page	:SeedViewerServeFeature:
fid	:fig|451515.3.peg.1727:
show_prot_sequence	:1:

>fig|451515.3.peg.1727
MADESKFDQFKGNVKETVGNVTDNKELEKEGQQDKVIGKAKEVVENAKNKITDAIDKLKK


PEGs with Identical Sequence
PEG Genome Function
fig|1006543.3.peg.1593 Staphylococcus aureus subsp. aureus T0131 sigmaB-controlled gene product
fig|1137133.3.peg.2364 Staphylococcus aureus subsp. aureus MRGR3 sigmaB-controlled gene product
fig|1156994.3.peg.1126 Staphylococcus aureus HI049 sigmaB-controlled gene product
fig|1156995.3.peg.2290 Staphylococcus aureus HI010 sigmaB-controlled gene product
fig|1156996.3.peg.1128 Staphylococcus aureus HI049B sigmaB-controlled gene product
fig|1156997.3.peg.1646 Staphylococcus aureus HI010B sigmaB-controlled gene product
fig|1156998.3.peg.1044 Staphylococcus aureus HIF003_B2N-C sigmaB-controlled gene product
fig|1156999.3.peg.1578 Staphylococcus aureus HI022 sigmaB-controlled gene product
fig|1157000.3.peg.1617 Staphylococcus aureus HI049C sigmaB-controlled gene product
fig|1157001.3.peg.2164 Staphylococcus aureus HI168 sigmaB-controlled gene product
fig|1157002.3.peg.1337 Staphylococcus aureus HI111 sigmaB-controlled gene product
fig|1157003.3.peg.2191 Staphylococcus aureus HI013 sigmaB-controlled gene product
fig|1157016.3.peg.2500 Staphylococcus aureus M0221 sigmaB-controlled gene product
fig|1157024.3.peg.2365 Staphylococcus aureus M0340 sigmaB-controlled gene product
fig|1157032.3.peg.1196 Staphylococcus aureus M0468 sigmaB-controlled gene product
fig|1158465.3.peg.2249 Staphylococcus aureus M1064 sigmaB-controlled gene product
fig|1158495.3.peg.1656 Staphylococcus aureus M1462 sigmaB-controlled gene product
fig|1158508.3.peg.1551 Staphylococcus aureus M0055 sigmaB-controlled gene product
fig|1158530.3.peg.2277 Staphylococcus aureus M0424 sigmaB-controlled gene product
fig|1158539.3.peg.1650 Staphylococcus aureus M0633 sigmaB-controlled gene product
fig|1158683.3.peg.1108 Staphylococcus aureus M0531 sigmaB-controlled gene product
fig|1158707.3.peg.2274 Staphylococcus aureus M1007 sigmaB-controlled gene product
fig|1169268.3.peg.2248 Staphylococcus aureus M1223 sigmaB-controlled gene product
fig|1213728.3.peg.1209 Staphylococcus aureus M0831 sigmaB-controlled gene product
fig|1224928.3.peg.1220 Staphylococcus aureus M0312 sigmaB-controlled gene product
fig|1235275.3.peg.1678 Staphylococcus aureus PPUKM-261-2009 sigmaB-controlled gene product
fig|1235276.3.peg.1742 Staphylococcus aureus PPUKM-332-2009 sigmaB-controlled gene product
fig|1235278.3.peg.1612 Staphylococcus aureus PPUKM-775-2009 sigmaB-controlled gene product
fig|1242970.3.peg.1568 Staphylococcus aureus CN79 sigmaB-controlled gene product
fig|1305598.3.peg.1610 Staphylococcus aureus M1 sigmaB-controlled gene product
fig|367830.3.peg.396 Staphylococcus aureus subsp. aureus USA300 sigmaB-controlled gene product
fig|426430.6.peg.1481 Staphylococcus aureus subsp. aureus str. Newman sigmaB-controlled gene product
fig|426430.8.peg.1656 Staphylococcus aureus subsp. aureus str. Newman sigmaB-controlled gene product
fig|451515.3.peg.1727 Staphylococcus aureus subsp. aureus USA300_FPR3757 sigmaB-controlled gene product
fig|451516.9.peg.1716 Staphylococcus aureus subsp. aureus USA300_TCH1516 sigmaB-controlled gene product
