page	:SeedViewerServeFeature:
fid	:fig|93061.3.peg.2164:
show_prot_sequence	:1:

>fig|93061.3.peg.2164
MDAMSRIETARSLFLCLKRQNKSKHKERWLGEVKTFESDETRNVKYNKKQS


PEGs with Identical Sequence
PEG Genome Function
fig|1158465.3.peg.2672 Staphylococcus aureus M1064 hypothetical protein
fig|1169270.3.peg.2068 Staphylococcus aureus M1244 hypothetical protein
fig|908247.3.peg.2634 Staphylococcus aureus 16K hypothetical protein
fig|93061.3.peg.2164 Staphylococcus aureus subsp. aureus NCTC 8325 hypothetical protein