page	:SeedViewerServeFeature:
fid	:fig|451515.3.peg.2066:
show_prot_sequence	:1:

>fig|451515.3.peg.2066
MVVKQASAPKAYFNITGLGFAKLTKEGAKLEYSDITKTRGLQKIGVETGGDLKTAYADGG
PIESGNTDGEGKISLQMHAFPKEIRKIVFNEEYDEYGVYKETQGKQNNYVAIWFRQERRD
GTFRTVLLPKVMFTNPKIDGETAEKDWDFSSEEVEGEALFPLIDNKKSVRKYIFDSANMT
NHSGNGEKGEEAFLKKILGEEYTGNVTEDNGETL


PEGs with Identical Sequence
PEG Genome Function
fig|1156994.3.peg.1452 Staphylococcus aureus HI049 Bacteriophage
fig|1156995.3.peg.2616 Staphylococcus aureus HI010 Bacteriophage
fig|1156996.3.peg.1454 Staphylococcus aureus HI049B Bacteriophage
fig|1156997.3.peg.1974 Staphylococcus aureus HI010B Bacteriophage
fig|1156999.3.peg.1903 Staphylococcus aureus HI022 Bacteriophage
fig|1157000.3.peg.1944 Staphylococcus aureus HI049C Bacteriophage
fig|1157001.3.peg.2556 Staphylococcus aureus HI168 Bacteriophage
fig|1157002.3.peg.1665 Staphylococcus aureus HI111 Bacteriophage
fig|1157003.3.peg.2578 Staphylococcus aureus HI013 Bacteriophage
fig|1158683.3.peg.1435 Staphylococcus aureus M0531 Bacteriophage
fig|367830.3.peg.2337 Staphylococcus aureus subsp. aureus USA300 Bacteriophage
fig|451515.3.peg.2066 Staphylococcus aureus subsp. aureus USA300_FPR3757 Bacteriophage
fig|451516.9.peg.2056 Staphylococcus aureus subsp. aureus USA300_TCH1516 Bacteriophage
fig|543539.3.peg.2030 Staphylococcus aureus subsp. aureus CGS01 Bacteriophage
fig|553590.4.peg.1576 Staphylococcus aureus A9754 Bacteriophage
fig|754026.3.peg.2066 Staphylococcus aureus subsp. aureus MRSA177 Bacteriophage
fig|904776.3.peg.845 Staphylococcus aureus subsp. aureus IS-24 Bacteriophage
fig|904778.3.peg.75 Staphylococcus aureus subsp. aureus IS-88 Bacteriophage
fig|904782.3.peg.2541 Staphylococcus aureus subsp. aureus IS-111 Bacteriophage
fig|904795.7.peg.1946 Staphylococcus aureus subsp. aureus CO-23 Bacteriophage