page	:SeedViewerServeFeature:
fid	:fig|451515.3.peg.587:
show_prot_sequence	:1:

>fig|451515.3.peg.587
MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVEL
TSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVE
LK


PEGs with Identical Sequence
PEG Genome Function
fig|1006543.3.peg.541 Staphylococcus aureus subsp. aureus T0131 LSU ribosomal protein L7/L12 (P1/P2)
fig|1028799.3.peg.457 Staphylococcus aureus subsp. aureus VC40 LSU ribosomal protein L7/L12 (P1/P2)
fig|1074252.3.peg.476 Staphylococcus aureus subsp. aureus HO 5096 0412 LSU ribosomal protein L7/L12 (P1/P2)
fig|1075076.3.peg.491 Staphylococcus aureus ST228/10388 LSU ribosomal protein L7/L12 (P1/P2)
fig|1075077.3.peg.493 Staphylococcus aureus ST228/10497 LSU ribosomal protein L7/L12 (P1/P2)
fig|1075078.3.peg.488 Staphylococcus aureus ST228/15532 LSU ribosomal protein L7/L12 (P1/P2)
fig|1075079.3.peg.487 Staphylococcus aureus ST228/16035 LSU ribosomal protein L7/L12 (P1/P2)
fig|1075082.3.peg.489 Staphylococcus aureus ST228/18412 LSU ribosomal protein L7/L12 (P1/P2)
fig|1112349.3.peg.2228 Staphylococcus aureus subsp. aureus NN50 LSU ribosomal protein L7/L12 (P1/P2)
fig|1116214.3.peg.472 Staphylococcus aureus subsp. aureus VRS1 LSU ribosomal protein L7/L12 (P1/P2)
fig|1116215.3.peg.467 Staphylococcus aureus subsp. aureus VRS2 LSU ribosomal protein L7/L12 (P1/P2)
fig|1116216.3.peg.459 Staphylococcus aureus subsp. aureus VRS3a LSU ribosomal protein L7/L12 (P1/P2)
fig|1116217.3.peg.470 Staphylococcus aureus subsp. aureus VRS4 LSU ribosomal protein L7/L12 (P1/P2)
fig|1116218.3.peg.475 Staphylococcus aureus subsp. aureus VRS5 LSU ribosomal protein L7/L12 (P1/P2)
fig|1116219.3.peg.452 Staphylococcus aureus subsp. aureus VRS6 LSU ribosomal protein L7/L12 (P1/P2)
fig|1116220.3.peg.504 Staphylococcus aureus subsp. aureus VRS7 LSU ribosomal protein L7/L12 (P1/P2)
fig|1116221.3.peg.475 Staphylococcus aureus subsp. aureus VRS8 LSU ribosomal protein L7/L12 (P1/P2)
fig|1116222.3.peg.499 Staphylococcus aureus subsp. aureus VRS9 LSU ribosomal protein L7/L12 (P1/P2)
fig|1116223.3.peg.504 Staphylococcus aureus subsp. aureus VRS10 LSU ribosomal protein L7/L12 (P1/P2)
fig|1116224.3.peg.524 Staphylococcus aureus subsp. aureus VRS11a LSU ribosomal protein L7/L12 (P1/P2)
fig|1116225.3.peg.523 Staphylococcus aureus subsp. aureus VRS11b LSU ribosomal protein L7/L12 (P1/P2)
fig|1118959.3.peg.505 Staphylococcus aureus subsp. aureus M013 LSU ribosomal protein L7/L12 (P1/P2)
fig|1123523.3.peg.509 Staphylococcus aureus subsp. aureus 11819-97 LSU ribosomal protein L7/L12 (P1/P2)
fig|1134842.3.peg.2227 Staphylococcus aureus subsp. aureus CM05 LSU ribosomal protein L7/L12 (P1/P2)
fig|1137129.3.peg.217 Staphylococcus aureus subsp. aureus 091751 LSU ribosomal protein L7/L12 (P1/P2)
fig|1137130.3.peg.890 Staphylococcus aureus subsp. aureus 103564 LSU ribosomal protein L7/L12 (P1/P2)
fig|1137132.3.peg.1013 Staphylococcus aureus subsp. aureus 112808A LSU ribosomal protein L7/L12 (P1/P2)
fig|1137133.3.peg.910 Staphylococcus aureus subsp. aureus MRGR3 LSU ribosomal protein L7/L12 (P1/P2)
fig|1144271.3.peg.2483 Staphylococcus aureus subsp. aureus 118 LSU ribosomal protein L7/L12 (P1/P2)
fig|1144272.3.peg.2563 Staphylococcus aureus subsp. aureus GR1 LSU ribosomal protein L7/L12 (P1/P2)
fig|1147034.3.peg.2594 Staphylococcus aureus PM1 LSU ribosomal protein L7/L12 (P1/P2)
fig|1155079.3.peg.2143 Staphylococcus aureus subsp. aureus DR10 LSU ribosomal protein L7/L12 (P1/P2)
fig|1155084.3.peg.457 Staphylococcus aureus subsp. aureus 71193 LSU ribosomal protein L7/L12 (P1/P2)
fig|1156994.3.peg.24 Staphylococcus aureus HI049 LSU ribosomal protein L7/L12 (P1/P2)
fig|1156995.3.peg.1186 Staphylococcus aureus HI010 LSU ribosomal protein L7/L12 (P1/P2)
fig|1156996.3.peg.24 Staphylococcus aureus HI049B LSU ribosomal protein L7/L12 (P1/P2)
fig|1156997.3.peg.543 Staphylococcus aureus HI010B LSU ribosomal protein L7/L12 (P1/P2)
fig|1156998.3.peg.23 Staphylococcus aureus HIF003_B2N-C LSU ribosomal protein L7/L12 (P1/P2)
fig|1156999.3.peg.475 Staphylococcus aureus HI022 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157000.3.peg.514 Staphylococcus aureus HI049C LSU ribosomal protein L7/L12 (P1/P2)
