerol kinase (EC 2.7.1.107)
fig|685039.3.peg.1637 Staphylococcus aureus subsp. aureus ED133 Diacylglycerol kinase (EC 2.7.1.107)
fig|703339.3.peg.1554 Staphylococcus aureus 04-02981 Diacylglycerol kinase (EC 2.7.1.107)
fig|754025.3.peg.1116 Staphylococcus aureus subsp. aureus MRSA131 Diacylglycerol kinase (EC 2.7.1.107)
fig|754026.3.peg.487 Staphylococcus aureus subsp. aureus MRSA177 Diacylglycerol kinase (EC 2.7.1.107)
fig|762962.3.peg.417 Staphylococcus aureus subsp. aureus ATCC 51811 Diacylglycerol kinase (EC 2.7.1.107)
fig|862516.3.peg.1716 Staphylococcus aureus subsp. aureus ATCC BAA-39 Diacylglycerol kinase (EC 2.7.1.107)
fig|869816.3.peg.1580 Staphylococcus aureus subsp. aureus JKD6159 Diacylglycerol kinase (EC 2.7.1.107)
fig|889933.4.peg.1398 Staphylococcus aureus subsp. aureus ECT-R 2 Diacylglycerol kinase (EC 2.7.1.107)
fig|904724.3.peg.93 Staphylococcus aureus subsp. aureus 21178 Diacylglycerol kinase (EC 2.7.1.107)
fig|904725.3.peg.1420 Staphylococcus aureus subsp. aureus 21189 Diacylglycerol kinase (EC 2.7.1.107)
fig|904726.3.peg.304 Staphylococcus aureus subsp. aureus 21193 Diacylglycerol kinase (EC 2.7.1.107)
fig|904727.3.peg.1505 Staphylococcus aureus subsp. aureus 21194 Diacylglycerol kinase (EC 2.7.1.107)
fig|904728.3.peg.992 Staphylococcus aureus subsp. aureus 21195 Diacylglycerol kinase (EC 2.7.1.107)
fig|904729.3.peg.1962 Staphylococcus aureus subsp. aureus 21196 Diacylglycerol kinase (EC 2.7.1.107)
fig|904730.3.peg.432 Staphylococcus aureus subsp. aureus 21200 Diacylglycerol kinase (EC 2.7.1.107)
fig|904731.3.peg.333 Staphylococcus aureus subsp. aureus 21201 Diacylglycerol kinase (EC 2.7.1.107)
fig|904732.3.peg.2434 Staphylococcus aureus subsp. aureus 21202 Diacylglycerol kinase (EC 2.7.1.107)
fig|904735.3.peg.670 Staphylococcus aureus subsp. aureus 21209 Diacylglycerol kinase (EC 2.7.1.107)
fig|904737.3.peg.2132 Staphylococcus aureus subsp. aureus 21232 Diacylglycerol kinase (EC 2.7.1.107)
fig|904739.3.peg.2359 Staphylococcus aureus subsp. aureus 21236 Diacylglycerol kinase (EC 2.7.1.107)
fig|904743.3.peg.413 Staphylococcus aureus subsp. aureus 21252 Diacylglycerol kinase (EC 2.7.1.107)
fig|904744.3.peg.370 Staphylococcus aureus subsp. aureus 21259 Diacylglycerol kinase (EC 2.7.1.107)
fig|904746.3.peg.718 Staphylococcus aureus subsp. aureus 21264 Diacylglycerol kinase (EC 2.7.1.107)
fig|904749.3.peg.2512 Staphylococcus aureus subsp. aureus 21269 Diacylglycerol kinase (EC 2.7.1.107)
fig|904750.3.peg.294 Staphylococcus aureus subsp. aureus 21272 Diacylglycerol kinase (EC 2.7.1.107)
fig|904753.3.peg.1476 Staphylococcus aureus subsp. aureus 21282 Diacylglycerol kinase (EC 2.7.1.107)
fig|904754.3.peg.201 Staphylococcus aureus subsp. aureus 21283 Diacylglycerol kinase (EC 2.7.1.107)
