page	:SeedViewerServeFeature:
fid	:fig|93061.5.peg.234:
show_prot_sequence	:1:

>fig|93061.5.peg.234
MIIFILITIFAIYYIAMIASLFKSEGFSIIGLILDVVIMGTLIFYYFIGARFVDHDLSNF
LMFMDTGSYIFMYFAIKCLWVKPKVVNYLIAKELGESKEVIEEQELDLQTSKIRGIYFFI
ISVVMLIITKLRMQPELQADAISMNPVFIFVGVIIILIWLVLDIYRKKKYGIFLFKTIVP
LVVTTWIIIATIILS


PEGs with Identical Sequence
PEG Genome Function
fig|1028799.3.peg.226 Staphylococcus aureus subsp. aureus VC40 FIG01108751: hypothetical protein
fig|1112349.3.peg.1015 Staphylococcus aureus subsp. aureus NN50 FIG01108751: hypothetical protein
fig|1156994.3.peg.2480 Staphylococcus aureus HI049 FIG01108751: hypothetical protein
fig|1156995.3.peg.940 Staphylococcus aureus HI010 FIG01108751: hypothetical protein
fig|1156996.3.peg.2492 Staphylococcus aureus HI049B FIG01108751: hypothetical protein
fig|1156997.3.peg.294 Staphylococcus aureus HI010B FIG01108751: hypothetical protein
fig|1156998.3.peg.2332 Staphylococcus aureus HIF003_B2N-C FIG01108751: hypothetical protein
fig|1156999.3.peg.232 Staphylococcus aureus HI022 FIG01108751: hypothetical protein
fig|1157000.3.peg.266 Staphylococcus aureus HI049C FIG01108751: hypothetical protein
fig|1157001.3.peg.838 Staphylococcus aureus HI168 FIG01108751: hypothetical protein
fig|1157003.3.peg.842 Staphylococcus aureus HI013 FIG01108751: hypothetical protein
fig|1157016.3.peg.1074 Staphylococcus aureus M0221 FIG01108751: hypothetical protein
fig|1157024.3.peg.936 Staphylococcus aureus M0340 FIG01108751: hypothetical protein
fig|1157032.3.peg.2533 Staphylococcus aureus M0468 FIG01108751: hypothetical protein
fig|1158465.3.peg.814 Staphylococcus aureus M1064 FIG01108751: hypothetical protein
fig|1158477.3.peg.2377 Staphylococcus aureus M1216 FIG01108751: hypothetical protein
fig|1158495.3.peg.195 Staphylococcus aureus M1462 FIG01108751: hypothetical protein
fig|1158508.3.peg.192 Staphylococcus aureus M0055 FIG01108751: hypothetical protein
fig|1158530.3.peg.812 Staphylococcus aureus M0424 FIG01108751: hypothetical protein
fig|1158539.3.peg.224 Staphylococcus aureus M0633 FIG01108751: hypothetical protein
fig|1158683.3.peg.2437 Staphylococcus aureus M0531 FIG01108751: hypothetical protein
fig|1158707.3.peg.817 Staphylococcus aureus M1007 FIG01108751: hypothetical protein
fig|1169268.3.peg.811 Staphylococcus aureus M1223 FIG01108751: hypothetical protein
fig|1213728.3.peg.2549 Staphylococcus aureus M0831 FIG01108751: hypothetical protein
fig|1224928.3.peg.2558 Staphylococcus aureus M0312 FIG01108751: hypothetical protein
fig|1241616.3.peg.2305 Staphylococcus aureus subsp. aureus DSM 20231 FIG01108751: hypothetical protein
fig|1305598.3.peg.281 Staphylococcus aureus M1 FIG01108751: hypothetical protein
fig|367830.3.peg.2205 Staphylococcus aureus subsp. aureus USA300 FIG01108751: hypothetical protein
fig|426430.6.peg.217 Staphylococcus aureus subsp. aureus str. Newman FIG01108751: hypothetical protein
fig|426430.8.peg.232 Staphylococcus aureus subsp. aureus str. Newman FIG01108751: hypothetical protein
fig|451515.3.peg.338 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG01108751: hypothetical protein
fig|451516.9.peg.328 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG01108751: hypothetical protein
fig|452948.4.peg.2260 Staphylococcus aureus 930918-3 FIG01108751: hypothetical protein
fig|543539.3.peg.683 Staphylococcus aureus subsp. aureus CGS01 FIG01108751: hypothetical protein
fig|553567.3.peg.2640 Staphylococcus aureus A5948 FIG01108751: hypothetical protein
fig|553590.4.peg.2631 Staphylococcus aureus A9754 FIG01108751: hypothetical protein
fig|553594.3.peg.2531 Staphylococcus aureus A9765 FIG01108751: hypothetical protein
fig|561307.5.peg.543 Staphylococcus aureus subsp. aureus RN4220 FIG01108751: hypothetical protein
fig|644279.4.peg.348 Staphylococcus aureus subsp. aureus 132 FIG01108751: hypothetical protein
fig|754025.3.peg.2386 Staphylococcus aureus subsp. aureus MRSA131 FIG01108751: hypothetical protein
fig|754026.3.peg.1165 Staphylococcus aureus subsp. aureus MRSA177 FIG01108751: hypothetical protein
fig|904725.3.peg.114 Staphylococcus aureus subsp. aureus 21189 FIG01108751: hypothetical protein
fig|904735.3.peg.2551 Staphylococcus aureus subsp. aureus 21209 FIG01108751: hypothetical protein
fig|904737.3.peg.95 Staphylococcus aureus subsp. aureus 21232 FIG01108751: hypothetical protein
fig|904753.3.peg.1212 Staphylococcus aureus subsp. aureus 21282 FIG01108751: hypothetical protein
fig|904754.3.peg.851 Staphylococcus aureus subsp. aureus 21283 FIG01108751: hypothetical protein
fig|904776.3.peg.1873 Staphylococcus aureus subsp. aureus IS-24 FIG01108751: hypothetical protein
fig|904778.3.peg.1167 Staphylococcus aureus subsp. aureus IS-88 FIG01108751: hypothetical protein
fig|904779.3.peg.819 Staphylococcus aureus subsp. aureus IS-91 FIG01108751: hypothetical protein
fig|904782.3.peg.454 Staphylococcus aureus subsp. aureus IS-111 FIG01108751: hypothetical protein
fig|904795.7.peg.39 Staphylococcus aureus subsp. aureus CO-23 FIG01108751: hypothetical protein
fig|93061.3.peg.262 Staphylococcus aureus subsp. aureus NCTC 8325 FIG01108751: hypothetical protein
fig|93061.5.peg.234 Staphylococcus aureus subsp. aureus NCTC 8325 FIG01108751: hypothetical protein
fig|93062.19.peg.262 Staphylococcus aureus subsp. aureus COL FIG01108751: hypothetical protein
fig|93062.4.peg.731 Staphylococcus aureus subsp. aureus COL FIG01108751: hypothetical protein
fig|931433.3.peg.854 Staphylococcus aureus subsp. aureus CIG1114 FIG01108751: hypothetical protein
fig|931442.3.peg.880 Staphylococcus aureus subsp. aureus CIG547 FIG01108751: hypothetical protein
fig|931448.3.peg.831 Staphylococcus aureus subsp. aureus CIG1612 FIG01108751: hypothetical protein
fig|931449.3.peg.2378 Staphylococcus aureus subsp. aureus CIG1770 FIG01108751: hypothetical protein
fig|931457.3.peg.764 Staphylococcus aureus subsp. aureus CIGC345D FIG01108751: hypothetical protein