page	:SeedViewerServeFeature:
fid	:fig|451515.3.peg.2425:
show_prot_sequence	:1:

>fig|451515.3.peg.2425
MEVHKKSNAWALFPLLLFVALFLGVGIITGDFTSMPLNVAITITVIVALLMNRKESFAKK
VEVFTKGAGHSNIVLMMLIFILAGAFSNTAEKMGGVKSTVNLGLSLIPENLIIVGLFVIC
MFVSISMGTSVGTVAAIAPVGYGFAQATDVPTALAMATVVGGAMFGDNLSMISDTTIAAV
RTQHTKMKDKFRVNFKIVLPGAILTIIILYFLTNGISLNHAKNYDYNLIKVVPYILVLVL
ALLGVNVIIVLIGGTLLAGIIGLIDGSFGWMGLLDAVSKGIISMEDIAMIALLIGGLVGI
IQHNGGIEWLLQFVRSKVKSKRGAELGIASLVSVADIATANNTISIIMSGPLAKNIADEY
DVDSRKSASILDIFGGCFQGLLPYSPQVISAAGVAGISPLMLFPYSIYPILLGVCGLIAI
LFNFPKLKKNTSQEMKH


PEGs with Identical Sequence
PEG Genome Function
fig|1006543.3.peg.2309 Staphylococcus aureus subsp. aureus T0131 Methionine transporter MetT
fig|1028799.3.peg.2084 Staphylococcus aureus subsp. aureus VC40 Methionine transporter MetT
fig|1112349.3.peg.2443 Staphylococcus aureus subsp. aureus NN50 Methionine transporter MetT
fig|1137133.3.peg.1379 Staphylococcus aureus subsp. aureus MRGR3 Methionine transporter MetT
fig|1156994.3.peg.1802 Staphylococcus aureus HI049 Methionine transporter MetT
fig|1156995.3.peg.263 Staphylococcus aureus HI010 Methionine transporter MetT
fig|1156996.3.peg.1804 Staphylococcus aureus HI049B Methionine transporter MetT
fig|1156997.3.peg.2324 Staphylococcus aureus HI010B Methionine transporter MetT
fig|1156998.3.peg.1712 Staphylococcus aureus HIF003_B2N-C Methionine transporter MetT
fig|1156999.3.peg.2252 Staphylococcus aureus HI022 Methionine transporter MetT
fig|1157000.3.peg.2299 Staphylococcus aureus HI049C Methionine transporter MetT
fig|1157001.3.peg.162 Staphylococcus aureus HI168 Methionine transporter MetT
fig|1157002.3.peg.2015 Staphylococcus aureus HI111 Methionine transporter MetT
fig|1157003.3.peg.162 Staphylococcus aureus HI013 Methionine transporter MetT
fig|1157016.3.peg.419 Staphylococcus aureus M0221 Methionine transporter MetT
fig|1157018.3.peg.1687 Staphylococcus aureus M0239 Methionine transporter MetT
fig|1157024.3.peg.288 Staphylococcus aureus M0340 Methionine transporter MetT
fig|1157032.3.peg.1879 Staphylococcus aureus M0468 Methionine transporter MetT
fig|1158465.3.peg.165 Staphylococcus aureus M1064 Methionine transporter MetT
fig|1158495.3.peg.2269 Staphylococcus aureus M1462 Methionine transporter MetT
fig|1158508.3.peg.2228 Staphylococcus aureus M0055 Methionine transporter MetT
fig|1158530.3.peg.160 Staphylococcus aureus M0424 Methionine transporter MetT
fig|1158539.3.peg.2334 Staphylococcus aureus M0633 Methionine transporter MetT
fig|1158683.3.peg.1786 Staphylococcus aureus M0531 Methionine transporter MetT
fig|1158707.3.peg.164 Staphylococcus aureus M1007 Methionine transporter MetT
fig|1169268.3.peg.162 Staphylococcus aureus M1223 Methionine transporter MetT
fig|1213728.3.peg.1899 Staphylococcus aureus M0831 Methionine transporter MetT
fig|1224928.3.peg.1913 Staphylococcus aureus M0312 Methionine transporter MetT
fig|1235275.3.peg.2505 Staphylococcus aureus PPUKM-261-2009 Methionine transporter MetT
fig|1235276.3.peg.2551 Staphylococcus aureus PPUKM-332-2009 Methionine transporter MetT
fig|1235278.3.peg.2502 Staphylococcus aureus PPUKM-775-2009 Methionine transporter MetT
fig|1241616.3.peg.1691 Staphylococcus aureus subsp. aureus DSM 20231 Methionine transporter MetT
fig|1242970.3.peg.192 Staphylococcus aureus CN79 Methionine transporter MetT
fig|426430.8.peg.2421 Staphylococcus aureus subsp. aureus str. Newman Methionine transporter MetT
fig|451515.3.peg.2425 Staphylococcus aureus subsp. aureus USA300_FPR3757 Methionine transporter MetT
fig|451516.9.peg.2414 Staphylococcus aureus subsp. aureus USA300_TCH1516 Methionine transporter MetT