fig|904759.3.peg.2366 Staphylococcus aureus subsp. aureus 21305 Diacylglycerol kinase (EC 2.7.1.107)
fig|904760.3.peg.1085 Staphylococcus aureus subsp. aureus 21310 Diacylglycerol kinase (EC 2.7.1.107)
fig|904763.3.peg.844 Staphylococcus aureus subsp. aureus 21318 Diacylglycerol kinase (EC 2.7.1.107)
fig|904766.3.peg.560 Staphylococcus aureus subsp. aureus 21331 Diacylglycerol kinase (EC 2.7.1.107)
fig|904767.3.peg.2289 Staphylococcus aureus subsp. aureus 21333 Diacylglycerol kinase (EC 2.7.1.107)
fig|904768.3.peg.1250 Staphylococcus aureus subsp. aureus 21334 Diacylglycerol kinase (EC 2.7.1.107)
fig|904771.3.peg.1765 Staphylococcus aureus subsp. aureus 21340 Diacylglycerol kinase (EC 2.7.1.107)
fig|904772.3.peg.1947 Staphylococcus aureus subsp. aureus 21342 Diacylglycerol kinase (EC 2.7.1.107)
fig|904773.3.peg.2024 Staphylococcus aureus subsp. aureus 21343 Diacylglycerol kinase (EC 2.7.1.107)
fig|904774.3.peg.295 Staphylococcus aureus subsp. aureus 21345 Diacylglycerol kinase (EC 2.7.1.107)
fig|904775.3.peg.2598 Staphylococcus aureus subsp. aureus IS-3 Diacylglycerol kinase (EC 2.7.1.107)
fig|904776.3.peg.1300 Staphylococcus aureus subsp. aureus IS-24 Diacylglycerol kinase (EC 2.7.1.107)
fig|904777.3.peg.1718 Staphylococcus aureus subsp. aureus IS-55 Diacylglycerol kinase (EC 2.7.1.107)
fig|904779.3.peg.1505 Staphylococcus aureus subsp. aureus IS-91 Diacylglycerol kinase (EC 2.7.1.107)
fig|904780.3.peg.856 Staphylococcus aureus subsp. aureus IS-99 Diacylglycerol kinase (EC 2.7.1.107)
fig|904781.3.peg.2548 Staphylococcus aureus subsp. aureus IS-105 Diacylglycerol kinase (EC 2.7.1.107)
fig|904782.3.peg.1366 Staphylococcus aureus subsp. aureus IS-111 Diacylglycerol kinase (EC 2.7.1.107)
fig|904783.3.peg.1198 Staphylococcus aureus subsp. aureus IS-122 Diacylglycerol kinase (EC 2.7.1.107)
fig|904784.3.peg.2420 Staphylococcus aureus subsp. aureus IS-125 Diacylglycerol kinase (EC 2.7.1.107)
fig|904785.3.peg.29 Staphylococcus aureus subsp. aureus IS-157 Diacylglycerol kinase (EC 2.7.1.107)
fig|904787.3.peg.2958 Staphylococcus aureus subsp. aureus IS-189 Diacylglycerol kinase (EC 2.7.1.107)
fig|904792.3.peg.1055 Staphylococcus aureus subsp. aureus IS-M Diacylglycerol kinase (EC 2.7.1.107)
fig|904795.7.peg.261 Staphylococcus aureus subsp. aureus CO-23 Diacylglycerol kinase (EC 2.7.1.107)
fig|93061.3.peg.1618 Staphylococcus aureus subsp. aureus NCTC 8325 Diacylglycerol kinase (EC 2.7.1.107)
fig|93061.5.peg.1520 Staphylococcus aureus subsp. aureus NCTC 8325 Diacylglycerol kinase (EC 2.7.1.107)
fig|93062.19.peg.1581 Staphylococcus aureus subsp. aureus COL Diacylglycerol kinase (EC 2.7.1.107)
