page	:SeedViewerServeFeature:
fid	:fig|93061.5.peg.971:
show_prot_sequence	:1:

>fig|93061.5.peg.971
MTNKREDVRNIAIIAHVDHGKTTLVDELLKQSGIFRENEHVDERAMDSNDIERERGITIL
AKNTAVDYKGTRINILDTPGHADFGGEVERIMKMVDGVVLVVDAYEGTMPQTRFVLKKAL
EQNLKPVVVVNKIDKPSARPEGVVDEVLDLFIELEANDEQLEFPVVYASAVNGTASLDPE
KQDDNLQSLYETIIDYVPAPIDNSDEPLQFQVALLDYNDYVGRIGIGRVFRGKMRVGDNV
SLIKLDGTVKNFRVTKIFGYFGLKRLEIEEAQAGDLIAVSGMEDINVGETVTPHDHQEAL
PVLRIDEPTLEMTFKVNNSPFAGREGDFVTARQIQERLNQQLETDVSLKVSNTDSPDTWV
VAGRGELHLSILIENMRREGYELQVSKPQVIIKEIDGVMCEPFERVQCEVPQENAGAVIE
SLGARKGEMVDMTTTDNGLTRLIFNVPARGMIGYTTEFMSMTRGYGIINHTFEEFRPRIK
AQIGGRRNGALISMDQGSASTYAILGLEDRGVNFMEPGTEVYEGMIVGEHNRENDLTVNI
TKTKHQTNVRSATKDQTQTMNRPRILTLEEALQFINDDELVEVTPESIRLRKKILNKNVR
EKEAKRIKQMMQENE


PEGs with Identical Sequence
PEG Genome Function
fig|1006543.3.peg.1065 Staphylococcus aureus subsp. aureus T0131 GTP-binding protein TypA/BipA
fig|1028799.3.peg.936 Staphylococcus aureus subsp. aureus VC40 GTP-binding protein TypA/BipA
fig|1074252.3.peg.954 Staphylococcus aureus subsp. aureus HO 5096 0412 GTP-binding protein TypA/BipA
fig|1075076.3.peg.969 Staphylococcus aureus ST228/10388 GTP-binding protein TypA/BipA
fig|1075077.3.peg.973 Staphylococcus aureus ST228/10497 GTP-binding protein TypA/BipA
fig|1075078.3.peg.968 Staphylococcus aureus ST228/15532 GTP-binding protein TypA/BipA
fig|1075079.3.peg.965 Staphylococcus aureus ST228/16035 GTP-binding protein TypA/BipA
fig|1075082.3.peg.970 Staphylococcus aureus ST228/18412 GTP-binding protein TypA/BipA
fig|1112349.3.peg.631 Staphylococcus aureus subsp. aureus NN50 GTP-binding protein TypA/BipA
fig|1116215.3.peg.972 Staphylococcus aureus subsp. aureus VRS2 GTP-binding protein TypA/BipA
fig|1116216.3.peg.942 Staphylococcus aureus subsp. aureus VRS3a GTP-binding protein TypA/BipA
fig|1116222.3.peg.997 Staphylococcus aureus subsp. aureus VRS9 GTP-binding protein TypA/BipA
fig|1116223.3.peg.986 Staphylococcus aureus subsp. aureus VRS10 GTP-binding protein TypA/BipA
fig|1123523.3.peg.1044 Staphylococcus aureus subsp. aureus 11819-97 GTP-binding protein TypA/BipA
fig|1134842.3.peg.2542 Staphylococcus aureus subsp. aureus CM05 GTP-binding protein TypA/BipA
fig|1137129.3.peg.1782 Staphylococcus aureus subsp. aureus 091751 GTP-binding protein TypA/BipA
fig|1137130.3.peg.1509 Staphylococcus aureus subsp. aureus 103564 GTP-binding protein TypA/BipA
fig|1137133.3.peg.1811 Staphylococcus aureus subsp. aureus MRGR3 GTP-binding protein TypA/BipA
fig|1144271.3.peg.660 Staphylococcus aureus subsp. aureus 118 GTP-binding protein TypA/BipA
fig|1144272.3.peg.660 Staphylococcus aureus subsp. aureus GR1 GTP-binding protein TypA/BipA
fig|1155079.3.peg.547 Staphylococcus aureus subsp. aureus DR10 GTP-binding protein TypA/BipA
fig|1155084.3.peg.924 Staphylococcus aureus subsp. aureus 71193 GTP-binding protein TypA/BipA
fig|1156994.3.peg.537 Staphylococcus aureus HI049 GTP-binding protein TypA/BipA