fig|1157001.3.peg.1081 Staphylococcus aureus HI168 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157002.3.peg.231 Staphylococcus aureus HI111 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157003.3.peg.1085 Staphylococcus aureus HI013 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157004.3.peg.1170 Staphylococcus aureus M0001 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157005.3.peg.26 Staphylococcus aureus M0029 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157006.3.peg.31 Staphylococcus aureus M0035 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157007.3.peg.1547 Staphylococcus aureus M0045 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157008.3.peg.1067 Staphylococcus aureus M0060 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157009.3.peg.1051 Staphylococcus aureus M0066 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157010.3.peg.450 Staphylococcus aureus M0102 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157011.3.peg.1061 Staphylococcus aureus M0103 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157012.3.peg.1313 Staphylococcus aureus M0150 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157013.3.peg.1375 Staphylococcus aureus M0173 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157014.3.peg.459 Staphylococcus aureus M0192 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157015.3.peg.1221 Staphylococcus aureus M0197 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157016.3.peg.1339 Staphylococcus aureus M0221 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157017.3.peg.531 Staphylococcus aureus M0237 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157018.3.peg.23 Staphylococcus aureus M0239 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157019.3.peg.1462 Staphylococcus aureus M0252 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157020.3.peg.30 Staphylococcus aureus M0326 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157021.3.peg.24 Staphylococcus aureus M0328 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157022.3.peg.484 Staphylococcus aureus M0329 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157023.3.peg.1160 Staphylococcus aureus M0330 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157024.3.peg.1203 Staphylococcus aureus M0340 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157025.3.peg.521 Staphylococcus aureus M0347 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157026.3.peg.470 Staphylococcus aureus M0364 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157027.3.peg.1052 Staphylococcus aureus M0391 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157029.3.peg.454 Staphylococcus aureus M0427 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157030.3.peg.452 Staphylococcus aureus M0450 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157031.3.peg.2321 Staphylococcus aureus M0467 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157032.3.peg.45 Staphylococcus aureus M0468 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157033.3.peg.413 Staphylococcus aureus M0478 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157034.3.peg.557 Staphylococcus aureus M0489 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157035.3.peg.24 Staphylococcus aureus M0494 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157036.3.peg.470 Staphylococcus aureus B53639 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157037.3.peg.476 Staphylococcus aureus B40723 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157038.3.peg.457 Staphylococcus aureus B40950 LSU ribosomal protein L7/L12 (P1/P2)
fig|1157039.3.peg.425 Staphylococcus aureus B147830 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158461.3.peg.61 Staphylococcus aureus M0628 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158462.3.peg.1217 Staphylococcus aureus M0529 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158463.3.peg.1247 Staphylococcus aureus M1063 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158464.3.peg.64 Staphylococcus aureus M1076 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158465.3.peg.1071 Staphylococcus aureus M1064 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158466.3.peg.1154 Staphylococcus aureus M1092 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158467.3.peg.248 Staphylococcus aureus M1093 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158468.3.peg.428 Staphylococcus aureus M1095 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158469.3.peg.1301 Staphylococcus aureus M1103 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158470.3.peg.1009 Staphylococcus aureus M1119 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158471.3.peg.462 Staphylococcus aureus M1167 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158472.3.peg.1332 Staphylococcus aureus M1170 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158473.3.peg.25 Staphylococcus aureus M1188 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158474.3.peg.2338 Staphylococcus aureus M1198 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158475.3.peg.1593 Staphylococcus aureus M1199 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158476.3.peg.2343 Staphylococcus aureus M1215 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158477.3.peg.23 Staphylococcus aureus M1216 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158478.3.peg.2311 Staphylococcus aureus M1229 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158479.3.peg.463 Staphylococcus