fig|93062.4.peg.1327 Staphylococcus aureus subsp. aureus COL Diacylglycerol kinase (EC 2.7.1.107)
fig|931432.3.peg.2370 Staphylococcus aureus subsp. aureus CIG1057 Diacylglycerol kinase (EC 2.7.1.107)
fig|931434.3.peg.2101 Staphylococcus aureus subsp. aureus CIG1165 Diacylglycerol kinase (EC 2.7.1.107)
fig|931435.3.peg.2301 Staphylococcus aureus subsp. aureus CIG1214 Diacylglycerol kinase (EC 2.7.1.107)
fig|931436.3.peg.1682 Staphylococcus aureus subsp. aureus CIG1242 Diacylglycerol kinase (EC 2.7.1.107)
fig|931437.3.peg.2444 Staphylococcus aureus subsp. aureus CIG1500 Diacylglycerol kinase (EC 2.7.1.107)
fig|931438.3.peg.2354 Staphylococcus aureus subsp. aureus CIG1605 Diacylglycerol kinase (EC 2.7.1.107)
fig|931439.3.peg.2251 Staphylococcus aureus subsp. aureus CIG1750 Diacylglycerol kinase (EC 2.7.1.107)
fig|931440.3.peg.2096 Staphylococcus aureus subsp. aureus CIG1769 Diacylglycerol kinase (EC 2.7.1.107)
fig|931441.3.peg.1889 Staphylococcus aureus subsp. aureus CIG1835 Diacylglycerol kinase (EC 2.7.1.107)
fig|931442.3.peg.2177 Staphylococcus aureus subsp. aureus CIG547 Diacylglycerol kinase (EC 2.7.1.107)
fig|931444.3.peg.2076 Staphylococcus aureus subsp. aureus CIG1150 Diacylglycerol kinase (EC 2.7.1.107)
fig|931445.3.peg.2314 Staphylococcus aureus subsp. aureus CIG1176 Diacylglycerol kinase (EC 2.7.1.107)
fig|931446.3.peg.2062 Staphylococcus aureus subsp. aureus CIG1213 Diacylglycerol kinase (EC 2.7.1.107)
fig|931447.3.peg.2196 Staphylococcus aureus subsp. aureus CIG1233 Diacylglycerol kinase (EC 2.7.1.107)
fig|931451.3.peg.2149 Staphylococcus aureus subsp. aureus CIG290 Diacylglycerol kinase (EC 2.7.1.107)
fig|931452.3.peg.2153 Staphylococcus aureus subsp. aureus CIG1267 Diacylglycerol kinase (EC 2.7.1.107)
fig|931453.3.peg.2244 Staphylococcus aureus subsp. aureus CIG149 Diacylglycerol kinase (EC 2.7.1.107)
fig|931454.3.peg.1970 Staphylococcus aureus subsp. aureus CIG1524 Diacylglycerol kinase (EC 2.7.1.107)
fig|931455.3.peg.1955 Staphylococcus aureus subsp. aureus CIGC340D Diacylglycerol kinase (EC 2.7.1.107)
fig|931456.3.peg.2414 Staphylococcus aureus subsp. aureus CIGC341D Diacylglycerol kinase (EC 2.7.1.107)
fig|931457.3.peg.1994 Staphylococcus aureus subsp. aureus CIGC345D Diacylglycerol kinase (EC 2.7.1.107)
fig|931458.3.peg.2391 Staphylococcus aureus subsp. aureus CIGC348 Diacylglycerol kinase (EC 2.7.1.107)
fig|931459.3.peg.2053 Staphylococcus aureus subsp. aureus CIGC128 Diacylglycerol kinase (EC 2.7.1.107)
fig|948561.3.peg.735 Staphylococcus aureus O11 Diacylglycerol kinase (EC 2.7.1.107)
fig|948563.3.peg.851 Staphylococcus aureus O46 Diacylglycerol kinase (EC 2.7.1.107)
fig|985006.4.peg.1486 Staphylococcus aureus subsp. aureus LGA251 Diacylglycerol kinase (EC 2.7.1.107)