fig|1156995.3.peg.1698 Staphylococcus aureus HI010 GTP-binding protein TypA/BipA
fig|1156996.3.peg.538 Staphylococcus aureus HI049B GTP-binding protein TypA/BipA
fig|1156997.3.peg.1054 Staphylococcus aureus HI010B GTP-binding protein TypA/BipA
fig|1156998.3.peg.518 Staphylococcus aureus HIF003_B2N-C GTP-binding protein TypA/BipA
fig|1156999.3.peg.989 Staphylococcus aureus HI022 GTP-binding protein TypA/BipA
fig|1157000.3.peg.1027 Staphylococcus aureus HI049C GTP-binding protein TypA/BipA
fig|1157001.3.peg.1574 Staphylococcus aureus HI168 GTP-binding protein TypA/BipA
fig|1157002.3.peg.747 Staphylococcus aureus HI111 GTP-binding protein TypA/BipA
fig|1157003.3.peg.1600 Staphylococcus aureus HI013 GTP-binding protein TypA/BipA
fig|1157010.3.peg.943 Staphylococcus aureus M0102 GTP-binding protein TypA/BipA
fig|1157016.3.peg.1852 Staphylococcus aureus M0221 GTP-binding protein TypA/BipA
fig|1157017.3.peg.1095 Staphylococcus aureus M0237 GTP-binding protein TypA/BipA
fig|1157018.3.peg.500 Staphylococcus aureus M0239 GTP-binding protein TypA/BipA
fig|1157022.3.peg.1040 Staphylococcus aureus M0329 GTP-binding protein TypA/BipA
fig|1157024.3.peg.1713 Staphylococcus aureus M0340 GTP-binding protein TypA/BipA
fig|1157027.3.peg.1622 Staphylococcus aureus M0391 GTP-binding protein TypA/BipA
fig|1157032.3.peg.547 Staphylococcus aureus M0468 GTP-binding protein TypA/BipA
fig|1157035.3.peg.496 Staphylococcus aureus M0494 GTP-binding protein TypA/BipA
fig|1158465.3.peg.1578 Staphylococcus aureus M1064 GTP-binding protein TypA/BipA
fig|1158466.3.peg.1657 Staphylococcus aureus M1092 GTP-binding protein TypA/BipA
fig|1158477.3.peg.492 Staphylococcus aureus M1216 GTP-binding protein TypA/BipA
fig|1158485.3.peg.2149 Staphylococcus aureus M1311 GTP-binding protein TypA/BipA
fig|1158487.3.peg.1020 Staphylococcus aureus M1321 GTP-binding protein TypA/BipA
fig|1158495.3.peg.1003 Staphylococcus aureus M1462 GTP-binding protein TypA/BipA
fig|1158500.3.peg.874 Staphylococcus aureus M1531 GTP-binding protein TypA/BipA
fig|1158504.3.peg.1191 Staphylococcus aureus M1563 GTP-binding protein TypA/BipA
fig|1158508.3.peg.948 Staphylococcus aureus M0055 GTP-binding protein TypA/BipA
fig|1158510.3.peg.995 Staphylococcus aureus M0108 GTP-binding protein TypA/BipA
fig|1158521.3.peg.1083 Staphylococcus aureus M0306 GTP-binding protein TypA/BipA
fig|1158529.3.peg.1170 Staphylococcus aureus M0396 GTP-binding protein TypA/BipA
fig|1158530.3.peg.1605 Staphylococcus aureus M0424 GTP-binding protein TypA/BipA
fig|1158539.3.peg.982 Staphylococcus aureus M0633 GTP-binding protein TypA/BipA
fig|1158683.3.peg.520 Staphylococcus aureus M0531 GTP-binding protein TypA/BipA
fig|1158684.3.peg.1044 Staphylococcus aureus M0536 GTP-binding protein TypA/BipA
fig|1158707.3.peg.1603 Staphylococcus aureus M1007 GTP-binding protein TypA/BipA
fig|1158709.3.peg.1145 Staphylococcus aureus M1015 GTP-binding protein TypA/BipA
fig|1161392.3.peg.842 Staphylococcus aureus NN54 GTP-binding protein TypA/BipA