aureus M1248 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158480.3.peg.1340 Staphylococcus aureus M1253 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158481.3.peg.459 Staphylococcus aureus M1255 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158482.3.peg.460 Staphylococcus aureus M1257 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158483.3.peg.24 Staphylococcus aureus M1277 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158484.3.peg.461 Staphylococcus aureus M1291 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158485.3.peg.2616 Staphylococcus aureus M1311 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158486.3.peg.62 Staphylococcus aureus M1320 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158487.3.peg.468 Staphylococcus aureus M1321 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158488.3.peg.2310 Staphylococcus aureus M1322 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158489.3.peg.1347 Staphylococcus aureus M1359 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158490.3.peg.29 Staphylococcus aureus M1367 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158491.3.peg.1001 Staphylococcus aureus M1373 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158492.3.peg.1357 Staphylococcus aureus M1394 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158493.3.peg.27 Staphylococcus aureus M1450 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158494.3.peg.478 Staphylococcus aureus M1451 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158495.3.peg.493 Staphylococcus aureus M1462 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158496.3.peg.281 Staphylococcus aureus M1463 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158497.3.peg.24 Staphylococcus aureus M1481 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158498.3.peg.1048 Staphylococcus aureus M1520 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158499.3.peg.59 Staphylococcus aureus M1521 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158500.3.peg.383 Staphylococcus aureus M1531 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158501.3.peg.62 Staphylococcus aureus M1533 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158502.3.peg.465 Staphylococcus aureus M1544 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158503.3.peg.460 Staphylococcus aureus M1556 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158504.3.peg.698 Staphylococcus aureus M1563 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158505.3.peg.1454 Staphylococcus aureus M1565 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158506.3.peg.462 Staphylococcus aureus M1578 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158507.3.peg.1298 Staphylococcus aureus M0006 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158508.3.peg.443 Staphylococcus aureus M0055 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158509.3.peg.1044 Staphylococcus aureus M0077 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158510.3.peg.453 Staphylococcus aureus M0108 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158511.3.peg.1275 Staphylococcus aureus M0144 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158512.3.peg.485 Staphylococcus aureus M0154 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158513.3.peg.62 Staphylococcus aureus M0177 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158514.3.peg.80 Staphylococcus aureus M0200 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158515.3.peg.462 Staphylococcus aureus M0212 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158516.3.peg.24 Staphylococcus aureus M0216 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158517.3.peg.1053 Staphylococcus aureus M0235 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158518.3.peg.1452 Staphylococcus aureus M0250 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158520.3.peg.2447 Staphylococcus aureus M0280 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158521.3.peg.458 Staphylococcus aureus M0306 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158522.3.peg.1301 Staphylococcus aureus M0334 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158523.3.peg.1072 Staphylococcus aureus M0350 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158524.3.peg.512 Staphylococcus aureus M0351 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158525.3.peg.400 Staphylococcus aureus M0363 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158526.3.peg.1346 Staphylococcus aureus M0367 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158527.3.peg.2352 Staphylococcus aureus M0374 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158528.3.peg.1046 Staphylococcus aureus M0375 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158529.3.peg.678 Staphylococcus aureus M0396 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158530.3.peg.1091 