page	:SeedViewerServeFeature:
fid	:fig|868161.3.peg.4336:
show_prot_sequence	:1:

>fig|868161.3.peg.4336
MKPMHIAMALLSAAMFFVLAGVFMGVQLELDGTKLVVDTASDVRWQWVFIGTAVVFFFQL
LRPAFQKGLKSVSGPKFILPAIDGSTVKQKLFLVALLVLAVAWPFMVSRGTVDIATLTMI
YIILGLGLNVVVGLSGLLVLGYGGFYAIGAYTFALLNHYYGLGFWTCLPIAGLMAAAAGF
LLGFPVLRLRGDYLAIVTLGFGEIVRILLLNNTEITGGPNGISQIPKPTLFGLEFSRTAR
EGGWDTFSNFFGLKYDPSDRVIFLYLVALLLVVLSLFVINRLLRMPLGRAWEALREDEIA
CRSLGLSPRRIKLTAFTISAAFAGFAGTLFAARQGFVSPESFTFAESAFVLAIVVLGGMG
SQFAVILAAILLVVSRELMRDFNEYSMLMLGGLMVLMMIWRPQGLLPMTRPQLKLKNGAA
KGEQA


PEGs with Identical Sequence
PEG Genome Function
fig|1005462.3.peg.3625 Escherichia coli 8.0566 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1005464.3.peg.3623 Escherichia coli 8.0569 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1005562.3.peg.3782 Escherichia coli TW15901 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1005564.3.peg.3912 Escherichia coli TW00353 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1050617.5.peg.4289 Escherichia coli UMNF18 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1068608.3.peg.3697 Escherichia coli XH140A Branched-chain amino acid ABC transporter, permease protein LivM
fig|1069495.4.peg.3962 Escherichia coli XH001 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1090929.3.peg.3588 Escherichia coli O127:H27 str. C43/90 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1090930.3.peg.3553 Escherichia coli ONT:H33 str. C48/93 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1110693.3.peg.2884 Escherichia coli str. K-12 substr. MDS42 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1144303.3.peg.319 Escherichia coli J53 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1167694.3.peg.2841 Escherichia coli O32:H37 str. P4 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1169320.3.peg.4334 Escherichia coli KTE35 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1169333.3.peg.4057 Escherichia coli KTE14 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1169359.3.peg.4333 Escherichia coli KTE42 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1169361.3.peg.4628 Escherichia coli KTE44 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1169379.3.peg.3908 Escherichia coli KTE120 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1181743.3.peg.4208 Escherichia coli KTE197 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1181744.3.peg.4558 Escherichia coli KTE198 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1182658.3.peg.4564 Escherichia coli KTE51 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1182668.3.peg.3860 Escherichia coli KTE61 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1182678.3.peg.4440 Escherichia coli KTE71 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1182684.3.peg.4047 Escherichia coli KTE77 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1182688.3.peg.4118 Escherichia coli KTE81 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1182706.3.peg.4237 Escherichia coli KTE111 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1182715.3.peg.4493 Escherichia coli KTE130 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1182716.3.peg.4532 Escherichia coli KTE132 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1182729.3.peg.3903 Escherichia coli KTE155 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1182730.3.peg.4243 Escherichia coli KTE156 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1182733.3.peg.965 Escherichia coli KTE161 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1182738.3.peg.4171 Escherichia coli KTE171 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1227813.3.peg.3261 Escherichia coli S17 Branched-chain amino acid ABC transporter, permease protein LivM
fig|1246623.3.peg.3167 Escherichia coli O10:K5(L):H4 str. ATCC 23506 Branched-chain amino acid ABC transporter, permease protein LivM