fig|1169268.3.peg.1587 Staphylococcus aureus M1223 GTP-binding protein TypA/BipA
fig|1169277.3.peg.971 Staphylococcus aureus M1510 GTP-binding protein TypA/BipA
fig|1213725.3.peg.1001 Staphylococcus aureus M0695 GTP-binding protein TypA/BipA
fig|1213728.3.peg.534 Staphylococcus aureus M0831 GTP-binding protein TypA/BipA
fig|1216363.3.peg.1094 Staphylococcus aureus subsp. aureus 06BA18369 GTP-binding protein TypA/BipA
fig|1221451.3.peg.884 Staphylococcus aureus subsp. aureus 120 GTP-binding protein TypA/BipA
fig|1221452.3.peg.428 Staphylococcus aureus subsp. aureus 333 GTP-binding protein TypA/BipA
fig|1221453.3.peg.802 Staphylococcus aureus subsp. aureus 3989 GTP-binding protein TypA/BipA
fig|1224923.3.peg.986 Staphylococcus aureus M0240 GTP-binding protein TypA/BipA
fig|1224928.3.peg.565 Staphylococcus aureus M0312 GTP-binding protein TypA/BipA
fig|1224929.3.peg.771 Staphylococcus aureus M0404 GTP-binding protein TypA/BipA
fig|1224931.3.peg.531 Staphylococcus aureus M0455 GTP-binding protein TypA/BipA
fig|1226740.3.peg.967 Staphylococcus aureus subsp. aureus VH60 GTP-binding protein TypA/BipA
fig|1229492.3.peg.1069 Staphylococcus aureus 08BA02176 GTP-binding protein TypA/BipA
fig|1231382.3.peg.1891 Staphylococcus aureus KT/Y21 GTP-binding protein TypA/BipA
fig|1231383.3.peg.1982 Staphylococcus aureus KT/314250 GTP-binding protein TypA/BipA
fig|1235275.3.peg.1121 Staphylococcus aureus PPUKM-261-2009 GTP-binding protein TypA/BipA
fig|1235276.3.peg.1132 Staphylococcus aureus PPUKM-332-2009 GTP-binding protein TypA/BipA
fig|1235277.3.peg.1061 Staphylococcus aureus PPUKM-377-2009 GTP-binding protein TypA/BipA
fig|1235278.3.peg.1020 Staphylococcus aureus PPUKM-775-2009 GTP-binding protein TypA/BipA
fig|1241616.3.peg.568 Staphylococcus aureus subsp. aureus DSM 20231 GTP-binding protein TypA/BipA
fig|1242970.3.peg.1041 Staphylococcus aureus CN79 GTP-binding protein TypA/BipA
fig|1278071.4.peg.1677 Staphylococcus aureus 3957 GTP-binding protein TypA/BipA
fig|1278072.4.peg.1263 Staphylococcus aureus LVP2 GTP-binding protein TypA/BipA
fig|1278074.4.peg.1685 Staphylococcus aureus VH221 GTP-binding protein TypA/BipA
fig|1278075.4.peg.1480 Staphylococcus aureus LVP5 GTP-binding protein TypA/BipA
fig|1283278.3.peg.965 Staphylococcus aureus KLT6 GTP-binding protein TypA/BipA
fig|1288493.3.peg.2308 Staphylococcus aureus subsp. aureus S1800 GTP-binding protein TypA/BipA
fig|1303785.3.peg.1618 Staphylococcus aureus M1228 GTP-binding protein TypA/BipA
fig|1323661.3.peg.997 Staphylococcus aureus CA-347 GTP-binding protein TypA/BipA
fig|158878.1.peg.1109 Staphylococcus aureus subsp. aureus Mu50 GTP-binding protein TypA/BipA
fig|158878.14.peg.1137 Staphylococcus aureus subsp. aureus Mu50 GTP-binding protein TypA/BipA
fig|158879.1.peg.989 Staphylococcus aureus subsp. aureus N315 GTP-binding protein TypA/BipA
fig|158879.11.peg.1025 Staphylococcus aureus subsp. aureus N315 GTP-binding protein TypA/BipA