Staphylococcus aureus M0424 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158531.3.peg.460 Staphylococcus aureus M0438 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158533.3.peg.32 Staphylococcus aureus M0510 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158535.3.peg.460 Staphylococcus aureus M0562 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158536.3.peg.1532 Staphylococcus aureus M0571 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158537.3.peg.460 Staphylococcus aureus M0584 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158538.3.peg.1182 Staphylococcus aureus M0586 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158539.3.peg.476 Staphylococcus aureus M0633 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158682.3.peg.515 Staphylococcus aureus M0528 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158683.3.peg.24 Staphylococcus aureus M0531 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158684.3.peg.470 Staphylococcus aureus M0536 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158685.3.peg.1294 Staphylococcus aureus M0539 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158686.3.peg.1282 Staphylococcus aureus M0547 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158687.3.peg.461 Staphylococcus aureus M0565 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158688.3.peg.2335 Staphylococcus aureus M0580 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158689.3.peg.53 Staphylococcus aureus M0602 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158690.3.peg.463 Staphylococcus aureus M0622 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158691.3.peg.499 Staphylococcus aureus M0676 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158692.3.peg.240 Staphylococcus aureus M0687 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158693.3.peg.1056 Staphylococcus aureus M0692 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158694.3.peg.1151 Staphylococcus aureus M0719 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158695.3.peg.464 Staphylococcus aureus M0769 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158696.3.peg.1532 Staphylococcus aureus M0770 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158697.3.peg.465 Staphylococcus aureus M0780 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158698.3.peg.1282 Staphylococcus aureus M0799 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158699.3.peg.464 Staphylococcus aureus M0823 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158700.3.peg.1154 Staphylococcus aureus M0844 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158701.3.peg.1528 Staphylococcus aureus M0934 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158702.3.peg.464 Staphylococcus aureus M0943 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158703.3.peg.421 Staphylococcus aureus M0944 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158704.3.peg.62 Staphylococcus aureus M0953 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158705.3.peg.62 Staphylococcus aureus M0998 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158706.3.peg.482 Staphylococcus aureus M0999 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158707.3.peg.1095 Staphylococcus aureus M1007 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158708.3.peg.24 Staphylococcus aureus M1010 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158709.3.peg.604 Staphylococcus aureus M1015 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158710.3.peg.62 Staphylococcus aureus M1016 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158711.3.peg.127 Staphylococcus aureus M1036 LSU ribosomal protein L7/L12 (P1/P2)
fig|1158712.3.peg.463 Staphylococcus aureus M1037 LSU ribosomal protein L7/L12 (P1/P2)
fig|1161392.3.peg.1969 Staphylococcus aureus NN54 LSU ribosomal protein L7/L12 (P1/P2)
fig|1169256.3.peg.464 Staphylococcus aureus M0964 LSU ribosomal protein L7/L12 (P1/P2)
fig|1169257.3.peg.68 Staphylococcus aureus M0978 LSU ribosomal protein L7/L12 (P1/P2)
fig|1169258.3.peg.29 Staphylococcus aureus M0994 LSU ribosomal protein L7/L12 (P1/P2)
fig|1169260.3.peg.472 Staphylococcus aureus M1044 LSU ribosomal protein L7/L12 (P1/P2)
fig|1169261.3.peg.1064 Staphylococcus aureus M1061 LSU ribosomal protein L7/L12 (P1/P2)
fig|1169262.3.peg.464 Staphylococcus aureus M1062 LSU ribosomal protein L7/L12 (P1/P2)
fig|1169263.3.peg.461 Staphylococcus aureus M1068 LSU ribosomal protein L7/L12 (P1/P2)
fig|1169264.3.peg.461 Staphylococcus aureus M1083 LSU ribosomal protein L7/L12 (P1/P2)
fig|1169265.3.peg.1149 Staphylococcus aureus M1109 LSU ribosomal protein L7/L12 (P1/P2)
fig|1169266.3.peg.463 Staphylococcus aureus M1126 LSU ribosomal protein L7/L12 (P1/P2)
fig|1169267.3.peg.26 Staphylococcus aureus M1142 LSU ribosomal protein L7/L12 (P1/P2)
