page	:SeedViewerServeFeature:
fid	:fig|93061.5.peg.2698:
show_prot_sequence	:1:

>fig|93061.5.peg.2698
MNYSPKQGVRSHGLPHDPFKSSTVPRPIGWISTVSKDGKDNLAPYSQYQNLTWDPPMVMF
AANQSVLGDHERKDTVKNAEETGWFVWNMATYDLREAVNLSSKALPPEEDEFNFAGVTKE
KCIEAPGYRVKESPVHFECEYVQTIRIPTGDPVSTVDIVIGRVAQVHIDDKVILDNGKLD
IKSIKPIARLGYYDYTVVNEIFEMKAPAASKEELAGLEGRNFDNQSDEKI


PEGs with Identical Sequence
PEG Genome Function
fig|1028799.3.peg.2418 Staphylococcus aureus subsp. aureus VC40 FIG01107912: hypothetical protein
fig|1112349.3.peg.1251 Staphylococcus aureus subsp. aureus NN50 FIG01107912: hypothetical protein
fig|1123523.3.peg.2588 Staphylococcus aureus subsp. aureus 11819-97 FIG01107912: hypothetical protein
fig|1137130.3.peg.60 Staphylococcus aureus subsp. aureus 103564 FIG01107912: hypothetical protein
fig|1144272.3.peg.1177 Staphylococcus aureus subsp. aureus GR1 FIG01107912: hypothetical protein
fig|1156998.3.peg.2044 Staphylococcus aureus HIF003_B2N-C FIG01107912: hypothetical protein
fig|1157016.3.peg.752 Staphylococcus aureus M0221 FIG01107912: hypothetical protein
fig|1157024.3.peg.620 Staphylococcus aureus M0340 FIG01107912: hypothetical protein
fig|1157032.3.peg.2210 Staphylococcus aureus M0468 FIG01107912: hypothetical protein
fig|1158465.3.peg.499 Staphylococcus aureus M1064 FIG01107912: hypothetical protein
fig|1158495.3.peg.2602 Staphylococcus aureus M1462 FIG01107912: hypothetical protein
fig|1158508.3.peg.2558 Staphylococcus aureus M0055 FIG01107912: hypothetical protein
fig|1158530.3.peg.491 Staphylococcus aureus M0424 FIG01107912: hypothetical protein
fig|1158539.3.peg.2667 Staphylococcus aureus M0633 FIG01107912: hypothetical protein
fig|1158683.3.peg.2120 Staphylococcus aureus M0531 FIG01107912: hypothetical protein
fig|1158707.3.peg.495 Staphylococcus aureus M1007 FIG01107912: hypothetical protein
fig|1169268.3.peg.488 Staphylococcus aureus M1223 FIG01107912: hypothetical protein
fig|1213728.3.peg.2227 Staphylococcus aureus M0831 FIG01107912: hypothetical protein
fig|1224928.3.peg.2244 Staphylococcus aureus M0312 FIG01107912: hypothetical protein
fig|1231383.3.peg.881 Staphylococcus aureus KT/314250 FIG01107912: hypothetical protein
fig|1241616.3.peg.2020 Staphylococcus aureus subsp. aureus DSM 20231 FIG01107912: hypothetical protein
fig|1265302.3.peg.2473 Staphylococcus aureus subsp. aureus PB32 FIG01107912: hypothetical protein
fig|1278074.4.peg.1015 Staphylococcus aureus VH221 FIG01107912: hypothetical protein
fig|1278075.4.peg.2239 Staphylococcus aureus LVP5 FIG01107912: hypothetical protein
fig|1288493.3.peg.1648 Staphylococcus aureus subsp. aureus S1800 FIG01107912: hypothetical protein
fig|1305598.3.peg.2632 Staphylococcus aureus M1 FIG01107912: hypothetical protein
fig|196620.1.peg.2576 Staphylococcus aureus subsp. aureus MW2 FIG01107912: hypothetical protein
fig|196620.5.peg.2661 Staphylococcus aureus subsp. aureus MW2 FIG01107912: hypothetical protein
fig|282459.1.peg.2521 Staphylococcus aureus subsp. aureus MSSA476 FIG01107912: hypothetical protein
fig|282459.5.peg.2646 Staphylococcus aureus subsp. aureus MSSA476 FIG01107912: hypothetical protein
fig|426430.6.peg.2466 Staphylococcus aureus subsp. aureus str. Newman FIG01107912: hypothetical protein
