page	:SeedViewerServeFeature:
fid	:fig|93061.5.peg.98:
show_prot_sequence	:1:

>fig|93061.5.peg.98
MSNAERLSHFMSTNPEIRLWDILQTNFKAKALKEKVYIEYDKIKATLWNRRSMRVEFNPN
KLSHDEVLWLKQNIISYLDDVSFTRLDLAFDFEFDLNDYYALSDKSVKKTIFYGRNVKPE
TKYFGVRNSDRFIRIYNKNKNVKIMQMLKLIQHFYGVWKLN


PEGs with Identical Sequence
PEG Genome Function
fig|1028799.3.peg.95 Staphylococcus aureus subsp. aureus VC40 Replication initiation protein, topisomerase
fig|1112349.3.peg.1146 Staphylococcus aureus subsp. aureus NN50 Replication initiation protein, topisomerase
fig|1156994.3.peg.2349 Staphylococcus aureus HI049 Replication initiation protein, topisomerase
fig|1156996.3.peg.2361 Staphylococcus aureus HI049B Replication initiation protein, topisomerase
fig|1156997.3.peg.163 Staphylococcus aureus HI010B Replication initiation protein, topisomerase
fig|1156998.3.peg.2199 Staphylococcus aureus HIF003_B2N-C Replication initiation protein, topisomerase
fig|1156999.3.peg.101 Staphylococcus aureus HI022 Replication initiation protein, topisomerase
fig|1157000.3.peg.134 Staphylococcus aureus HI049C Replication initiation protein, topisomerase
fig|1157001.3.peg.707 Staphylococcus aureus HI168 Replication initiation protein, topisomerase
fig|1157002.3.peg.2526 Staphylococcus aureus HI111 Replication initiation protein, topisomerase
fig|1157003.3.peg.711 Staphylococcus aureus HI013 Replication initiation protein, topisomerase
fig|1157016.3.peg.941 Staphylococcus aureus M0221 Replication initiation protein, topisomerase
fig|1157024.3.peg.804 Staphylococcus aureus M0340 Replication initiation protein, topisomerase
fig|1157032.3.peg.2400 Staphylococcus aureus M0468 Replication initiation protein, topisomerase
fig|1158465.3.peg.682 Staphylococcus aureus M1064 Replication initiation protein, topisomerase
fig|1158495.3.peg.62 Staphylococcus aureus M1462 Replication initiation protein, topisomerase
fig|1158508.3.peg.62 Staphylococcus aureus M0055 Replication initiation protein, topisomerase
fig|1158530.3.peg.679 Staphylococcus aureus M0424 Replication initiation protein, topisomerase
fig|1158539.3.peg.93 Staphylococcus aureus M0633 Replication initiation protein, topisomerase
fig|1158683.3.peg.2306 Staphylococcus aureus M0531 Replication initiation protein, topisomerase
fig|1158707.3.peg.684 Staphylococcus aureus M1007 Replication initiation protein, topisomerase
fig|1169268.3.peg.680 Staphylococcus aureus M1223 Replication initiation protein, topisomerase
fig|1224928.3.peg.2426 Staphylococcus aureus M0312 Replication initiation protein, topisomerase
fig|1241616.3.peg.2176 Staphylococcus aureus subsp. aureus DSM 20231 Replication initiation protein, topisomerase
fig|1305598.3.peg.149 Staphylococcus aureus M1 Replication initiation protein, topisomerase
fig|426430.6.peg.92 Staphylococcus aureus subsp. aureus str. Newman Replication initiation protein, topisomerase
fig|426430.8.peg.96 Staphylococcus aureus subsp. aureus str. Newman Replication initiation protein, topisomerase
fig|451516.9.peg.190 Staphylococcus aureus subsp. aureus USA300_TCH1516 Replication initiation protein, topisomerase
fig|455227.3.peg.2574 Staphylococcus aureus D30 Replication initiation protein, topisomerase
fig|543539.3.peg.490 Staphylococcus aureus subsp. aureus CGS01 Replication initiation protein, topisomerase
fig|553590.4.peg.1145 Staphylococcus aureus A9754 Replication initiation protein, topisomerase
fig|553594.3.peg.2701 Staphylococcus aureus A9765 Replication initiation protein, topisomerase
fig|561307.5.peg.1267 Staphylococcus aureus subsp. aureus RN4220 Replication initiation protein, topisomerase
fig|644279.4.peg.215 Staphylococcus aureus subsp. aureus 132 Replication initiation protein, topisomerase
fig|754025.3.peg.400 Staphylococcus aureus subsp. aureus MRSA131 Replication initiation protein, topisomerase
fig|754026.3.peg.577 Staphylococcus aureus subsp. aureus MRSA177 Replication initiation protein, topisomerase
fig|904725.3.peg.246 Staphylococcus aureus subsp. aureus 21189 Replication initiation protein, topisomerase
fig|904726.3.peg.886 Staphylococcus aureus subsp. aureus 21193 Replication initiation protein, topisomerase
fig|904735.3.peg.894 Staphylococcus aureus subsp. aureus 21209 Replication initiation protein, topisomerase
fig|904737.3.peg.1975 Staphylococcus aureus subsp. aureus 21232 Replication initiation protein, topisomerase
fig|904753.3.peg.1069 Staphylococcus aureus subsp. aureus 21282 Replication initiation protein, topisomerase
fig|904754.3.peg.72 Staphylococcus aureus subsp. aureus 21283 Replication initiation protein, topisomerase
fig|904776.3.peg.1061 Staphylococcus aureus subsp. aureus IS-24 Replication initiation protein, topisomerase
fig|904778.3.peg.203 Staphylococcus aureus subsp. aureus IS-88 Replication initiation protein, topisomerase
fig|904779.3.peg.955 Staphylococcus aureus subsp. aureus IS-91 Replication initiation protein, topisomerase
fig|904782.3.peg.2749 Staphylococcus aureus subsp. aureus IS-111 Replication initiation protein, topisomerase
fig|904795.7.peg.171 Staphylococcus aureus subsp. aureus CO-23 Replication initiation protein, topisomerase
fig|93061.3.peg.123 Staphylococcus aureus subsp. aureus NCTC 8325 Replication initiation protein, topisomerase
fig|93061.5.peg.98 Staphylococcus aureus subsp. aureus NCTC 8325 Replication initiation protein, topisomerase
fig|931448.3.peg.583 Staphylococcus aureus subsp. aureus CIG1612 Replication initiation protein, topisomerase
fig|931449.3.peg.604 Staphylococcus aureus subsp. aureus CIG1770 Replication initiation protein, topisomerase
fig|931450.3.peg.680 Staphylococcus aureus subsp. aureus CIG2018 Replication initiation protein, topisomerase
fig|931457.3.peg.895 Staphylococcus aureus subsp. aureus CIGC345D Replication initiation protein, topisomerase