fig|1169268.3.peg.1087 Staphylococcus aureus M1223 LSU ribosomal protein L7/L12 (P1/P2)
fig|1169269.3.peg.459 Staphylococcus aureus M1224 LSU ribosomal protein L7/L12 (P1/P2)
fig|1169270.3.peg.517 Staphylococcus aureus M1244 LSU ribosomal protein L7/L12 (P1/P2)
fig|1169272.3.peg.522 Staphylococcus aureus M1275 LSU ribosomal protein L7/L12 (P1/P2)
fig|1169273.3.peg.463 Staphylococcus aureus M1286 LSU ribosomal protein L7/L12 (P1/P2)
fig|1169274.3.peg.463 Staphylococcus aureus M1309 LSU ribosomal protein L7/L12 (P1/P2)
fig|1169275.3.peg.461 Staphylococcus aureus M1374 LSU ribosomal protein L7/L12 (P1/P2)
fig|1169276.3.peg.463 Staphylococcus aureus M1405 LSU ribosomal protein L7/L12 (P1/P2)
fig|1169277.3.peg.464 Staphylococcus aureus M1510 LSU ribosomal protein L7/L12 (P1/P2)
fig|1213721.3.peg.1161 Staphylococcus aureus M0648 LSU ribosomal protein L7/L12 (P1/P2)
fig|1213722.3.peg.1060 Staphylococcus aureus M0660 LSU ribosomal protein L7/L12 (P1/P2)
fig|1213723.3.peg.454 Staphylococcus aureus M0663 LSU ribosomal protein L7/L12 (P1/P2)
fig|1213724.3.peg.465 Staphylococcus aureus M0673 LSU ribosomal protein L7/L12 (P1/P2)
fig|1213725.3.peg.504 Staphylococcus aureus M0695 LSU ribosomal protein L7/L12 (P1/P2)
fig|1213726.3.peg.465 Staphylococcus aureus M0792 LSU ribosomal protein L7/L12 (P1/P2)
fig|1213727.3.peg.461 Staphylococcus aureus M0822 LSU ribosomal protein L7/L12 (P1/P2)
fig|1213728.3.peg.25 Staphylococcus aureus M0831 LSU ribosomal protein L7/L12 (P1/P2)
fig|1213729.3.peg.462 Staphylococcus aureus M0871 LSU ribosomal protein L7/L12 (P1/P2)
fig|1213730.3.peg.2592 Staphylococcus aureus M0877 LSU ribosomal protein L7/L12 (P1/P2)
fig|1213732.3.peg.469 Staphylococcus aureus M0892 LSU ribosomal protein L7/L12 (P1/P2)
fig|1213733.3.peg.438 Staphylococcus aureus M0900 LSU ribosomal protein L7/L12 (P1/P2)
fig|1213734.3.peg.461 Staphylococcus aureus M0927 LSU ribosomal protein L7/L12 (P1/P2)
fig|1214901.3.peg.1520 Staphylococcus aureus M0646 LSU ribosomal protein L7/L12 (P1/P2)
fig|1216363.3.peg.579 Staphylococcus aureus subsp. aureus 06BA18369 LSU ribosomal protein L7/L12 (P1/P2)
fig|1221451.3.peg.1153 Staphylococcus aureus subsp. aureus 120 LSU ribosomal protein L7/L12 (P1/P2)
fig|1221452.3.peg.2043 Staphylococcus aureus subsp. aureus 333 LSU ribosomal protein L7/L12 (P1/P2)
fig|1221453.3.peg.1380 Staphylococcus aureus subsp. aureus 3989 LSU ribosomal protein L7/L12 (P1/P2)
fig|1224919.3.peg.1201 Staphylococcus aureus M0104 LSU ribosomal protein L7/L12 (P1/P2)
fig|1224920.3.peg.1088 Staphylococcus aureus M0171 LSU ribosomal protein L7/L12 (P1/P2)
fig|1224921.3.peg.2119 Staphylococcus aureus M0210 LSU ribosomal protein L7/L12 (P1/P2)
fig|1224922.3.peg.1351 Staphylococcus aureus M0213 LSU ribosomal protein L7/L12 (P1/P2)
fig|1224923.3.peg.412 Staphylococcus aureus M0240 LSU ribosomal protein L7/L12 (P1/P2)
fig|1224924.3.peg.1042 Staphylococcus aureus M0270 LSU ribosomal protein L7/L12 (P1/P2)
fig|1224925.3.peg.1330 Staphylococcus aureus M0273 LSU ribosomal protein L7/L12 (P1/P2)
fig|1224926.3.peg.31 Staphylococcus aureus M0279 LSU ribosomal protein L7/L12 (P1/P2)
fig|1224927.3.peg.24 Staphylococcus aureus M0288 LSU ribosomal protein L7/L12 (P1/P2)
fig|1224928.3.peg.64 Staphylococcus aureus M0312 LSU ribosomal protein L7/L12 (P1/P2)
fig|1224929.3.peg.237 Staphylococcus aureus M0404 LSU ribosomal protein L7/L12 (P1/P2)
fig|1224930.3.peg.1143 Staphylococcus aureus M0415 LSU ribosomal protein L7/L12 (P1/P2)
fig|1224931.3.peg.61 Staphylococcus aureus M0455 LSU ribosomal protein L7/L12 (P1/P2)
fig|1224932.3.peg.24 Staphylococcus aureus M0460 LSU ribosomal protein L7/L12 (P1/P2)
fig|1224933.3.peg.1339 Staphylococcus aureus M0493 LSU ribosomal protein L7/L12 (P1/P2)
fig|1226740.3.peg.2189 Staphylococcus aureus subsp. aureus VH60 LSU ribosomal protein L7/L12 (P1/P2)
fig|1229492.3.peg.576 Staphylococcus aureus 08BA02176 LSU ribosomal protein L7/L12 (P1/P2)
fig|1231382.3.peg.1224 Staphylococcus aureus KT/Y21 LSU ribosomal protein L7/L12 (P1/P2)
fig|1231383.3.peg.1454 Staphylococcus aureus KT/314250 LSU ribosomal protein L7/L12 (P1/P2)
fig|1235275.3.peg.616 Staphylococcus aureus PPUKM-261-2009 LSU ribosomal protein L7/L12 (P1/P2)
fig|1235276.3.peg.604 Staphylococcus aureus PPUKM-332-2009 LSU ribosomal protein L7/L12 (P1/P2)
fig|1235277.3.peg.513 Staphylococcus aureus PPUKM-377-2009 LSU ribosomal protein L7/L12 (P1/P2)
fig|1235278.3.peg.595 Staphylococcus aureus PPUKM-775-2009 LSU ribosomal protein L7/L12 (P1/P2)
fig|1241616.3.peg.23 Staphylococcus aureus subsp. aureus DSM 20231 LSU ribosomal protein L7/L12 (P1/P2)
fig|1242970.3.peg.518 Staphylococcus aureus CN79 LSU ribosomal protein L7/L12 (P1/P2)
fig|1258575.3.peg.2317 Staphylococcus aureus subsp. aureus H29 LSU ribosomal protein L7/L12 (P1/P2)
fig|1265302.3.peg.1430 Staphylococcus aureus subsp. aureus PB32 LSU ribosomal protein L7/L12 (P1/P2)
