page	:SeedViewerServeFeature:
fid	:fig|426430.8.peg.2508:
show_prot_sequence	:1:

>fig|426430.8.peg.2508
MVKKINELLKSIDRNGALEGIGKPEKLKSNLTGYYSRRINHEHRLVYTVDDNHIKIASCK
YHY


PEGs with Identical Sequence
PEG Genome Function
fig|1006543.3.peg.2393 Staphylococcus aureus subsp. aureus T0131 FIG01108752: hypothetical protein
fig|1028799.3.peg.2169 Staphylococcus aureus subsp. aureus VC40 FIG01108752: hypothetical protein
fig|1075076.3.peg.2246 Staphylococcus aureus ST228/10388 FIG01108752: hypothetical protein
fig|1075077.3.peg.2250 Staphylococcus aureus ST228/10497 FIG01108752: hypothetical protein
fig|1075078.3.peg.2243 Staphylococcus aureus ST228/15532 FIG01108752: hypothetical protein
fig|1075079.3.peg.2239 Staphylococcus aureus ST228/16035 FIG01108752: hypothetical protein
fig|1075082.3.peg.2246 Staphylococcus aureus ST228/18412 FIG01108752: hypothetical protein
fig|1112349.3.peg.2528 Staphylococcus aureus subsp. aureus NN50 FIG01108752: hypothetical protein
fig|1116214.3.peg.2270 Staphylococcus aureus subsp. aureus VRS1 FIG01108752: hypothetical protein
fig|1116216.3.peg.2189 Staphylococcus aureus subsp. aureus VRS3a FIG01108752: hypothetical protein
fig|1116217.3.peg.2285 Staphylococcus aureus subsp. aureus VRS4 FIG01108752: hypothetical protein
fig|1116218.3.peg.2253 Staphylococcus aureus subsp. aureus VRS5 FIG01108752: hypothetical protein
fig|1116219.3.peg.2265 Staphylococcus aureus subsp. aureus VRS6 FIG01108752: hypothetical protein
fig|1116220.3.peg.2315 Staphylococcus aureus subsp. aureus VRS7 FIG01108752: hypothetical protein
fig|1116221.3.peg.2165 Staphylococcus aureus subsp. aureus VRS8 FIG01108752: hypothetical protein
fig|1116222.3.peg.2339 Staphylococcus aureus subsp. aureus VRS9 FIG01108752: hypothetical protein
fig|1116224.3.peg.2327 Staphylococcus aureus subsp. aureus VRS11a FIG01108752: hypothetical protein
fig|1116225.3.peg.2299 Staphylococcus aureus subsp. aureus VRS11b FIG01108752: hypothetical protein
fig|1123523.3.peg.2351 Staphylococcus aureus subsp. aureus 11819-97 FIG01108752: hypothetical protein
fig|1134842.3.peg.1349 Staphylococcus aureus subsp. aureus CM05 FIG01108752: hypothetical protein
fig|1137129.3.peg.2544 Staphylococcus aureus subsp. aureus 091751 FIG01108752: hypothetical protein
fig|1137130.3.peg.1313 Staphylococcus aureus subsp. aureus 103564 FIG01108752: hypothetical protein
fig|1137133.3.peg.2159 Staphylococcus aureus subsp. aureus MRGR3 FIG01108752: hypothetical protein
fig|1144271.3.peg.1714 Staphylococcus aureus subsp. aureus 118 FIG01108752: hypothetical protein
fig|1144272.3.peg.1272 Staphylococcus aureus subsp. aureus GR1 FIG01108752: hypothetical protein
fig|1156996.3.peg.1888 Staphylococcus aureus HI049B FIG01108752: hypothetical protein
fig|1156997.3.peg.2408 Staphylococcus aureus HI010B FIG01108752: hypothetical protein
fig|1156998.3.peg.1796 Staphylococcus aureus HIF003_B2N-C FIG01108752: hypothetical protein
fig|1157004.3.peg.345 Staphylococcus aureus M0001 FIG01108752: hypothetical protein
fig|1157005.3.peg.1897 Staphylococcus aureus M0029 FIG01108752: hypothetical protein
fig|1157006.3.peg.1909 Staphylococcus aureus M0035 FIG01108752: hypothetical protein
fig|1157007.3.peg.740 Staphylococcus aureus M0045 FIG01108752: hypothetical protein
fig|1157008.3.peg.265 Staphylococcus aureus M0060 FIG01108752: hypothetical protein
fig|1157009.3.peg.242 Staphylococcus aureus M0066 FIG01108752: hypothetical protein
fig|1157010.3.peg.2221 Staphylococcus aureus M0102 FIG01108752: hypothetical protein
fig|1157011.3.peg.243 Staphylococcus aureus M0103 FIG01108752: hypothetical protein
fig|1157012.3.peg.511 Staphylococcus aureus M0150 FIG01108752: hypothetical protein
fig|1157013.3.peg.570 Staphylococcus aureus M0173 FIG01108752: hypothetical protein
fig|1157014.3.peg.2271 Staphylococcus aureus M0192 FIG01108752: hypothetical protein
fig|1157015.3.peg.414 Staphylococcus aureus M0197 FIG01108752: hypothetical protein
fig|1157016.3.peg.502 Staphylococcus aureus M0221 FIG01108752: hypothetical protein
fig|1157017.3.peg.2395 Staphylococcus aureus M0237 FIG01108752: hypothetical protein
fig|1157018.3.peg.1768 Staphylococcus aureus M0239 FIG01108752: hypothetical protein
fig|1157019.3.peg.653 Staphylococcus aureus M0252 FIG01108752: hypothetical protein
fig|1157020.3.peg.1922 Staphylococcus aureus M0326 FIG01108752: hypothetical protein
fig|1157021.3.peg.1934 Staphylococcus aureus M0328 FIG01108752: hypothetical protein