fig|196620.1.peg.992 Staphylococcus aureus subsp. aureus MW2 GTP-binding protein TypA/BipA
fig|196620.5.peg.1041 Staphylococcus aureus subsp. aureus MW2 GTP-binding protein TypA/BipA
fig|282459.1.peg.1035 Staphylococcus aureus subsp. aureus MSSA476 GTP-binding protein TypA/BipA
fig|282459.5.peg.1083 Staphylococcus aureus subsp. aureus MSSA476 GTP-binding protein TypA/BipA
fig|367830.3.peg.2062 Staphylococcus aureus subsp. aureus USA300 GTP-binding protein TypA/BipA
fig|418127.4.peg.1015 Staphylococcus aureus subsp. aureus Mu3 GTP-binding protein TypA/BipA
fig|418127.6.peg.1119 Staphylococcus aureus subsp. aureus Mu3 GTP-binding protein TypA/BipA
fig|426430.6.peg.944 Staphylococcus aureus subsp. aureus str. Newman GTP-binding protein TypA/BipA
fig|426430.8.peg.1055 Staphylococcus aureus subsp. aureus str. Newman GTP-binding protein TypA/BipA
fig|450394.6.peg.300 Staphylococcus aureus subsp. aureus USA300_TCH959 GTP-binding protein TypA/BipA
fig|451515.3.peg.1107 Staphylococcus aureus subsp. aureus USA300_FPR3757 GTP-binding protein TypA/BipA
fig|451516.9.peg.1111 Staphylococcus aureus subsp. aureus USA300_TCH1516 GTP-binding protein TypA/BipA
fig|452948.4.peg.1353 Staphylococcus aureus 930918-3 GTP-binding protein TypA/BipA
fig|455227.3.peg.663 Staphylococcus aureus D30 GTP-binding protein TypA/BipA
fig|505321.3.peg.2292 Staphylococcus aureus subsp. aureus str. CF-Marseille GTP-binding protein TypA/BipA
fig|543539.3.peg.2421 Staphylococcus aureus subsp. aureus CGS01 GTP-binding protein TypA/BipA
fig|546342.3.peg.1728 Staphylococcus aureus subsp. aureus str. JKD6008 GTP-binding protein TypA/BipA
fig|546342.4.peg.1125 Staphylococcus aureus subsp. aureus str. JKD6008 GTP-binding protein TypA/BipA
fig|546343.3.peg.506 Staphylococcus aureus subsp. aureus str. JKD6009 GTP-binding protein TypA/BipA
fig|548474.3.peg.1206 Staphylococcus aureus subsp. aureus TCH130 GTP-binding protein TypA/BipA
fig|548475.3.peg.1340 Staphylococcus aureus subsp. aureus TCH70 GTP-binding protein TypA/BipA
fig|553565.3.peg.1694 Staphylococcus aureus A5937 GTP-binding protein TypA/BipA
fig|553567.3.peg.1437 Staphylococcus aureus A5948 GTP-binding protein TypA/BipA
fig|553573.3.peg.1156 Staphylococcus aureus A8115 GTP-binding protein TypA/BipA
fig|553574.3.peg.1472 Staphylococcus aureus A8117 GTP-binding protein TypA/BipA
fig|553581.3.peg.1168 Staphylococcus aureus A9299 GTP-binding protein TypA/BipA
fig|553583.3.peg.1132 Staphylococcus aureus A9635 GTP-binding protein TypA/BipA
fig|553590.4.peg.155 Staphylococcus aureus A9754 GTP-binding protein TypA/BipA
fig|553592.3.peg.258 Staphylococcus aureus A9763 GTP-binding protein TypA/BipA
fig|553594.3.peg.2145 Staphylococcus aureus A9765 GTP-binding protein TypA/BipA
fig|561307.5.peg.530 Staphylococcus aureus subsp. aureus RN4220 GTP-binding protein TypA/BipA
fig|585152.3.peg.958 Staphylococcus aureus subsp. aureus D139 GTP-binding protein TypA/BipA