fig|1278071.4.peg.1181 Staphylococcus aureus 3957 LSU ribosomal protein L7/L12 (P1/P2)
fig|1278072.4.peg.1977 Staphylococcus aureus LVP2 LSU ribosomal protein L7/L12 (P1/P2)
fig|1278074.4.peg.680 Staphylococcus aureus VH221 LSU ribosomal protein L7/L12 (P1/P2)
fig|1278075.4.peg.1797 Staphylococcus aureus LVP5 LSU ribosomal protein L7/L12 (P1/P2)
fig|1283278.3.peg.469 Staphylococcus aureus KLT6 LSU ribosomal protein L7/L12 (P1/P2)
fig|1288493.3.peg.2510 Staphylococcus aureus subsp. aureus S1800 LSU ribosomal protein L7/L12 (P1/P2)
fig|1303780.3.peg.2347 Staphylococcus aureus M0075 LSU ribosomal protein L7/L12 (P1/P2)
fig|1303781.3.peg.1307 Staphylococcus aureus M0294 LSU ribosomal protein L7/L12 (P1/P2)
fig|1303782.3.peg.1185 Staphylococcus aureus M1060 LSU ribosomal protein L7/L12 (P1/P2)
fig|1303783.3.peg.24 Staphylococcus aureus M1078 LSU ribosomal protein L7/L12 (P1/P2)
fig|1303784.3.peg.1351 Staphylococcus aureus M1193 LSU ribosomal protein L7/L12 (P1/P2)
fig|1303785.3.peg.1144 Staphylococcus aureus M1228 LSU ribosomal protein L7/L12 (P1/P2)
fig|1303786.3.peg.1191 Staphylococcus aureus M1407 LSU ribosomal protein L7/L12 (P1/P2)
fig|1303787.3.peg.484 Staphylococcus aureus M1466 LSU ribosomal protein L7/L12 (P1/P2)
fig|1305598.3.peg.522 Staphylococcus aureus M1 LSU ribosomal protein L7/L12 (P1/P2)
fig|1323661.3.peg.535 Staphylococcus aureus CA-347 LSU ribosomal protein L7/L12 (P1/P2)
fig|1331008.3.peg.2103 Staphylococcus aureus subsp. aureus CBD-635 LSU ribosomal protein L7/L12 (P1/P2)
fig|158878.1.peg.540 Staphylococcus aureus subsp. aureus Mu50 LSU ribosomal protein L7/L12 (P1/P2)
fig|158878.14.peg.546 Staphylococcus aureus subsp. aureus Mu50 LSU ribosomal protein L7/L12 (P1/P2)
fig|158879.1.peg.512 Staphylococcus aureus subsp. aureus N315 LSU ribosomal protein L7/L12 (P1/P2)
fig|158879.11.peg.524 Staphylococcus aureus subsp. aureus N315 LSU ribosomal protein L7/L12 (P1/P2)
fig|196620.1.peg.495 Staphylococcus aureus subsp. aureus MW2 LSU ribosomal protein L7/L12 (P1/P2)
fig|196620.5.peg.524 Staphylococcus aureus subsp. aureus MW2 LSU ribosomal protein L7/L12 (P1/P2)
fig|282459.1.peg.493 Staphylococcus aureus subsp. aureus MSSA476 LSU ribosomal protein L7/L12 (P1/P2)
fig|282459.5.peg.520 Staphylococcus aureus subsp. aureus MSSA476 LSU ribosomal protein L7/L12 (P1/P2)
fig|359786.13.peg.615 Staphylococcus aureus subsp. aureus JH9 LSU ribosomal protein L7/L12 (P1/P2)
fig|359786.3.peg.484 Staphylococcus aureus subsp. aureus JH9 LSU ribosomal protein L7/L12 (P1/P2)
fig|359787.11.peg.605 Staphylococcus aureus subsp. aureus JH1 LSU ribosomal protein L7/L12 (P1/P2)
fig|359787.3.peg.401 Staphylococcus aureus subsp. aureus JH1 LSU ribosomal protein L7/L12 (P1/P2)
fig|367830.3.peg.456 Staphylococcus aureus subsp. aureus USA300 LSU ribosomal protein L7/L12 (P1/P2)
fig|418127.4.peg.506 Staphylococcus aureus subsp. aureus Mu3 LSU ribosomal protein L7/L12 (P1/P2)
fig|418127.6.peg.543 Staphylococcus aureus subsp. aureus Mu3 LSU ribosomal protein L7/L12 (P1/P2)
fig|450394.6.peg.445 Staphylococcus aureus subsp. aureus USA300_TCH959 LSU ribosomal protein L7/L12 (P1/P2)
fig|451515.3.peg.587 Staphylococcus aureus subsp. aureus USA300_FPR3757 LSU ribosomal protein L7/L12 (P1/P2)
fig|451516.9.peg.577 Staphylococcus aureus subsp. aureus USA300_TCH1516 LSU ribosomal protein L7/L12 (P1/P2)
fig|452948.4.peg.1603 Staphylococcus aureus 930918-3 LSU ribosomal protein L7/L12 (P1/P2)
fig|455227.3.peg.1616 Staphylococcus aureus D30 LSU ribosomal protein L7/L12 (P1/P2)
fig|505321.3.peg.1155 Staphylococcus aureus subsp. aureus str. CF-Marseille LSU ribosomal protein L7/L12 (P1/P2)
fig|543539.3.peg.1972 Staphylococcus aureus subsp. aureus CGS01 LSU ribosomal protein L7/L12 (P1/P2)
fig|543540.3.peg.2164 Staphylococcus aureus subsp. aureus CGS03 LSU ribosomal protein L7/L12 (P1/P2)
fig|546342.3.peg.2668 Staphylococcus aureus subsp. aureus str. JKD6008 LSU ribosomal protein L7/L12 (P1/P2)
fig|546342.4.peg.571 Staphylococcus aureus subsp. aureus str. JKD6008 LSU ribosomal protein L7/L12 (P1/P2)
fig|546343.3.peg.1045 Staphylococcus aureus subsp. aureus str. JKD6009 LSU ribosomal protein L7/L12 (P1/P2)
fig|548474.3.peg.2106 Staphylococcus aureus subsp. aureus TCH130 LSU ribosomal protein L7/L12 (P1/P2)
fig|548475.3.peg.24 Staphylococcus aureus subsp. aureus TCH70 LSU ribosomal protein L7/L12 (P1/P2)
fig|553565.3.peg.515 Staphylococcus aureus A5937 LSU ribosomal protein L7/L12 (P1/P2)
fig|553567.3.peg.2224 Staphylococcus aureus A5948 LSU ribosomal protein L7/L12 (P1/P2)
fig|553568.3.peg.748 Staphylococcus aureus A6224 LSU ribosomal protein L7/L12 (P1/P2)
fig|553571.3.peg.1367 Staphylococcus aureus A6300 LSU ribosomal protein L7/L12 (P1/P2)
fig|553573.3.peg.1886 Staphylococcus aureus A8115 LSU ribosomal protein L7/L12 (P1/P2)
fig|553574.3.peg.2285 Staphylococcus aureus A8117 LSU ribosomal protein L7/L12 (P1/P2)