fig|426430.8.peg.2767 Staphylococcus aureus subsp. aureus str. Newman FIG01107912: hypothetical protein
fig|450394.6.peg.1661 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG01107912: hypothetical protein
fig|452948.4.peg.1041 Staphylococcus aureus 930918-3 FIG01107912: hypothetical protein
fig|455227.3.peg.1518 Staphylococcus aureus D30 FIG01107912: hypothetical protein
fig|548475.3.peg.1511 Staphylococcus aureus subsp. aureus TCH70 FIG01107912: hypothetical protein
fig|553567.3.peg.917 Staphylococcus aureus A5948 FIG01107912: hypothetical protein
fig|553594.3.peg.623 Staphylococcus aureus A9765 FIG01107912: hypothetical protein
fig|561307.5.peg.794 Staphylococcus aureus subsp. aureus RN4220 FIG01107912: hypothetical protein
fig|644279.4.peg.26 Staphylococcus aureus subsp. aureus 132 FIG01107912: hypothetical protein
fig|754025.3.peg.280 Staphylococcus aureus subsp. aureus MRSA131 FIG01107912: hypothetical protein
fig|754026.3.peg.308 Staphylococcus aureus subsp. aureus MRSA177 FIG01107912: hypothetical protein
fig|762962.3.peg.1850 Staphylococcus aureus subsp. aureus ATCC 51811 FIG01107912: hypothetical protein
fig|904725.3.peg.402 Staphylococcus aureus subsp. aureus 21189 FIG01107912: hypothetical protein
fig|904729.3.peg.977 Staphylococcus aureus subsp. aureus 21196 FIG01107912: hypothetical protein
fig|904735.3.peg.2512 Staphylococcus aureus subsp. aureus 21209 FIG01107912: hypothetical protein
fig|904737.3.peg.985 Staphylococcus aureus subsp. aureus 21232 FIG01107912: hypothetical protein
fig|904753.3.peg.1118 Staphylococcus aureus subsp. aureus 21282 FIG01107912: hypothetical protein
fig|904754.3.peg.889 Staphylococcus aureus subsp. aureus 21283 FIG01107912: hypothetical protein
fig|904767.3.peg.1776 Staphylococcus aureus subsp. aureus 21333 FIG01107912: hypothetical protein
fig|904768.3.peg.353 Staphylococcus aureus subsp. aureus 21334 FIG01107912: hypothetical protein
fig|904773.3.peg.664 Staphylococcus aureus subsp. aureus 21343 FIG01107912: hypothetical protein
fig|93061.3.peg.2832 Staphylococcus aureus subsp. aureus NCTC 8325 FIG01107912: hypothetical protein
fig|93061.5.peg.2698 Staphylococcus aureus subsp. aureus NCTC 8325 FIG01107912: hypothetical protein
fig|93062.19.peg.2603 Staphylococcus aureus subsp. aureus COL FIG01107912: hypothetical protein
fig|93062.4.peg.2165 Staphylococcus aureus subsp. aureus COL FIG01107912: hypothetical protein
fig|931433.3.peg.516 Staphylococcus aureus subsp. aureus CIG1114 FIG01107912: hypothetical protein
fig|931441.3.peg.183 Staphylococcus aureus subsp. aureus CIG1835 FIG01107912: hypothetical protein
fig|931442.3.peg.489 Staphylococcus aureus subsp. aureus CIG547 FIG01107912: hypothetical protein
fig|931448.3.peg.491 Staphylococcus aureus subsp. aureus CIG1612 FIG01107912: hypothetical protein
fig|931449.3.peg.513 Staphylococcus aureus subsp. aureus CIG1770 FIG01107912: hypothetical protein
fig|931450.3.peg.489 Staphylococcus aureus subsp. aureus CIG2018 FIG01107912: hypothetical protein
fig|931457.3.peg.1094 Staphylococcus aureus subsp. aureus CIGC345D FIG01107912: hypothetical protein
fig|931459.3.peg.470 Staphylococcus aureus subsp. aureus CIGC128 FIG01107912: hypothetical protein