page	:SeedViewerServeFeature:
fid	:fig|93061.5.peg.2062:
show_prot_sequence	:1:

>fig|93061.5.peg.2062
MIHELGTVGMVCPFPLIEAQKKMATLQSGDELKIDFDCTQATEAIPNWAAENGYPVTNYE
QIDNASWTITIQKV


PEGs with Identical Sequence
PEG Genome Function
fig|1006543.3.peg.2024 Staphylococcus aureus subsp. aureus T0131 Hypothetical protein SAV2044
fig|1028799.3.peg.1804 Staphylococcus aureus subsp. aureus VC40 hypothetical protein
fig|1074252.3.peg.1978 Staphylococcus aureus subsp. aureus HO 5096 0412 hypothetical protein
fig|1112349.3.peg.2283 Staphylococcus aureus subsp. aureus NN50 Hypothetical protein SAV2044
fig|1118959.3.peg.1913 Staphylococcus aureus subsp. aureus M013 hypothetical protein
fig|1123523.3.peg.1997 Staphylococcus aureus subsp. aureus 11819-97 sirA-like family protein
fig|1137130.3.peg.1218 Staphylococcus aureus subsp. aureus 103564 Hypothetical protein SAV2044
fig|1137132.3.peg.182 Staphylococcus aureus subsp. aureus 112808A Hypothetical protein SAV2044
fig|1137133.3.peg.1151 Staphylococcus aureus subsp. aureus MRGR3 Hypothetical protein SAV2044
fig|1144272.3.peg.4 Staphylococcus aureus subsp. aureus GR1 Hypothetical protein SAV2044
fig|1147034.3.peg.218 Staphylococcus aureus PM1 Hypothetical protein SAV2044
fig|1155079.3.peg.1597 Staphylococcus aureus subsp. aureus DR10 hypothetical protein
fig|1155084.3.peg.1823 Staphylococcus aureus subsp. aureus 71193 hypothetical protein
fig|1156994.3.peg.1521 Staphylococcus aureus HI049 Hypothetical protein SAV2044
fig|1156995.3.peg.2685 Staphylococcus aureus HI010 Hypothetical protein SAV2044
fig|1156996.3.peg.1523 Staphylococcus aureus HI049B Hypothetical protein SAV2044
fig|1156997.3.peg.2045 Staphylococcus aureus HI010B Hypothetical protein SAV2044
fig|1156998.3.peg.1432 Staphylococcus aureus HIF003_B2N-C Hypothetical protein SAV2044
fig|1156999.3.peg.1972 Staphylococcus aureus HI022 Hypothetical protein SAV2044
fig|1157000.3.peg.2013 Staphylococcus aureus HI049C Hypothetical protein SAV2044
fig|1157001.3.peg.2626 Staphylococcus aureus HI168 Hypothetical protein SAV2044
fig|1157002.3.peg.1734 Staphylococcus aureus HI111 Hypothetical protein SAV2044
fig|1157003.3.peg.2649 Staphylococcus aureus HI013 Hypothetical protein SAV2044
fig|1157016.3.peg.131 Staphylococcus aureus M0221 Hypothetical protein SAV2044
fig|1157018.3.peg.1418 Staphylococcus aureus M0239 Hypothetical protein SAV2044
fig|1157024.3.peg.2766 Staphylococcus aureus M0340 Hypothetical protein SAV2044
fig|1157032.3.peg.1596 Staphylococcus aureus M0468 Hypothetical protein SAV2044
fig|1158465.3.peg.2654 Staphylococcus aureus M1064 Hypothetical protein SAV2044
fig|1158477.3.peg.1408 Staphylococcus aureus M1216 Hypothetical protein SAV2044
fig|1158485.3.peg.1168 Staphylococcus aureus M1311 hypothetical protein
fig|1158495.3.peg.1986 Staphylococcus aureus M1462 Hypothetical protein SAV2044
fig|1158508.3.peg.1953 Staphylococcus aureus M0055 Hypothetical protein SAV2044
fig|1158530.3.peg.2682 Staphylococcus aureus M0424 Hypothetical protein SAV2044