fig|585891.3.peg.1134 Staphylococcus aureus subsp. aureus Mu50-omega GTP-binding protein TypA/BipA
fig|644279.4.peg.1116 Staphylococcus aureus subsp. aureus 132 GTP-binding protein TypA/BipA
fig|663951.4.peg.1176 Staphylococcus aureus subsp. aureus TW20 GTP-binding protein TypA/BipA
fig|680649.3.peg.1410 Staphylococcus aureus subsp. aureus MR1 GTP-binding protein TypA/BipA
fig|681288.4.peg.1080 Staphylococcus aureus subsp. aureus ED98 GTP-binding protein TypA/BipA
fig|754025.3.peg.657 Staphylococcus aureus subsp. aureus MRSA131 GTP-binding protein TypA/BipA
fig|754026.3.peg.1284 Staphylococcus aureus subsp. aureus MRSA177 GTP-binding protein TypA/BipA
fig|762962.3.peg.956 Staphylococcus aureus subsp. aureus ATCC 51811 GTP-binding protein TypA/BipA
fig|862516.3.peg.2219 Staphylococcus aureus subsp. aureus ATCC BAA-39 GTP-binding protein TypA/BipA
fig|889933.4.peg.942 Staphylococcus aureus subsp. aureus ECT-R 2 GTP-binding protein TypA/BipA
fig|904313.3.peg.1657 Staphylococcus aureus subsp. aureus VCU006 GTP-binding protein TypA/BipA
fig|904724.3.peg.21 Staphylococcus aureus subsp. aureus 21178 GTP-binding protein TypA/BipA
fig|904725.3.peg.670 Staphylococcus aureus subsp. aureus 21189 GTP-binding protein TypA/BipA
fig|904727.3.peg.85 Staphylococcus aureus subsp. aureus 21194 GTP-binding protein TypA/BipA
fig|904729.3.peg.2539 Staphylococcus aureus subsp. aureus 21196 GTP-binding protein TypA/BipA
fig|904730.3.peg.2215 Staphylococcus aureus subsp. aureus 21200 GTP-binding protein TypA/BipA
fig|904731.3.peg.2089 Staphylococcus aureus subsp. aureus 21201 GTP-binding protein TypA/BipA
fig|904732.3.peg.1320 Staphylococcus aureus subsp. aureus 21202 GTP-binding protein TypA/BipA
fig|904735.3.peg.478 Staphylococcus aureus subsp. aureus 21209 GTP-binding protein TypA/BipA
fig|904737.3.peg.535 Staphylococcus aureus subsp. aureus 21232 GTP-binding protein TypA/BipA
fig|904739.3.peg.566 Staphylococcus aureus subsp. aureus 21236 GTP-binding protein TypA/BipA
fig|904743.3.peg.718 Staphylococcus aureus subsp. aureus 21252 GTP-binding protein TypA/BipA
fig|904744.3.peg.1952 Staphylococcus aureus subsp. aureus 21259 GTP-binding protein TypA/BipA
fig|904747.3.peg.1453 Staphylococcus aureus subsp. aureus 21266 GTP-binding protein TypA/BipA
fig|904750.3.peg.1361 Staphylococcus aureus subsp. aureus 21272 GTP-binding protein TypA/BipA
fig|904753.3.peg.103 Staphylococcus aureus subsp. aureus 21282 GTP-binding protein TypA/BipA
fig|904754.3.peg.1797 Staphylococcus aureus subsp. aureus 21283 GTP-binding protein TypA/BipA
fig|904760.3.peg.1163 Staphylococcus aureus subsp. aureus 21310 GTP-binding protein TypA/BipA
fig|904763.3.peg.146 Staphylococcus aureus subsp. aureus 21318 GTP-binding protein TypA/BipA
fig|904766.3.peg.392 Staphylococcus aureus subsp. aureus 21331 GTP-binding protein TypA/BipA
fig|904767.3.peg.2454 Staphylococcus aureus subsp. aureus 21333 GTP-binding protein TypA/BipA
