page	:SeedViewerServeFeature:
fid	:fig|93061.5.peg.1834:
show_prot_sequence	:1:

>fig|93061.5.peg.1834
MEGNFKNVKKFIYEGEEYTKVYAGNIQVWKKPSSFVIKPLPKNKYPDSIEESTAKWTING
VEPNKSYQVTIENVRSGIMRISQTNLGSSDLGISGVNSGVASKNINFSNPSGMLYVTISD
VYSGSPTLTIE


PEGs with Identical Sequence
PEG Genome Function
fig|1157017.3.peg.1181 Staphylococcus aureus M0237 Hypothetical protein, phi-ETA orf63 homolog [SA bacteriophages 11, Mu50B]
fig|1157022.3.peg.1100 Staphylococcus aureus M0329 hypothetical protein
fig|12360.1.peg.51 Staphylococcus aureus phage phi 11 Phage protein
fig|585151.3.peg.1500 Staphylococcus aureus subsp. aureus C427 Phage protein
fig|904725.3.peg.1665 Staphylococcus aureus subsp. aureus 21189 Phage protein
fig|93061.3.peg.1910 Staphylococcus aureus subsp. aureus NCTC 8325 Phage protein
fig|93061.5.peg.1834 Staphylococcus aureus subsp. aureus NCTC 8325 Phage protein
fig|931437.3.peg.1902 Staphylococcus aureus subsp. aureus CIG1500 Phage protein
fig|931456.3.peg.1869 Staphylococcus aureus subsp. aureus CIGC341D Phage protein