page	:SeedViewerServeFeature:
fid	:fig|93061.5.peg.201:
show_prot_sequence	:1:

>fig|93061.5.peg.201
MKALKLYGVEDLRYEDNEKPVIESANDVIIKVRATGICGSDTSRYKKMGPYIKGMPFGHE
FSGVVDAIGSDVTHVNVGDKVTGCPAIPCYQCEYCLKGEYARCEKLFVIGSYEPGSFAEY
VKLPAQNVLKVPDNVDYIEAAMVEPSAVVAHGFYKSNIQPGMTVAVMGCGSIGLLAIQWA
RIFGAAHIIAIDIDAHKLDIATSLGAHQTINSKEENLEKFIENHYANQIDLAIESSGAKV
TIGQILTLPKKGGEVVLLGIPYDDIEIDRVHFEKILRNELTVCGSWNCLSSNFPGKEWTA
TLHYMKTKDINVKPIISHFLPLEKGPETFDKLVNKKERFDKVMFTIY


PEGs with Identical Sequence
PEG Genome Function
fig|1028799.3.peg.193 Staphylococcus aureus subsp. aureus VC40 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|1112349.3.peg.1048 Staphylococcus aureus subsp. aureus NN50 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|1144271.3.peg.2438 Staphylococcus aureus subsp. aureus 118 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|1144272.3.peg.1861 Staphylococcus aureus subsp. aureus GR1 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|1156994.3.peg.2447 Staphylococcus aureus HI049 Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|1156995.3.peg.907 Staphylococcus aureus HI010 Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|1156996.3.peg.2459 Staphylococcus aureus HI049B Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|1156997.3.peg.261 Staphylococcus aureus HI010B Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|1156998.3.peg.2299 Staphylococcus aureus HIF003_B2N-C Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|1156999.3.peg.199 Staphylococcus aureus HI022 Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|1157000.3.peg.233 Staphylococcus aureus HI049C Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|1157001.3.peg.805 Staphylococcus aureus HI168 Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|1157002.3.peg.2626 Staphylococcus aureus HI111 Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|1157003.3.peg.809 Staphylococcus aureus HI013 Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|1158683.3.peg.2404 Staphylococcus aureus M0531 Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|1221451.3.peg.1593 Staphylococcus aureus subsp. aureus 120 Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|1221452.3.peg.1831 Staphylococcus aureus subsp. aureus 333 Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|1221453.3.peg.959 Staphylococcus aureus subsp. aureus 3989 Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|1226740.3.peg.1605 Staphylococcus aureus subsp. aureus VH60 Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|1231382.3.peg.942 Staphylococcus aureus KT/Y21 Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|1241616.3.peg.2273 Staphylococcus aureus subsp. aureus DSM 20231 Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|1265302.3.peg.189 Staphylococcus aureus subsp. aureus PB32 Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|1278071.4.peg.2328 Staphylococcus aureus 3957 Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|1278072.4.peg.2389 Staphylococcus aureus LVP2 Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|1278074.4.peg.778 Staphylococcus aureus VH221 Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|1278075.4.peg.1987 Staphylococcus aureus LVP5 Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|1305598.3.peg.248 Staphylococcus aureus M1 Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|367830.3.peg.2018 Staphylococcus aureus subsp. aureus USA300 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|426430.6.peg.184 Staphylococcus aureus subsp. aureus str. Newman Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|426430.8.peg.198 Staphylococcus aureus subsp. aureus str. Newman Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|451515.3.peg.305 Staphylococcus aureus subsp. aureus USA300_FPR3757 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|451516.9.peg.295 Staphylococcus aureus subsp. aureus USA300_TCH1516 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|452948.4.peg.98 Staphylococcus aureus 930918-3 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|455227.3.peg.261 Staphylococcus aureus D30 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|543539.3.peg.392 Staphylococcus aureus subsp. aureus CGS01 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|553567.3.peg.1172 Staphylococcus aureus A5948 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|553590.4.peg.1248 Staphylococcus aureus A9754 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|561307.5.peg.652 Staphylococcus aureus subsp. aureus RN4220 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|644279.4.peg.316 Staphylococcus aureus subsp. aureus 132 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|754025.3.peg.231 Staphylococcus aureus subsp. aureus MRSA131 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|754026.3.peg.2197 Staphylococcus aureus subsp. aureus MRSA177 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|904725.3.peg.149 Staphylococcus aureus subsp. aureus 21189 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|904729.3.peg.1079 Staphylococcus aureus subsp. aureus 21196 Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|904737.3.peg.2283 Staphylococcus aureus subsp. aureus 21232 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|904753.3.peg.2152 Staphylococcus aureus subsp. aureus 21282 Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)
fig|904754.3.peg.2062 Staphylococcus aureus subsp. aureus 21283 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|904776.3.peg.960 Staphylococcus aureus subsp. aureus IS-24 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|904778.3.peg.1201 Staphylococcus aureus subsp. aureus IS-88 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|904779.3.peg.852 Staphylococcus aureus subsp. aureus IS-91 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|904782.3.peg.421 Staphylococcus aureus subsp. aureus IS-111 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|904795.7.peg.71 Staphylococcus aureus subsp. aureus CO-23 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|93061.3.peg.228 Staphylococcus aureus subsp. aureus NCTC 8325 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|93061.5.peg.201 Staphylococcus aureus subsp. aureus NCTC 8325 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|93062.19.peg.229 Staphylococcus aureus subsp. aureus COL Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|93062.4.peg.698 Staphylococcus aureus subsp. aureus COL Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|931442.3.peg.846 Staphylococcus aureus subsp. aureus CIG547 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|931457.3.peg.797 Staphylococcus aureus subsp. aureus CIGC345D Sorbitol dehydrogenase homologue (EC:1.1.1.14)