fig|553577.3.peg.2310 Staphylococcus aureus A8796 LSU ribosomal protein L7/L12 (P1/P2)
fig|553580.3.peg.2060 Staphylococcus aureus A8819 LSU ribosomal protein L7/L12 (P1/P2)
fig|553581.3.peg.2360 Staphylococcus aureus A9299 LSU ribosomal protein L7/L12 (P1/P2)
fig|553583.3.peg.125 Staphylococcus aureus A9635 LSU ribosomal protein L7/L12 (P1/P2)
fig|553588.3.peg.735 Staphylococcus aureus A9719 LSU ribosomal protein L7/L12 (P1/P2)
fig|553590.4.peg.2365 Staphylococcus aureus A9754 LSU ribosomal protein L7/L12 (P1/P2)
fig|553592.3.peg.1255 Staphylococcus aureus A9763 LSU ribosomal protein L7/L12 (P1/P2)
fig|553594.3.peg.1859 Staphylococcus aureus A9765 LSU ribosomal protein L7/L12 (P1/P2)
fig|553596.3.peg.2287 Staphylococcus aureus A9781 LSU ribosomal protein L7/L12 (P1/P2)
fig|553601.3.peg.2269 Staphylococcus aureus A10102 LSU ribosomal protein L7/L12 (P1/P2)
fig|561307.5.peg.2162 Staphylococcus aureus subsp. aureus RN4220 LSU ribosomal protein L7/L12 (P1/P2)
fig|585152.3.peg.457 Staphylococcus aureus subsp. aureus D139 LSU ribosomal protein L7/L12 (P1/P2)
fig|585155.3.peg.1083 Staphylococcus aureus subsp. aureus H19 LSU ribosomal protein L7/L12 (P1/P2)
fig|585891.3.peg.545 Staphylococcus aureus subsp. aureus Mu50-omega LSU ribosomal protein L7/L12 (P1/P2)
fig|644279.4.peg.612 Staphylococcus aureus subsp. aureus 132 LSU ribosomal protein L7/L12 (P1/P2)
fig|663951.4.peg.640 Staphylococcus aureus subsp. aureus TW20 LSU ribosomal protein L7/L12 (P1/P2)
fig|680649.3.peg.1135 Staphylococcus aureus subsp. aureus MR1 LSU ribosomal protein L7/L12 (P1/P2)
fig|681288.4.peg.493 Staphylococcus aureus subsp. aureus ED98 LSU ribosomal protein L7/L12 (P1/P2)
fig|685039.3.peg.594 Staphylococcus aureus subsp. aureus ED133 LSU ribosomal protein L7/L12 (P1/P2)
fig|703339.3.peg.521 Staphylococcus aureus 04-02981 LSU ribosomal protein L7/L12 (P1/P2)
fig|754025.3.peg.110 Staphylococcus aureus subsp. aureus MRSA131 LSU ribosomal protein L7/L12 (P1/P2)
fig|754026.3.peg.2386 Staphylococcus aureus subsp. aureus MRSA177 LSU ribosomal protein L7/L12 (P1/P2)
fig|762962.3.peg.154 Staphylococcus aureus subsp. aureus ATCC 51811 LSU ribosomal protein L7/L12 (P1/P2)
fig|862516.3.peg.2759 Staphylococcus aureus subsp. aureus ATCC BAA-39 LSU ribosomal protein L7/L12 (P1/P2)
fig|869816.3.peg.523 Staphylococcus aureus subsp. aureus JKD6159 LSU ribosomal protein L7/L12 (P1/P2)
fig|889933.4.peg.474 Staphylococcus aureus subsp. aureus ECT-R 2 LSU ribosomal protein L7/L12 (P1/P2)
fig|904313.3.peg.361 Staphylococcus aureus subsp. aureus VCU006 LSU ribosomal protein L7/L12 (P1/P2)
fig|904723.3.peg.254 Staphylococcus aureus subsp. aureus 21172 LSU ribosomal protein L7/L12 (P1/P2)
fig|904724.3.peg.1124 Staphylococcus aureus subsp. aureus 21178 LSU ribosomal protein L7/L12 (P1/P2)
fig|904725.3.peg.551 Staphylococcus aureus subsp. aureus 21189 LSU ribosomal protein L7/L12 (P1/P2)
fig|904726.3.peg.1084 Staphylococcus aureus subsp. aureus 21193 LSU ribosomal protein L7/L12 (P1/P2)
fig|904727.3.peg.1401 Staphylococcus aureus subsp. aureus 21194 LSU ribosomal protein L7/L12 (P1/P2)
fig|904729.3.peg.380 Staphylococcus aureus subsp. aureus 21196 LSU ribosomal protein L7/L12 (P1/P2)
fig|904730.3.peg.712 Staphylococcus aureus subsp. aureus 21200 LSU ribosomal protein L7/L12 (P1/P2)
fig|904731.3.peg.1407 Staphylococcus aureus subsp. aureus 21201 LSU ribosomal protein L7/L12 (P1/P2)
fig|904732.3.peg.877 Staphylococcus aureus subsp. aureus 21202 LSU ribosomal protein L7/L12 (P1/P2)
fig|904735.3.peg.1728 Staphylococcus aureus subsp. aureus 21209 LSU ribosomal protein L7/L12 (P1/P2)
fig|904737.3.peg.783 Staphylococcus aureus subsp. aureus 21232 LSU ribosomal protein L7/L12 (P1/P2)
fig|904738.3.peg.1135 Staphylococcus aureus subsp. aureus 21235 LSU ribosomal protein L7/L12 (P1/P2)
fig|904739.3.peg.1928 Staphylococcus aureus subsp. aureus 21236 LSU ribosomal protein L7/L12 (P1/P2)
fig|904743.3.peg.1053 Staphylococcus aureus subsp. aureus 21252 LSU ribosomal protein L7/L12 (P1/P2)
fig|904744.3.peg.2104 Staphylococcus aureus subsp. aureus 21259 LSU ribosomal protein L7/L12 (P1/P2)
fig|904745.3.peg.290 Staphylococcus aureus subsp. aureus 21262 LSU ribosomal protein L7/L12 (P1/P2)
fig|904747.3.peg.1969 Staphylococcus aureus subsp. aureus 21266 LSU ribosomal protein L7/L12 (P1/P2)
fig|904749.3.peg.37 Staphylococcus aureus subsp. aureus 21269 LSU ribosomal protein L7/L12 (P1/P2)
fig|904750.3.peg.118 Staphylococcus aureus subsp. aureus 21272 LSU ribosomal protein L7/L12 (P1/P2)
fig|904759.3.peg.1654 Staphylococcus aureus subsp. aureus 21305 LSU ribosomal protein L7/L12 (P1/P2)
fig|904760.3.peg.608 Staphylococcus aureus subsp. aureus 21310 LSU ribosomal protein L7/L12 (P1/P2)
fig|904763.3.peg.808 Staphylococcus aureus subsp. aureus 21318 LSU ribosomal protein L7/L12 (P1/P2)
fig|904766.3.peg.1182 Staphylococcus aureus subsp. aureus 21331 LSU ribosomal protein L7/L12 (P1/P2)
