page	:SeedViewerServeFeature:
fid	:fig|93061.5.peg.1396:
show_prot_sequence	:1:

>fig|93061.5.peg.1396
MSLEEIKLWLRIDYNFENDLIEGLIQSAKSELLLSGVPDYDKDDLEYPLFCTAIKYIIAR
DYESRGYSNDQSRSKVFNEKGLQKMILKLKKW


PEGs with Identical Sequence
PEG Genome Function
fig|1074252.3.peg.1391 Staphylococcus aureus subsp. aureus HO 5096 0412 ORF046
fig|1116214.3.peg.2619 Staphylococcus aureus subsp. aureus VRS1 ORF046
fig|1116215.3.peg.890 Staphylococcus aureus subsp. aureus VRS2 ORF046
fig|1116218.3.peg.2649 Staphylococcus aureus subsp. aureus VRS5 ORF046
fig|1116219.3.peg.1331 Staphylococcus aureus subsp. aureus VRS6 ORF046
fig|1116220.3.peg.2628 Staphylococcus aureus subsp. aureus VRS7 ORF046
fig|1116221.3.peg.2553 Staphylococcus aureus subsp. aureus VRS8 ORF046
fig|1116223.3.peg.1402 Staphylococcus aureus subsp. aureus VRS10 ORF046
fig|1116224.3.peg.2667 Staphylococcus aureus subsp. aureus VRS11a ORF046
fig|1116225.3.peg.2646 Staphylococcus aureus subsp. aureus VRS11b ORF046
fig|1137131.3.peg.1452 Staphylococcus aureus subsp. aureus 122051 hypothetical protein within a prophage
fig|1137132.3.peg.2036 Staphylococcus aureus subsp. aureus 112808A hypothetical protein within a prophage
fig|1155079.3.peg.76 Staphylococcus aureus subsp. aureus DR10 ORF046
fig|1156994.3.peg.947 Staphylococcus aureus HI049 hypothetical protein within a prophage
fig|1156995.3.peg.2110 Staphylococcus aureus HI010 hypothetical protein within a prophage
fig|1156996.3.peg.949 Staphylococcus aureus HI049B hypothetical protein within a prophage
fig|1156997.3.peg.1467 Staphylococcus aureus HI010B hypothetical protein within a prophage
fig|1156999.3.peg.1399 Staphylococcus aureus HI022 hypothetical protein within a prophage
fig|1157000.3.peg.1438 Staphylococcus aureus HI049C hypothetical protein within a prophage
fig|1157001.3.peg.1984 Staphylococcus aureus HI168 hypothetical protein within a prophage
fig|1157002.3.peg.1158 Staphylococcus aureus HI111 hypothetical protein within a prophage
fig|1157003.3.peg.2012 Staphylococcus aureus HI013 hypothetical protein within a prophage
fig|1157004.3.peg.1546 Staphylococcus aureus M0001 hypothetical protein within a prophage
fig|1157005.3.peg.1635 Staphylococcus aureus M0029 hypothetical protein within a prophage
fig|1157006.3.peg.970 Staphylococcus aureus M0035 hypothetical protein within a prophage
fig|1157007.3.peg.2569 Staphylococcus aureus M0045 hypothetical protein within a prophage
fig|1157008.3.peg.2035 Staphylococcus aureus M0060 hypothetical protein within a prophage
fig|1157009.3.peg.2056 Staphylococcus aureus M0066 hypothetical protein within a prophage
fig|1157011.3.peg.2015 Staphylococcus aureus M0103 hypothetical protein within a prophage
fig|1157012.3.peg.2315 Staphylococcus aureus M0150 hypothetical protein within a prophage
fig|1157015.3.peg.2241 Staphylococcus aureus M0197 hypothetical protein within a prophage
fig|1157016.3.peg.2325 Staphylococcus aureus M0221 hypothetical protein within a prophage
fig|1157020.3.peg.980 Staphylococcus aureus M0326 hypothetical protein within a prophage
fig|1157021.3.peg.995 Staphylococcus aureus M0328 hypothetical protein within a prophage
fig|1157024.3.peg.2185 Staphylococcus aureus M0340 hypothetical protein within a prophage
fig|1157025.3.peg.302 Staphylococcus aureus M0347 hypothetical protein within a prophage
fig|1157032.3.peg.1021 Staphylococcus aureus M0468 hypothetical protein within a prophage
fig|1157034.3.peg.1547 Staphylococcus aureus M0489 hypothetical protein within a prophage
fig|1158462.3.peg.2171 Staphylococcus aureus M0529 hypothetical protein within a prophage
fig|1158463.3.peg.2260 Staphylococcus aureus M1063 hypothetical protein within a prophage
fig|1158464.3.peg.1000 Staphylococcus aureus M1076 hypothetical protein within a prophage