fig|452948.4.peg.1235 Staphylococcus aureus 930918-3 Methionine transporter MetT
fig|455227.3.peg.1869 Staphylococcus aureus D30 Methionine transporter MetT
fig|543539.3.peg.533 Staphylococcus aureus subsp. aureus CGS01 Methionine transporter MetT
fig|546342.3.peg.1059 Staphylococcus aureus subsp. aureus str. JKD6008 Methionine transporter MetT
fig|546342.4.peg.2483 Staphylococcus aureus subsp. aureus str. JKD6008 Methionine transporter MetT
fig|546343.3.peg.1286 Staphylococcus aureus subsp. aureus str. JKD6009 Methionine transporter MetT
fig|553590.4.peg.928 Staphylococcus aureus A9754 Methionine transporter MetT
fig|553594.3.peg.2080 Staphylococcus aureus A9765 Methionine transporter MetT
fig|561307.5.peg.1680 Staphylococcus aureus subsp. aureus RN4220 Methionine transporter MetT
fig|644279.4.peg.2465 Staphylococcus aureus subsp. aureus 132 Methionine transporter MetT
fig|663951.4.peg.2607 Staphylococcus aureus subsp. aureus TW20 Methionine transporter MetT
fig|754025.3.peg.1410 Staphylococcus aureus subsp. aureus MRSA131 Methionine transporter MetT
fig|754026.3.peg.992 Staphylococcus aureus subsp. aureus MRSA177 Methionine transporter MetT
fig|862516.3.peg.323 Staphylococcus aureus subsp. aureus ATCC BAA-39 Methionine transporter MetT
fig|904724.3.peg.1304 Staphylococcus aureus subsp. aureus 21178 Methionine transporter MetT
fig|904725.3.peg.1552 Staphylococcus aureus subsp. aureus 21189 Methionine transporter MetT
fig|904735.3.peg.2704 Staphylococcus aureus subsp. aureus 21209 Methionine transporter MetT
fig|904737.3.peg.1837 Staphylococcus aureus subsp. aureus 21232 Methionine transporter MetT
fig|904753.3.peg.1720 Staphylococcus aureus subsp. aureus 21282 Methionine transporter MetT
fig|904754.3.peg.1859 Staphylococcus aureus subsp. aureus 21283 Methionine transporter MetT
fig|904771.3.peg.2415 Staphylococcus aureus subsp. aureus 21340 Methionine transporter MetT
fig|904776.3.peg.2572 Staphylococcus aureus subsp. aureus IS-24 Methionine transporter MetT
fig|904778.3.peg.2392 Staphylococcus aureus subsp. aureus IS-88 Methionine transporter MetT
fig|904779.3.peg.1773 Staphylococcus aureus subsp. aureus IS-91 Methionine transporter MetT
fig|904782.3.peg.1957 Staphylococcus aureus subsp. aureus IS-111 Methionine transporter MetT
fig|904784.3.peg.1116 Staphylococcus aureus subsp. aureus IS-125 Methionine transporter MetT
fig|904785.3.peg.123 Staphylococcus aureus subsp. aureus IS-157 Methionine transporter MetT
fig|904787.3.peg.316 Staphylococcus aureus subsp. aureus IS-189 Methionine transporter MetT
fig|904795.7.peg.938 Staphylococcus aureus subsp. aureus CO-23 Methionine transporter MetT
fig|908247.3.peg.2364 Staphylococcus aureus 16K Methionine transporter MetT
fig|93061.5.peg.2349 Staphylococcus aureus subsp. aureus NCTC 8325 Methionine transporter MetT
fig|93062.19.peg.2263 Staphylococcus aureus subsp. aureus COL Methionine transporter MetT
fig|93062.4.peg.2381 Staphylococcus aureus subsp. aureus COL Methionine transporter MetT
fig|931433.3.peg.186 Staphylococcus aureus subsp. aureus CIG1114 Methionine transporter MetT
fig|931442.3.peg.159 Staphylococcus aureus subsp. aureus CIG547 Methionine transporter MetT
fig|931448.3.peg.161 Staphylococcus aureus subsp. aureus CIG1612 Methionine transporter MetT
fig|931449.3.peg.183 Staphylococcus aureus subsp. aureus CIG1770 Methionine transporter MetT
fig|931450.3.peg.160 Staphylococcus aureus subsp. aureus CIG2018 Methionine transporter MetT
fig|931457.3.peg.166 Staphylococcus aureus subsp. aureus CIGC345D Methionine transporter MetT