fig|1158539.3.peg.2055 Staphylococcus aureus M0633 Hypothetical protein SAV2044
fig|1158683.3.peg.1505 Staphylococcus aureus M0531 Hypothetical protein SAV2044
fig|1158707.3.peg.2681 Staphylococcus aureus M1007 Hypothetical protein SAV2044
fig|1169268.3.peg.2655 Staphylococcus aureus M1223 Hypothetical protein SAV2044
fig|1213728.3.peg.1615 Staphylococcus aureus M0831 Hypothetical protein SAV2044
fig|1213730.3.peg.1152 Staphylococcus aureus M0877 Hypothetical protein SAV2044
fig|1224928.3.peg.1628 Staphylococcus aureus M0312 Hypothetical protein SAV2044
fig|1229492.3.peg.1906 Staphylococcus aureus 08BA02176 Hypothetical protein SAV2044
fig|1231383.3.peg.1494 Staphylococcus aureus KT/314250 Hypothetical protein SAV2044
fig|1235275.3.peg.2071 Staphylococcus aureus PPUKM-261-2009 Hypothetical protein SAV2044
fig|1235276.3.peg.2124 Staphylococcus aureus PPUKM-332-2009 Hypothetical protein SAV2044
fig|1235278.3.peg.1993 Staphylococcus aureus PPUKM-775-2009 Hypothetical protein SAV2044
fig|1241616.3.peg.1417 Staphylococcus aureus subsp. aureus DSM 20231 Hypothetical protein SAV2044
fig|1242970.3.peg.2044 Staphylococcus aureus CN79 Hypothetical protein SAV2044
fig|1265302.3.peg.2523 Staphylococcus aureus subsp. aureus PB32 Hypothetical protein SAV2044
fig|1278074.4.peg.1520 Staphylococcus aureus VH221 Hypothetical protein SAV2044
fig|1278075.4.peg.1755 Staphylococcus aureus LVP5 Hypothetical protein SAV2044
fig|1283278.3.peg.1809 Staphylococcus aureus KLT6 Hypothetical protein SAV2044
fig|1288493.3.peg.129 Staphylococcus aureus subsp. aureus S1800 Hypothetical protein SAV2044
fig|1303785.3.peg.2563 Staphylococcus aureus M1228 Hypothetical protein SAV2044
fig|1305598.3.peg.2026 Staphylococcus aureus M1 Hypothetical protein SAV2044
fig|1323661.3.peg.2043 Staphylococcus aureus CA-347 Hypothetical protein SAV2044
fig|196620.1.peg.1968 Staphylococcus aureus subsp. aureus MW2 Hypothetical protein SAV2044
fig|196620.5.peg.2044 Staphylococcus aureus subsp. aureus MW2 Hypothetical protein SAV2044
fig|282459.1.peg.1926 Staphylococcus aureus subsp. aureus MSSA476 Hypothetical protein SAV2044
fig|282459.5.peg.2030 Staphylococcus aureus subsp. aureus MSSA476 Hypothetical protein SAV2044
fig|367830.3.peg.170 Staphylococcus aureus subsp. aureus USA300 Hypothetical protein SAV2044
fig|426430.6.peg.1898 Staphylococcus aureus subsp. aureus str. Newman Hypothetical protein SAV2044
fig|426430.8.peg.2136 Staphylococcus aureus subsp. aureus str. Newman Hypothetical protein SAV2044
fig|450394.6.peg.2550 Staphylococcus aureus subsp. aureus USA300_TCH959 Hypothetical protein SAV2044
fig|451515.3.peg.2140 Staphylococcus aureus subsp. aureus USA300_FPR3757 Hypothetical protein SAV2044
fig|451516.9.peg.2129 Staphylococcus aureus subsp. aureus USA300_TCH1516 Hypothetical protein SAV2044
fig|452948.4.peg.1976 Staphylococcus aureus 930918-3 Hypothetical protein SAV2044
fig|455227.3.peg.2123 Staphylococcus aureus D30 Hypothetical protein SAV2044