fig|1158465.3.peg.2074 Staphylococcus aureus M1064 hypothetical protein within a prophage
fig|1158468.3.peg.1431 Staphylococcus aureus M1095 hypothetical protein within a prophage
fig|1158469.3.peg.2263 Staphylococcus aureus M1103 hypothetical protein within a prophage
fig|1158470.3.peg.1961 Staphylococcus aureus M1119 hypothetical protein within a prophage
fig|1158472.3.peg.2272 Staphylococcus aureus M1170 hypothetical protein within a prophage
fig|1158473.3.peg.967 Staphylococcus aureus M1188 hypothetical protein within a prophage
fig|1158475.3.peg.520 Staphylococcus aureus M1199 hypothetical protein within a prophage
fig|1158481.3.peg.1459 Staphylococcus aureus M1255 hypothetical protein within a prophage
fig|1158487.3.peg.1481 Staphylococcus aureus M1321 hypothetical protein within a prophage
fig|1158490.3.peg.965 Staphylococcus aureus M1367 hypothetical protein within a prophage
fig|1158491.3.peg.1938 Staphylococcus aureus M1373 hypothetical protein within a prophage
fig|1158495.3.peg.1066 Staphylococcus aureus M1462 hypothetical protein within a prophage
fig|1158498.3.peg.1912 Staphylococcus aureus M1520 hypothetical protein within a prophage
fig|1158499.3.peg.1021 Staphylococcus aureus M1521 hypothetical protein within a prophage
fig|1158505.3.peg.2437 Staphylococcus aureus M1565 hypothetical protein within a prophage
fig|1158507.3.peg.2274 Staphylococcus aureus M0006 hypothetical protein within a prophage
fig|1158508.3.peg.1371 Staphylococcus aureus M0055 hypothetical protein within a prophage
fig|1158509.3.peg.1993 Staphylococcus aureus M0077 hypothetical protein within a prophage
fig|1158511.3.peg.2227 Staphylococcus aureus M0144 hypothetical protein within a prophage
fig|1158514.3.peg.1030 Staphylococcus aureus M0200 hypothetical protein within a prophage
fig|1158518.3.peg.2394 Staphylococcus aureus M0250 hypothetical protein within a prophage
fig|1158520.3.peg.672 Staphylococcus aureus M0280 hypothetical protein within a prophage
fig|1158522.3.peg.2254 Staphylococcus aureus M0334 hypothetical protein within a prophage
fig|1158523.3.peg.2011 Staphylococcus aureus M0350 hypothetical protein within a prophage
fig|1158526.3.peg.2295 Staphylococcus aureus M0367 hypothetical protein within a prophage
fig|1158528.3.peg.2009 Staphylococcus aureus M0375 hypothetical protein within a prophage
fig|1158529.3.peg.1571 Staphylococcus aureus M0396 hypothetical protein within a prophage
fig|1158530.3.peg.2098 Staphylococcus aureus M0424 hypothetical protein within a prophage
fig|1158531.3.peg.1396 Staphylococcus aureus M0438 hypothetical protein within a prophage
fig|1158533.3.peg.1018 Staphylococcus aureus M0510 hypothetical protein within a prophage
fig|1158534.3.peg.218 Staphylococcus aureus M0513 hypothetical protein within a prophage
fig|1158536.3.peg.2528 Staphylococcus aureus M0571 hypothetical protein within a prophage
fig|1158537.3.peg.1404 Staphylococcus aureus M0584 hypothetical protein within a prophage
fig|1158538.3.peg.2156 Staphylococcus aureus M0586 hypothetical protein within a prophage
fig|1158539.3.peg.1475 Staphylococcus aureus M0633 hypothetical protein within a prophage
fig|1158682.3.peg.1442 Staphylococcus aureus M0528 hypothetical protein within a prophage
fig|1158683.3.peg.930 Staphylococcus aureus M0531 hypothetical protein within a prophage
fig|1158685.3.peg.2248 Staphylococcus aureus M0539 hypothetical protein within a prophage
fig|1158686.3.peg.2246 Staphylococcus aureus M0547 hypothetical protein within a prophage
fig|1158689.3.peg.1030 Staphylococcus aureus M0602 hypothetical protein within a prophage
fig|1158692.3.peg.1222 Staphylococcus aureus M0687 hypothetical protein within a prophage
fig|1158693.3.peg.2075 Staphylococcus aureus M0692 hypothetical protein within a prophage
