page	:SeedViewerServeFeature:
fid	:fig|426430.8.peg.2708:
show_prot_sequence	:1:

>fig|426430.8.peg.2708
MLSVAIIGPGAVGTTIAYELQQSLPHTTLIGRHAKTITYYTVPHAPAQDIVVKGYEDVTN
TFDVIIIAVKTHQLDAVIPHLTHLAHEDTLIILAQNGYGQLEHISFKNVCQAVVYISGQK
KGDVVTHFRDYQLRIQDNALTRQFRDLVQDSQIDIVLEANIQQAIWYKLLVNLGINSITA
LGRQTVAIMHNPEIRTLCRQLLLDGCRVAQAEGLNFSEQTVDTIMTIYQGYPDEMGTSMY
YDIAHQQPLEVEAIQGFIYRRAREHNLDTPYLDTIYSFLRAYQQNM


PEGs with Identical Sequence
PEG Genome Function
fig|1112349.3.peg.2115 Staphylococcus aureus subsp. aureus NN50 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1156994.3.peg.2078 Staphylococcus aureus HI049 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1156995.3.peg.538 Staphylococcus aureus HI010 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1156996.3.peg.2080 Staphylococcus aureus HI049B 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1156997.3.peg.2600 Staphylococcus aureus HI010B 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1156998.3.peg.1988 Staphylococcus aureus HIF003_B2N-C 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1156999.3.peg.2528 Staphylococcus aureus HI022 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1157000.3.peg.2574 Staphylococcus aureus HI049C 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1157001.3.peg.436 Staphylococcus aureus HI168 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1157002.3.peg.2292 Staphylococcus aureus HI111 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1157003.3.peg.440 Staphylococcus aureus HI013 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1157016.3.peg.696 Staphylococcus aureus M0221 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1157024.3.peg.564 Staphylococcus aureus M0340 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1157032.3.peg.2154 Staphylococcus aureus M0468 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1158465.3.peg.442 Staphylococcus aureus M1064 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1158495.3.peg.2545 Staphylococcus aureus M1462 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1158508.3.peg.2502 Staphylococcus aureus M0055 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1158530.3.peg.435 Staphylococcus aureus M0424 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1158539.3.peg.2610 Staphylococcus aureus M0633 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1158683.3.peg.2064 Staphylococcus aureus M0531 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1158707.3.peg.439 Staphylococcus aureus M1007 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1169268.3.peg.433 Staphylococcus aureus M1223 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1213728.3.peg.2172 Staphylococcus aureus M0831 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1224928.3.peg.2188 Staphylococcus aureus M0312 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1241616.3.peg.1964 Staphylococcus aureus subsp. aureus DSM 20231 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|1305598.3.peg.2575 Staphylococcus aureus M1 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|367830.3.peg.1797 Staphylococcus aureus subsp. aureus USA300 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|426430.6.peg.2411 Staphylococcus aureus subsp. aureus str. Newman 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|426430.8.peg.2708 Staphylococcus aureus subsp. aureus str. Newman 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|451515.3.peg.2712 Staphylococcus aureus subsp. aureus USA300_FPR3757 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|451516.9.peg.2705 Staphylococcus aureus subsp. aureus USA300_TCH1516 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|452948.4.peg.468 Staphylococcus aureus 930918-3 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|455227.3.peg.1212 Staphylococcus aureus D30 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|543539.3.peg.1631 Staphylococcus aureus subsp. aureus CGS01 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|553567.3.peg.1026 Staphylococcus aureus A5948 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|553594.3.peg.1387 Staphylococcus aureus A9765 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|644279.4.peg.2750 Staphylococcus aureus subsp. aureus 132 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|754025.3.peg.2637 Staphylococcus aureus subsp. aureus MRSA131 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|754026.3.peg.31 Staphylococcus aureus subsp. aureus MRSA177 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|904735.3.peg.1867 Staphylococcus aureus subsp. aureus 21209 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|904737.3.peg.1635 Staphylococcus aureus subsp. aureus 21232 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|904753.3.peg.294 Staphylococcus aureus subsp. aureus 21282 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|904754.3.peg.2296 Staphylococcus aureus subsp. aureus 21283 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|904776.3.peg.1710 Staphylococcus aureus subsp. aureus IS-24 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|904778.3.peg.1747 Staphylococcus aureus subsp. aureus IS-88 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|904779.3.peg.2553 Staphylococcus aureus subsp. aureus IS-91 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|904782.3.peg.2455 Staphylococcus aureus subsp. aureus IS-111 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|904795.7.peg.568 Staphylococcus aureus subsp. aureus CO-23 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|93062.19.peg.2544 Staphylococcus aureus subsp. aureus COL 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|93062.4.peg.1926 Staphylococcus aureus subsp. aureus COL 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|931433.3.peg.460 Staphylococcus aureus subsp. aureus CIG1114 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|931442.3.peg.433 Staphylococcus aureus subsp. aureus CIG547 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|931448.3.peg.434 Staphylococcus aureus subsp. aureus CIG1612 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|931449.3.peg.456 Staphylococcus aureus subsp. aureus CIG1770 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|931450.3.peg.433 Staphylococcus aureus subsp. aureus CIG2018 2-dehydropantoate 2-reductase (EC 1.1.1.169)
fig|931457.3.peg.1152 Staphylococcus aureus subsp. aureus CIGC345D 2-dehydropantoate 2-reductase (EC 1.1.1.169)