fig|543539.3.peg.1867 Staphylococcus aureus subsp. aureus CGS01 Hypothetical protein SAV2044
fig|546342.3.peg.353 Staphylococcus aureus subsp. aureus str. JKD6008 Hypothetical protein SAV2044
fig|546342.4.peg.2191 Staphylococcus aureus subsp. aureus str. JKD6008 Hypothetical protein SAV2044
fig|546343.3.peg.277 Staphylococcus aureus subsp. aureus str. JKD6009 Hypothetical protein SAV2044
fig|548474.3.peg.2451 Staphylococcus aureus subsp. aureus TCH130 Hypothetical protein SAV2044
fig|548475.3.peg.2376 Staphylococcus aureus subsp. aureus TCH70 Hypothetical protein SAV2044
fig|553567.3.peg.1903 Staphylococcus aureus A5948 Hypothetical protein SAV2044
fig|553583.3.peg.332 Staphylococcus aureus A9635 Hypothetical protein SAV2044
fig|553590.4.peg.1650 Staphylococcus aureus A9754 Hypothetical protein SAV2044
fig|553594.3.peg.2006 Staphylococcus aureus A9765 Hypothetical protein SAV2044
fig|561307.5.peg.463 Staphylococcus aureus subsp. aureus RN4220 Hypothetical protein SAV2044
fig|585152.3.peg.2016 Staphylococcus aureus subsp. aureus D139 Hypothetical protein SAV2044
fig|585155.3.peg.2657 Staphylococcus aureus subsp. aureus H19 Hypothetical protein SAV2044
fig|644279.4.peg.2188 Staphylococcus aureus subsp. aureus 132 Hypothetical protein SAV2044
fig|663951.4.peg.2168 Staphylococcus aureus subsp. aureus TW20 Hypothetical protein SAV2044
fig|685039.3.peg.2135 Staphylococcus aureus subsp. aureus ED133 Hypothetical protein SAV2044
fig|754025.3.peg.1881 Staphylococcus aureus subsp. aureus MRSA131 Hypothetical protein SAV2044
fig|754026.3.peg.869 Staphylococcus aureus subsp. aureus MRSA177 Hypothetical protein SAV2044
fig|762962.3.peg.2559 Staphylococcus aureus subsp. aureus ATCC 51811 Hypothetical protein SAV2044
fig|862516.3.peg.39 Staphylococcus aureus subsp. aureus ATCC BAA-39 Hypothetical protein SAV2044
fig|904724.3.peg.1736 Staphylococcus aureus subsp. aureus 21178 hypothetical protein
fig|904725.3.peg.2185 Staphylococcus aureus subsp. aureus 21189 Hypothetical protein SAV2044
fig|904726.3.peg.1146 Staphylococcus aureus subsp. aureus 21193 Hypothetical protein SAV2044
fig|904727.3.peg.213 Staphylococcus aureus subsp. aureus 21194 hypothetical protein
fig|904729.3.peg.2482 Staphylococcus aureus subsp. aureus 21196 Hypothetical protein SAV2044
fig|904730.3.peg.835 Staphylococcus aureus subsp. aureus 21200 hypothetical protein
fig|904732.3.peg.1738 Staphylococcus aureus subsp. aureus 21202 hypothetical protein
fig|904735.3.peg.1672 Staphylococcus aureus subsp. aureus 21209 hypothetical protein
fig|904737.3.peg.1355 Staphylococcus aureus subsp. aureus 21232 hypothetical protein
fig|904738.3.peg.1193 Staphylococcus aureus subsp. aureus 21235 hypothetical protein
fig|904743.3.peg.2573 Staphylococcus aureus subsp. aureus 21252 hypothetical protein
fig|904744.3.peg.172 Staphylococcus aureus subsp. aureus 21259 hypothetical protein
fig|904747.3.peg.2153 Staphylococcus aureus subsp. aureus 21266 hypothetical protein
fig|904753.3.peg.1631 Staphylococcus aureus subsp. aureus 21282 Hypothetical protein SAV2044