fig|1158694.3.peg.2151 Staphylococcus aureus M0719 hypothetical protein within a prophage
fig|1158696.3.peg.2530 Staphylococcus aureus M0770 hypothetical protein within a prophage
fig|1158698.3.peg.2295 Staphylococcus aureus M0799 hypothetical protein within a prophage
fig|1158699.3.peg.1482 Staphylococcus aureus M0823 hypothetical protein within a prophage
fig|1158700.3.peg.2094 Staphylococcus aureus M0844 hypothetical protein within a prophage
fig|1158701.3.peg.2502 Staphylococcus aureus M0934 hypothetical protein within a prophage
fig|1158703.3.peg.1298 Staphylococcus aureus M0944 hypothetical protein within a prophage
fig|1158707.3.peg.2095 Staphylococcus aureus M1007 hypothetical protein within a prophage
fig|1158709.3.peg.1551 Staphylococcus aureus M1015 hypothetical protein within a prophage
fig|1158711.3.peg.1049 Staphylococcus aureus M1036 hypothetical protein within a prophage
fig|1161392.3.peg.675 Staphylococcus aureus NN54 hypothetical protein within a prophage
fig|1169255.3.peg.1800 Staphylococcus aureus M0946 hypothetical protein within a prophage
fig|1169256.3.peg.1403 Staphylococcus aureus M0964 hypothetical protein within a prophage
fig|1169259.3.peg.1560 Staphylococcus aureus M1034 hypothetical protein within a prophage
fig|1169260.3.peg.1417 Staphylococcus aureus M1044 hypothetical protein within a prophage
fig|1169261.3.peg.1639 Staphylococcus aureus M1061 hypothetical protein within a prophage
fig|1169265.3.peg.1770 Staphylococcus aureus M1109 hypothetical protein within a prophage
fig|1169268.3.peg.2073 Staphylococcus aureus M1223 hypothetical protein within a prophage
fig|1169270.3.peg.299 Staphylococcus aureus M1244 hypothetical protein within a prophage
fig|1169274.3.peg.1423 Staphylococcus aureus M1309 hypothetical protein
fig|1213721.3.peg.2106 Staphylococcus aureus M0648 hypothetical protein within a prophage
fig|1213722.3.peg.2023 Staphylococcus aureus M0660 hypothetical protein within a prophage
fig|1213723.3.peg.1404 Staphylococcus aureus M0663 hypothetical protein within a prophage
fig|1213726.3.peg.1432 Staphylococcus aureus M0792 hypothetical protein within a prophage
fig|1213728.3.peg.1028 Staphylococcus aureus M0831 hypothetical protein within a prophage
fig|1213733.3.peg.1421 Staphylococcus aureus M0900 hypothetical protein within a prophage
fig|1214901.3.peg.2520 Staphylococcus aureus M0646 hypothetical protein within a prophage
fig|1224919.3.peg.2188 Staphylococcus aureus M0104 hypothetical protein within a prophage
fig|1224920.3.peg.2029 Staphylococcus aureus M0171 hypothetical protein within a prophage
fig|1224924.3.peg.2066 Staphylococcus aureus M0270 hypothetical protein within a prophage
fig|1224926.3.peg.971 Staphylococcus aureus M0279 hypothetical protein within a prophage
fig|1224927.3.peg.985 Staphylococcus aureus M0288 hypothetical protein within a prophage
fig|1224928.3.peg.1048 Staphylococcus aureus M0312 hypothetical protein within a prophage
fig|1224929.3.peg.1174 Staphylococcus aureus M0404 hypothetical protein within a prophage
fig|1224930.3.peg.1767 Staphylococcus aureus M0415 hypothetical protein within a prophage
fig|1231383.3.peg.1637 Staphylococcus aureus KT/314250 hypothetical protein within a prophage
fig|1303781.3.peg.2239 Staphylococcus aureus M0294 hypothetical protein within a prophage
fig|1303782.3.peg.2125 Staphylococcus aureus M1060 hypothetical protein within a prophage
fig|1303785.3.peg.2050 Staphylococcus aureus M1228 hypothetical protein within a prophage
fig|1303786.3.peg.2080 Staphylococcus aureus M1407 hypothetical protein within a prophage
fig|1303787.3.peg.1487 Staphylococcus aureus M1466 hypothetical protein within a prophage
fig|130478.1.peg.43 Staphylococcus aureus temperate phage phiSLT hypothetical protein within a prophage