fig|904767.3.peg.1287 Staphylococcus aureus subsp. aureus 21333 LSU ribosomal protein L7/L12 (P1/P2)
fig|904768.3.peg.840 Staphylococcus aureus subsp. aureus 21334 LSU ribosomal protein L7/L12 (P1/P2)
fig|904771.3.peg.765 Staphylococcus aureus subsp. aureus 21340 LSU ribosomal protein L7/L12 (P1/P2)
fig|904773.3.peg.1341 Staphylococcus aureus subsp. aureus 21343 LSU ribosomal protein L7/L12 (P1/P2)
fig|904775.3.peg.1791 Staphylococcus aureus subsp. aureus IS-3 LSU ribosomal protein L7/L12 (P1/P2)
fig|904776.3.peg.1479 Staphylococcus aureus subsp. aureus IS-24 LSU ribosomal protein L7/L12 (P1/P2)
fig|904777.3.peg.427 Staphylococcus aureus subsp. aureus IS-55 LSU ribosomal protein L7/L12 (P1/P2)
fig|904778.3.peg.24 Staphylococcus aureus subsp. aureus IS-88 LSU ribosomal protein L7/L12 (P1/P2)
fig|904779.3.peg.2176 Staphylococcus aureus subsp. aureus IS-91 LSU ribosomal protein L7/L12 (P1/P2)
fig|904780.3.peg.2772 Staphylococcus aureus subsp. aureus IS-99 LSU ribosomal protein L7/L12 (P1/P2)
fig|904781.3.peg.1859 Staphylococcus aureus subsp. aureus IS-105 LSU ribosomal protein L7/L12 (P1/P2)
fig|904782.3.peg.948 Staphylococcus aureus subsp. aureus IS-111 LSU ribosomal protein L7/L12 (P1/P2)
fig|904783.3.peg.1660 Staphylococcus aureus subsp. aureus IS-122 LSU ribosomal protein L7/L12 (P1/P2)
fig|904784.3.peg.831 Staphylococcus aureus subsp. aureus IS-125 LSU ribosomal protein L7/L12 (P1/P2)
fig|904785.3.peg.2432 Staphylococcus aureus subsp. aureus IS-157 LSU ribosomal protein L7/L12 (P1/P2)
fig|904786.3.peg.434 Staphylococcus aureus subsp. aureus IS-160 LSU ribosomal protein L7/L12 (P1/P2)
fig|904787.3.peg.1967 Staphylococcus aureus subsp. aureus IS-189 LSU ribosomal protein L7/L12 (P1/P2)
fig|904792.3.peg.2305 Staphylococcus aureus subsp. aureus IS-M LSU ribosomal protein L7/L12 (P1/P2)
fig|904795.7.peg.1856 Staphylococcus aureus subsp. aureus CO-23 LSU ribosomal protein L7/L12 (P1/P2)
fig|908247.3.peg.1996 Staphylococcus aureus 16K LSU ribosomal protein L7/L12 (P1/P2)
fig|93061.3.peg.507 Staphylococcus aureus subsp. aureus NCTC 8325 LSU ribosomal protein L7/L12 (P1/P2)
fig|93061.5.peg.468 Staphylococcus aureus subsp. aureus NCTC 8325 LSU ribosomal protein L7/L12 (P1/P2)
fig|93062.19.peg.570 Staphylococcus aureus subsp. aureus COL LSU ribosomal protein L7/L12 (P1/P2)
fig|93062.4.peg.1039 Staphylococcus aureus subsp. aureus COL LSU ribosomal protein L7/L12 (P1/P2)
fig|931432.3.peg.1044 Staphylococcus aureus subsp. aureus CIG1057 LSU ribosomal protein L7/L12 (P1/P2)
fig|931433.3.peg.1085 Staphylococcus aureus subsp. aureus CIG1114 LSU ribosomal protein L7/L12 (P1/P2)
fig|931434.3.peg.1007 Staphylococcus aureus subsp. aureus CIG1165 LSU ribosomal protein L7/L12 (P1/P2)
fig|931439.3.peg.965 Staphylococcus aureus subsp. aureus CIG1750 LSU ribosomal protein L7/L12 (P1/P2)
fig|931440.3.peg.1171 Staphylococcus aureus subsp. aureus CIG1769 LSU ribosomal protein L7/L12 (P1/P2)
fig|931441.3.peg.697 Staphylococcus aureus subsp. aureus CIG1835 LSU ribosomal protein L7/L12 (P1/P2)
fig|931442.3.peg.1205 Staphylococcus aureus subsp. aureus CIG547 LSU ribosomal protein L7/L12 (P1/P2)
fig|931443.3.peg.1047 Staphylococcus aureus subsp. aureus CIG1096 LSU ribosomal protein L7/L12 (P1/P2)
fig|931444.3.peg.1081 Staphylococcus aureus subsp. aureus CIG1150 LSU ribosomal protein L7/L12 (P1/P2)
fig|931446.3.peg.1065 Staphylococcus aureus subsp. aureus CIG1213 LSU ribosomal protein L7/L12 (P1/P2)
fig|931448.3.peg.1114 Staphylococcus aureus subsp. aureus CIG1612 LSU ribosomal protein L7/L12 (P1/P2)
fig|931449.3.peg.1088 Staphylococcus aureus subsp. aureus CIG1770 LSU ribosomal protein L7/L12 (P1/P2)
fig|931450.3.peg.865 Staphylococcus aureus subsp. aureus CIG2018 LSU ribosomal protein L7/L12 (P1/P2)
fig|931451.3.peg.1116 Staphylococcus aureus subsp. aureus CIG290 LSU ribosomal protein L7/L12 (P1/P2)
fig|931454.3.peg.1036 Staphylococcus aureus subsp. aureus CIG1524 LSU ribosomal protein L7/L12 (P1/P2)
fig|931455.3.peg.1016 Staphylococcus aureus subsp. aureus CIGC340D LSU ribosomal protein L7/L12 (P1/P2)
fig|931457.3.peg.570 Staphylococcus aureus subsp. aureus CIGC345D LSU ribosomal protein L7/L12 (P1/P2)
fig|931458.3.peg.1115 Staphylococcus aureus subsp. aureus CIGC348 LSU ribosomal protein L7/L12 (P1/P2)
fig|931459.3.peg.984 Staphylococcus aureus subsp. aureus CIGC128 LSU ribosomal protein L7/L12 (P1/P2)
fig|931460.3.peg.669 Staphylococcus aureus subsp. aureus CIGC93 LSU ribosomal protein L7/L12 (P1/P2)
fig|948561.3.peg.1312 Staphylococcus aureus O11 LSU ribosomal protein L7/L12 (P1/P2)
fig|948563.3.peg.954 Staphylococcus aureus O46 LSU ribosomal protein L7/L12 (P1/P2)
fig|985002.3.peg.491 Staphylococcus aureus subsp. aureus MSHR1132 LSU ribosomal protein L7/L12 (P1/P2)
fig|985006.4.peg.480 Staphylococcus aureus subsp. aureus LGA251 LSU ribosomal protein L7/L12 (P1/P2)