fig|904754.3.peg.237 Staphylococcus aureus subsp. aureus 21283 hypothetical protein
fig|904759.3.peg.1985 Staphylococcus aureus subsp. aureus 21305 Hypothetical protein SAV2044
fig|904760.3.peg.686 Staphylococcus aureus subsp. aureus 21310 Hypothetical protein SAV2044
fig|904766.3.peg.26 Staphylococcus aureus subsp. aureus 21331 hypothetical protein
fig|904767.3.peg.1175 Staphylococcus aureus subsp. aureus 21333 hypothetical protein
fig|904768.3.peg.29 Staphylococcus aureus subsp. aureus 21334 hypothetical protein
fig|904771.3.peg.937 Staphylococcus aureus subsp. aureus 21340 hypothetical protein
fig|904773.3.peg.2500 Staphylococcus aureus subsp. aureus 21343 hypothetical protein
fig|904776.3.peg.915 Staphylococcus aureus subsp. aureus IS-24 hypothetical protein
fig|904777.3.peg.195 Staphylococcus aureus subsp. aureus IS-55 hypothetical protein
fig|904778.3.peg.44 Staphylococcus aureus subsp. aureus IS-88 hypothetical protein
fig|904779.3.peg.2412 Staphylococcus aureus subsp. aureus IS-91 hypothetical protein
fig|904781.3.peg.704 Staphylococcus aureus subsp. aureus IS-105 hypothetical protein
fig|904782.3.peg.362 Staphylococcus aureus subsp. aureus IS-111 hypothetical protein
fig|904784.3.peg.2609 Staphylococcus aureus subsp. aureus IS-125 hypothetical protein
fig|904785.3.peg.286 Staphylococcus aureus subsp. aureus IS-157 hypothetical protein
fig|904786.3.peg.1832 Staphylococcus aureus subsp. aureus IS-160 hypothetical protein
fig|904787.3.peg.1530 Staphylococcus aureus subsp. aureus IS-189 hypothetical protein
fig|904795.7.peg.750 Staphylococcus aureus subsp. aureus CO-23 hypothetical protein
fig|908247.3.peg.2615 Staphylococcus aureus 16K Hypothetical protein SAV2044
fig|93061.3.peg.2144 Staphylococcus aureus subsp. aureus NCTC 8325 Hypothetical protein SAV2044
fig|93061.5.peg.2062 Staphylococcus aureus subsp. aureus NCTC 8325 Hypothetical protein SAV2044
fig|93062.19.peg.1983 Staphylococcus aureus subsp. aureus COL Hypothetical protein SAV2044
fig|93062.4.peg.1993 Staphylococcus aureus subsp. aureus COL Hypothetical protein SAV2044
fig|931433.3.peg.2611 Staphylococcus aureus subsp. aureus CIG1114 hypothetical protein
fig|931441.3.peg.2355 Staphylococcus aureus subsp. aureus CIG1835 hypothetical protein
fig|931442.3.peg.2587 Staphylococcus aureus subsp. aureus CIG547 hypothetical protein
fig|931448.3.peg.2649 Staphylococcus aureus subsp. aureus CIG1612 hypothetical protein
fig|931449.3.peg.2650 Staphylococcus aureus subsp. aureus CIG1770 hypothetical protein
fig|931450.3.peg.2542 Staphylococcus aureus subsp. aureus CIG2018 hypothetical protein
fig|931451.3.peg.2595 Staphylococcus aureus subsp. aureus CIG290 hypothetical protein
fig|931454.3.peg.2429 Staphylococcus aureus subsp. aureus CIG1524 hypothetical protein
fig|931457.3.peg.2452 Staphylococcus aureus subsp. aureus CIGC345D hypothetical protein
fig|931459.3.peg.2530 Staphylococcus aureus subsp. aureus CIGC128 hypothetical protein