fig|316385.5.peg.3575 Escherichia coli str. K-12 substr. DH10B Branched-chain amino acid ABC transporter, permease protein LivM
fig|316385.7.peg.3657 Escherichia coli str. K-12 substr. DH10B Branched-chain amino acid ABC transporter, permease protein LivM
fig|316407.3.peg.3672 Escherichia coli W3110 Branched-chain amino acid ABC transporter, permease protein LivM
fig|316407.9.peg.3859 Escherichia coli str. K-12 substr. W3110 Branched-chain amino acid ABC transporter, permease protein LivM
fig|469008.4.peg.302 Escherichia coli BL21(DE3) Branched-chain amino acid ABC transporter, permease protein LivM
fig|511145.12.peg.3554 Escherichia coli str. K-12 substr. MG1655 Branched-chain amino acid ABC transporter, permease protein LivM
fig|511145.6.peg.3537 Escherichia coli str. K-12 substr. MG1655 Branched-chain amino acid ABC transporter, permease protein LivM
fig|536056.3.peg.272 Escherichia coli DH1 Branched-chain amino acid ABC transporter, permease protein LivM
fig|595496.3.peg.3437 Escherichia coli BW2952 Branched-chain amino acid ABC transporter, permease protein LivM
fig|656413.3.peg.2484 Escherichia coli H730 Branched-chain amino acid ABC transporter, permease protein LivM
fig|656414.3.peg.3943 Escherichia coli H736 Branched-chain amino acid ABC transporter, permease protein LivM
fig|656421.3.peg.3297 Escherichia coli M919 Branched-chain amino acid ABC transporter, permease protein LivM
fig|670892.3.peg.5153 Escherichia coli 3431 Branched-chain amino acid ABC transporter, permease protein LivM
fig|749540.3.peg.2400 Escherichia coli MS 146-1 Branched-chain amino acid ABC transporter, permease protein LivM
fig|749548.3.peg.1241 Escherichia coli MS 196-1 Branched-chain amino acid ABC transporter, permease protein LivM
fig|752788.3.peg.2685 Escherichia coli 75 Branched-chain amino acid ABC transporter, permease protein LivM
fig|754078.3.peg.3765 Escherichia coli G58-1 Branched-chain amino acid ABC transporter, permease protein LivM
fig|754087.3.peg.4083 Escherichia coli STEC_EH250 Branched-chain amino acid ABC transporter, permease protein LivM
fig|754090.3.peg.4374 Escherichia coli STEC_S1191 Branched-chain amino acid ABC transporter, permease protein LivM
fig|83333.1.peg.3389 Escherichia coli K12 Branched-chain amino acid ABC transporter, permease protein LivM
fig|868160.3.peg.4106 Escherichia coli DEC6A Branched-chain amino acid ABC transporter, permease protein LivM
fig|868161.3.peg.4336 Escherichia coli DEC6B Branched-chain amino acid ABC transporter, permease protein LivM
fig|868162.3.peg.4214 Escherichia coli DEC6C Branched-chain amino acid ABC transporter, permease protein LivM
fig|868163.3.peg.4105 Escherichia coli DEC6D Branched-chain amino acid ABC transporter, permease protein LivM
fig|868164.3.peg.3941 Escherichia coli DEC6E Branched-chain amino acid ABC transporter, permease protein LivM
fig|869688.4.peg.5340 Escherichia coli 2.3916 Branched-chain amino acid ABC transporter, permease protein LivM
fig|869688.5.peg.4994 Escherichia coli 2.3916 Branched-chain amino acid ABC transporter, permease protein LivM
fig|869690.3.peg.648 Escherichia coli 2.4168 Branched-chain amino acid ABC transporter, permease protein LivM
fig|869690.4.peg.2466 Escherichia coli 2.4168 Branched-chain amino acid ABC transporter, permease protein LivM
fig|869691.3.peg.658 Escherichia coli 3.2303 Branched-chain amino acid ABC transporter, permease protein LivM
fig|869691.4.peg.891 Escherichia coli 3.2303 Branched-chain amino acid ABC transporter, permease protein LivM
fig|869694.3.peg.4582 Escherichia coli B41 Branched-chain amino acid ABC transporter, permease protein LivM
fig|869694.4.peg.3365 Escherichia coli B41 Branched-chain amino acid ABC transporter, permease protein LivM
fig|879462.4.peg.3486 Escherichia coli str. K-12 substr. MG1655star Branched-chain amino acid ABC transporter, permease protein LivM