fig|1305598.3.peg.1430 Staphylococcus aureus M1 hypothetical protein within a prophage
fig|196620.1.peg.1397 Staphylococcus aureus subsp. aureus MW2 hypothetical protein within a prophage
fig|196620.5.peg.1463 Staphylococcus aureus subsp. aureus MW2 hypothetical protein within a prophage
fig|282458.1.peg.1434 Staphylococcus aureus subsp. aureus MRSA252 hypothetical protein within a prophage
fig|282458.4.peg.1519 Staphylococcus aureus subsp. aureus MRSA252 hypothetical protein within a prophage
fig|282459.1.peg.930 Staphylococcus aureus subsp. aureus MSSA476 hypothetical protein within a prophage
fig|282459.5.peg.972 Staphylococcus aureus subsp. aureus MSSA476 hypothetical protein within a prophage
fig|320837.3.peg.9 Bacteriophage 42e hypothetical protein within a prophage
fig|320839.3.peg.7 Bacteriophage 47 hypothetical protein within a prophage
fig|367830.3.peg.1907 Staphylococcus aureus subsp. aureus USA300 hypothetical protein within a prophage
fig|430796.2.peg.39 Viruses Staphylococcus phage phi2958PVL Viruses. hypothetical protein within a prophage
fig|445516.2.peg.49 Viruses Staphylococcus phage tp310-2 Viruses. hypothetical protein within a prophage
fig|451515.3.peg.1531 Staphylococcus aureus subsp. aureus USA300_FPR3757 hypothetical protein within a prophage
fig|451516.9.peg.1536 Staphylococcus aureus subsp. aureus USA300_TCH1516 hypothetical protein within a prophage
fig|452948.4.peg.2149 Staphylococcus aureus 930918-3 hypothetical protein within a prophage
fig|505321.3.peg.961 Staphylococcus aureus subsp. aureus str. CF-Marseille hypothetical protein within a prophage
fig|543539.3.peg.963 Staphylococcus aureus subsp. aureus CGS01 hypothetical protein within a prophage
fig|543540.3.peg.2510 Staphylococcus aureus subsp. aureus CGS03 hypothetical protein within a prophage
fig|548470.3.peg.319 Staphylococcus aureus subsp. aureus MN8 hypothetical protein within a prophage
fig|548473.3.peg.1827 Staphylococcus aureus subsp. aureus TCH60 hypothetical protein within a prophage
fig|548473.6.peg.1654 Staphylococcus aureus subsp. aureus TCH60 DNA packaging protein
fig|548475.3.peg.435 Staphylococcus aureus subsp. aureus TCH70 hypothetical protein within a prophage
fig|553565.3.peg.2326 Staphylococcus aureus A5937 hypothetical protein within a prophage
fig|553568.3.peg.1162 Staphylococcus aureus A6224 hypothetical protein within a prophage
fig|553571.3.peg.605 Staphylococcus aureus A6300 hypothetical protein within a prophage
fig|553577.3.peg.2618 Staphylococcus aureus A8796 hypothetical protein within a prophage
fig|553580.3.peg.2693 Staphylococcus aureus A8819 hypothetical protein within a prophage
fig|553581.3.peg.75 Staphylococcus aureus A9299 hypothetical protein within a prophage
fig|553588.3.peg.622 Staphylococcus aureus A9719 hypothetical protein within a prophage
fig|553590.4.peg.533 Staphylococcus aureus A9754 hypothetical protein within a prophage
fig|553594.3.peg.788 Staphylococcus aureus A9765 hypothetical protein within a prophage
fig|575610.2.peg.42 Siphoviridae Staphylococcus phage phiSauS-IPLA35 hypothetical protein within a prophage
fig|585145.3.peg.1706 Staphylococcus aureus subsp. aureus 65-1322 hypothetical protein within a prophage
fig|585148.3.peg.1029 Staphylococcus aureus subsp. aureus Btn1260 hypothetical protein within a prophage
fig|585151.3.peg.1437 Staphylococcus aureus subsp. aureus C427 hypothetical protein within a prophage
fig|585153.3.peg.291 Staphylococcus aureus subsp. aureus E1410 hypothetical protein within a prophage
fig|585154.3.peg.1136 Staphylococcus aureus subsp. aureus EMRSA16 hypothetical protein within a prophage
fig|585160.3.peg.987 Staphylococcus aureus subsp. aureus WBG10049 hypothetical protein within a prophage