fig|904768.3.peg.652 Staphylococcus aureus subsp. aureus 21334 GTP-binding protein TypA/BipA
fig|904771.3.peg.1980 Staphylococcus aureus subsp. aureus 21340 GTP-binding protein TypA/BipA
fig|904773.3.peg.402 Staphylococcus aureus subsp. aureus 21343 GTP-binding protein TypA/BipA
fig|904776.3.peg.2233 Staphylococcus aureus subsp. aureus IS-24 GTP-binding protein TypA/BipA
fig|904777.3.peg.1258 Staphylococcus aureus subsp. aureus IS-55 GTP-binding protein TypA/BipA
fig|904778.3.peg.1393 Staphylococcus aureus subsp. aureus IS-88 GTP-binding protein TypA/BipA
fig|904779.3.peg.429 Staphylococcus aureus subsp. aureus IS-91 GTP-binding protein TypA/BipA
fig|904781.3.peg.629 Staphylococcus aureus subsp. aureus IS-105 GTP-binding protein TypA/BipA
fig|904782.3.peg.2410 Staphylococcus aureus subsp. aureus IS-111 GTP-binding protein TypA/BipA
fig|904783.3.peg.1742 Staphylococcus aureus subsp. aureus IS-122 GTP-binding protein TypA/BipA
fig|904784.3.peg.1323 Staphylococcus aureus subsp. aureus IS-125 GTP-binding protein TypA/BipA
fig|904785.3.peg.1720 Staphylococcus aureus subsp. aureus IS-157 GTP-binding protein TypA/BipA
fig|904787.3.peg.1768 Staphylococcus aureus subsp. aureus IS-189 GTP-binding protein TypA/BipA
fig|904795.7.peg.2240 Staphylococcus aureus subsp. aureus CO-23 GTP-binding protein TypA/BipA
fig|908247.3.peg.1895 Staphylococcus aureus 16K GTP-binding protein TypA/BipA
fig|93061.3.peg.1014 Staphylococcus aureus subsp. aureus NCTC 8325 GTP-binding protein TypA/BipA
fig|93061.5.peg.971 Staphylococcus aureus subsp. aureus NCTC 8325 GTP-binding protein TypA/BipA
fig|931433.3.peg.1595 Staphylococcus aureus subsp. aureus CIG1114 GTP-binding protein TypA/BipA
fig|931441.3.peg.1189 Staphylococcus aureus subsp. aureus CIG1835 GTP-binding protein TypA/BipA
fig|931442.3.peg.1712 Staphylococcus aureus subsp. aureus CIG547 GTP-binding protein TypA/BipA
fig|931444.3.peg.1611 Staphylococcus aureus subsp. aureus CIG1150 GTP-binding protein TypA/BipA
fig|931448.3.peg.1624 Staphylococcus aureus subsp. aureus CIG1612 GTP-binding protein TypA/BipA
fig|931449.3.peg.1600 Staphylococcus aureus subsp. aureus CIG1770 GTP-binding protein TypA/BipA
fig|931450.3.peg.1377 Staphylococcus aureus subsp. aureus CIG2018 GTP-binding protein TypA/BipA
fig|931451.3.peg.1585 Staphylococcus aureus subsp. aureus CIG290 GTP-binding protein TypA/BipA
fig|931454.3.peg.1498 Staphylococcus aureus subsp. aureus CIG1524 GTP-binding protein TypA/BipA
fig|931455.3.peg.1488 Staphylococcus aureus subsp. aureus CIGC340D GTP-binding protein TypA/BipA
fig|931457.3.peg.1522 Staphylococcus aureus subsp. aureus CIGC345D GTP-binding protein TypA/BipA
fig|931459.3.peg.1459 Staphylococcus aureus subsp. aureus CIGC128 GTP-binding protein TypA/BipA
fig|931460.3.peg.1150 Staphylococcus aureus subsp. aureus CIGC93 GTP-binding protein TypA/BipA
fig|985002.3.peg.963 Staphylococcus aureus subsp. aureus MSHR1132 GTP-binding protein TypA/BipA