page	:SeedViewerServeFeature:
fid	:fig|426430.8.peg.2602:
show_prot_sequence	:1:

>fig|426430.8.peg.2602
MDYQTFEKVNKFINVKAYIFFLTQELKQQYKLSLKELLILAYFYYKNEHSISLKEIIGDI
LYKQSDVVKNIKSLSKKGFINKSRNEADERRIFVSVTPIQRKKIACVINELDKIIKGFNK
ERDYIKYQWAPKYSKEFFILFMNIMYSKDFLKYRFNLTFLDLSILYVISSRKNEILNLKD
LFESIRFMYPQIVRSVNRLNNKGMLIKERSLADERIVLIKINKIQYNTIKSIFTDTSKIL
KPRKFFF


PEGs with Identical Sequence
PEG Genome Function
fig|426430.6.peg.2317 Staphylococcus aureus subsp. aureus str. Newman Transcriptional regulator SarU (Staphylococcal accessory regulator U)
fig|426430.8.peg.2602 Staphylococcus aureus subsp. aureus str. Newman Transcriptional regulator SarU (Staphylococcal accessory regulator U)
fig|904753.3.peg.398 Staphylococcus aureus subsp. aureus 21282 Transcriptional regulator SarU (Staphylococcal accessory regulator U)
fig|904754.3.peg.1128 Staphylococcus aureus subsp. aureus 21283 Transcriptional regulator SarU (Staphylococcal accessory regulator U)
fig|93062.19.peg.2442 Staphylococcus aureus subsp. aureus COL Transcriptional regulator SarU (Staphylococcal accessory regulator U)
fig|93062.4.peg.2557 Staphylococcus aureus subsp. aureus COL Transcriptional regulator SarU (Staphylococcal accessory regulator U)