fig|644279.4.peg.1601 Staphylococcus aureus subsp. aureus 132 hypothetical protein within a prophage
fig|680649.3.peg.1688 Staphylococcus aureus subsp. aureus MR1 hypothetical protein within a prophage
fig|681288.4.peg.1998 Staphylococcus aureus subsp. aureus ED98 hypothetical protein within a prophage
fig|754025.3.peg.1242 Staphylococcus aureus subsp. aureus MRSA131 hypothetical protein within a prophage
fig|754026.3.peg.1751 Staphylococcus aureus subsp. aureus MRSA177 hypothetical protein within a prophage
fig|762962.3.peg.536 Staphylococcus aureus subsp. aureus ATCC 51811 hypothetical protein within a prophage
fig|869816.3.peg.1449 Staphylococcus aureus subsp. aureus JKD6159 hypothetical protein within a prophage
fig|904725.3.peg.974 Staphylococcus aureus subsp. aureus 21189 hypothetical protein within a prophage
fig|904726.3.peg.1478 Staphylococcus aureus subsp. aureus 21193 hypothetical protein within a prophage
fig|904735.3.peg.166 Staphylococcus aureus subsp. aureus 21209 ORF046
fig|904746.3.peg.594 Staphylococcus aureus subsp. aureus 21264 ORF046
fig|904750.3.peg.1870 Staphylococcus aureus subsp. aureus 21272 ORF046
fig|904759.3.peg.2242 Staphylococcus aureus subsp. aureus 21305 hypothetical protein within a prophage
fig|904776.3.peg.1173 Staphylococcus aureus subsp. aureus IS-24 ORF046
fig|904778.3.peg.2623 Staphylococcus aureus subsp. aureus IS-88 ORF046
fig|904779.3.peg.1377 Staphylococcus aureus subsp. aureus IS-91 ORF046
fig|904780.3.peg.315 Staphylococcus aureus subsp. aureus IS-99 ORF046
fig|904782.3.peg.2265 Staphylococcus aureus subsp. aureus IS-111 ORF046
fig|904792.3.peg.2143 Staphylococcus aureus subsp. aureus IS-M ORF046
fig|904795.7.peg.2077 Staphylococcus aureus subsp. aureus CO-23 ORF046
fig|93061.3.peg.1442 Staphylococcus aureus subsp. aureus NCTC 8325 hypothetical protein within a prophage
fig|93061.5.peg.1396 Staphylococcus aureus subsp. aureus NCTC 8325 hypothetical protein within a prophage
fig|93062.19.peg.357 Staphylococcus aureus subsp. aureus COL hypothetical protein within a prophage
fig|93062.4.peg.830 Staphylococcus aureus subsp. aureus COL hypothetical protein within a prophage
fig|931432.3.peg.2241 Staphylococcus aureus subsp. aureus CIG1057 ORF046
fig|931433.3.peg.2026 Staphylococcus aureus subsp. aureus CIG1114 ORF046
fig|931434.3.peg.1969 Staphylococcus aureus subsp. aureus CIG1165 ORF046
fig|931435.3.peg.2173 Staphylococcus aureus subsp. aureus CIG1214 ORF046
fig|931436.3.peg.1552 Staphylococcus aureus subsp. aureus CIG1242 ORF046
fig|931437.3.peg.2315 Staphylococcus aureus subsp. aureus CIG1500 ORF046
fig|931438.3.peg.2224 Staphylococcus aureus subsp. aureus CIG1605 ORF046
fig|931441.3.peg.1768 Staphylococcus aureus subsp. aureus CIG1835 ORF046
fig|931442.3.peg.968 Staphylococcus aureus subsp. aureus CIG547 ORF046
fig|931443.3.peg.1985 Staphylococcus aureus subsp. aureus CIG1096 ORF046
fig|931445.3.peg.2185 Staphylococcus aureus subsp. aureus CIG1176 ORF046
fig|931446.3.peg.79 Staphylococcus aureus subsp. aureus CIG1213 ORF046
fig|931447.3.peg.2069 Staphylococcus aureus subsp. aureus CIG1233 ORF046
fig|931448.3.peg.2057 Staphylococcus aureus subsp. aureus CIG1612 ORF046
fig|931449.3.peg.2033 Staphylococcus aureus subsp. aureus CIG1770 ORF046
fig|931450.3.peg.2681 Staphylococcus aureus subsp. aureus CIG2018 ORF046
fig|931451.3.peg.2029 Staphylococcus aureus subsp. aureus CIG290 ORF046
fig|931452.3.peg.2023 Staphylococcus aureus subsp. aureus CIG1267 ORF046
fig|931453.3.peg.2086 Staphylococcus aureus subsp. aureus CIG149 ORF046
fig|931456.3.peg.2286 Staphylococcus aureus subsp. aureus CIGC341D ORF046
fig|931459.3.peg.1929 Staphylococcus aureus subsp. aureus CIGC128 ORF046
fig|948561.3.peg.2072 Staphylococcus aureus O11 hypothetical protein within a prophage