fig|452948.4.peg.151 Staphylococcus aureus 930918-3 sigmaB-controlled gene product
fig|455227.3.peg.575 Staphylococcus aureus D30 sigmaB-controlled gene product
fig|543539.3.peg.63 Staphylococcus aureus subsp. aureus CGS01 sigmaB-controlled gene product
fig|546342.3.peg.2070 Staphylococcus aureus subsp. aureus str. JKD6008 sigmaB-controlled gene product
fig|546342.4.peg.1681 Staphylococcus aureus subsp. aureus str. JKD6008 sigmaB-controlled gene product
fig|546343.3.peg.1129 Staphylococcus aureus subsp. aureus str. JKD6009 sigmaB-controlled gene product
fig|553567.3.peg.36 Staphylococcus aureus A5948 sigmaB-controlled gene product
fig|553590.4.peg.714 Staphylococcus aureus A9754 sigmaB-controlled gene product
fig|553594.3.peg.250 Staphylococcus aureus A9765 sigmaB-controlled gene product
fig|644279.4.peg.1777 Staphylococcus aureus subsp. aureus 132 sigmaB-controlled gene product
fig|663951.4.peg.1734 Staphylococcus aureus subsp. aureus TW20 sigmaB-controlled gene product
fig|754025.3.peg.1061 Staphylococcus aureus subsp. aureus MRSA131 sigmaB-controlled gene product
fig|754026.3.peg.433 Staphylococcus aureus subsp. aureus MRSA177 sigmaB-controlled gene product
fig|862516.3.peg.1658 Staphylococcus aureus subsp. aureus ATCC BAA-39 sigmaB-controlled gene product
fig|904724.3.peg.585 Staphylococcus aureus subsp. aureus 21178 sigmaB-controlled gene product
fig|904735.3.peg.1223 Staphylococcus aureus subsp. aureus 21209 sigmaB-controlled gene product
fig|904737.3.peg.1155 Staphylococcus aureus subsp. aureus 21232 sigmaB-controlled gene product
fig|904753.3.peg.1422 Staphylococcus aureus subsp. aureus 21282 sigmaB-controlled gene product
fig|904754.3.peg.2403 Staphylococcus aureus subsp. aureus 21283 sigmaB-controlled gene product
fig|904776.3.peg.1354 Staphylococcus aureus subsp. aureus IS-24 sigmaB-controlled gene product
fig|904778.3.peg.2129 Staphylococcus aureus subsp. aureus IS-88 sigmaB-controlled gene product
fig|904779.3.peg.1561 Staphylococcus aureus subsp. aureus IS-91 sigmaB-controlled gene product
fig|904782.3.peg.1478 Staphylococcus aureus subsp. aureus IS-111 sigmaB-controlled gene product
fig|904784.3.peg.2055 Staphylococcus aureus subsp. aureus IS-125 sigmaB-controlled gene product
fig|904785.3.peg.204 Staphylococcus aureus subsp. aureus IS-157 sigmaB-controlled gene product
fig|904787.3.peg.906 Staphylococcus aureus subsp. aureus IS-189 sigmaB-controlled gene product
fig|904795.7.peg.319 Staphylococcus aureus subsp. aureus CO-23 sigmaB-controlled gene product
fig|908247.3.peg.908 Staphylococcus aureus 16K sigmaB-controlled gene product
fig|93062.19.peg.1637 Staphylococcus aureus subsp. aureus COL sigmaB-controlled gene product
fig|93062.4.peg.1862 Staphylococcus aureus subsp. aureus COL sigmaB-controlled gene product
fig|931433.3.peg.2205 Staphylococcus aureus subsp. aureus CIG1114 sigmaB-controlled gene product
fig|931442.3.peg.2231 Staphylococcus aureus subsp. aureus CIG547 sigmaB-controlled gene product
fig|931448.3.peg.2237 Staphylococcus aureus subsp. aureus CIG1612 sigmaB-controlled gene product
fig|931449.3.peg.2213 Staphylococcus aureus subsp. aureus CIG1770 sigmaB-controlled gene product
fig|931450.3.peg.1979 Staphylococcus aureus subsp. aureus CIG2018 sigmaB-controlled gene product