fig|1157022.3.peg.2364 Staphylococcus aureus M0329 FIG01108752: hypothetical protein
fig|1157023.3.peg.352 Staphylococcus aureus M0330 FIG01108752: hypothetical protein
fig|1157024.3.peg.371 Staphylococcus aureus M0340 FIG01108752: hypothetical protein
fig|1157025.3.peg.2338 Staphylococcus aureus M0347 FIG01108752: hypothetical protein
fig|1157026.3.peg.2333 Staphylococcus aureus M0364 FIG01108752: hypothetical protein
fig|1157027.3.peg.244 Staphylococcus aureus M0391 FIG01108752: hypothetical protein
fig|1157029.3.peg.2269 Staphylococcus aureus M0427 FIG01108752: hypothetical protein
fig|1157030.3.peg.2320 Staphylococcus aureus M0450 FIG01108752: hypothetical protein
fig|1157031.3.peg.1519 Staphylococcus aureus M0467 FIG01108752: hypothetical protein
fig|1157032.3.peg.1962 Staphylococcus aureus M0468 FIG01108752: hypothetical protein
fig|1157033.3.peg.2254 Staphylococcus aureus M0478 FIG01108752: hypothetical protein
fig|1157034.3.peg.2478 Staphylococcus aureus M0489 FIG01108752: hypothetical protein
fig|1157035.3.peg.1828 Staphylococcus aureus M0494 FIG01108752: hypothetical protein
fig|1157036.3.peg.2331 Staphylococcus aureus B53639 FIG01108752: hypothetical protein
fig|1157037.3.peg.2336 Staphylococcus aureus B40723 FIG01108752: hypothetical protein
fig|1157038.3.peg.2301 Staphylococcus aureus B40950 FIG01108752: hypothetical protein
fig|1157039.3.peg.2360 Staphylococcus aureus B147830 FIG01108752: hypothetical protein
fig|1158461.3.peg.1870 Staphylococcus aureus M0628 FIG01108752: hypothetical protein
fig|1158462.3.peg.413 Staphylococcus aureus M0529 FIG01108752: hypothetical protein
fig|1158463.3.peg.442 Staphylococcus aureus M1063 FIG01108752: hypothetical protein
fig|1158464.3.peg.1941 Staphylococcus aureus M1076 FIG01108752: hypothetical protein
fig|1158465.3.peg.250 Staphylococcus aureus M1064 FIG01108752: hypothetical protein
fig|1158466.3.peg.341 Staphylococcus aureus M1092 FIG01108752: hypothetical protein
fig|1158467.3.peg.2004 Staphylococcus aureus M1093 FIG01108752: hypothetical protein
fig|1158468.3.peg.2375 Staphylococcus aureus M1095 FIG01108752: hypothetical protein
fig|1158469.3.peg.491 Staphylococcus aureus M1103 FIG01108752: hypothetical protein
fig|1158470.3.peg.197 Staphylococcus aureus M1119 FIG01108752: hypothetical protein
fig|1158471.3.peg.2322 Staphylococcus aureus M1167 FIG01108752: hypothetical protein
fig|1158472.3.peg.524 Staphylococcus aureus M1170 FIG01108752: hypothetical protein
fig|1158473.3.peg.1907 Staphylococcus aureus M1188 FIG01108752: hypothetical protein
fig|1158474.3.peg.1528 Staphylococcus aureus M1198 FIG01108752: hypothetical protein
fig|1158475.3.peg.791 Staphylococcus aureus M1199 FIG01108752: hypothetical protein
fig|1158476.3.peg.1533 Staphylococcus aureus M1215 FIG01108752: hypothetical protein
fig|1158477.3.peg.1764 Staphylococcus aureus M1216 FIG01108752: hypothetical protein
fig|1158478.3.peg.1501 Staphylococcus aureus M1229 FIG01108752: hypothetical protein
fig|1158479.3.peg.2317 Staphylococcus aureus M1248 FIG01108752: hypothetical protein
fig|1158480.3.peg.530 Staphylococcus aureus M1253 FIG01108752: hypothetical protein
fig|1158481.3.peg.2394 Staphylococcus aureus M1255 FIG01108752: hypothetical protein
fig|1158482.3.peg.2275 Staphylococcus aureus M1257 FIG01108752: hypothetical protein
fig|1158483.3.peg.1871 Staphylococcus aureus M1277 FIG01108752: hypothetical protein
fig|1158484.3.peg.2289 Staphylococcus aureus M1291 FIG01108752: hypothetical protein
fig|1158486.3.peg.1918 Staphylococcus aureus M1320 YoeB toxin protein
fig|1158487.3.peg.2417 Staphylococcus aureus M1321 FIG01108752: hypothetical protein
fig|1158488.3.peg.1497 Staphylococcus aureus M1322 FIG01108752: hypothetical protein
fig|1158489.3.peg.539 Staphylococcus aureus M1359 FIG01108752: hypothetical protein
fig|1158490.3.peg.1921 Staphylococcus aureus M1367 FIG01108752: hypothetical protein
fig|1158491.3.peg.196 Staphylococcus aureus M1373 FIG01108752: hypothetical protein
fig|1158492.3.peg.545 Staphylococcus aureus M1394 FIG01108752: hypothetical protein
fig|1158493.3.peg.1882 Staphylococcus aureus M1450 FIG01108752: hypothetical protein
fig|1158494.3.peg.2343 Staphylococcus aureus M1451 FIG01108752: hypothetical protein
fig|1158495.3.peg.2352 Staphylococcus aureus M1462 FIG01108752: hypothetical protein
fig|1158496.3.peg.2140 Staphylococcus aureus M1463 FIG01108752: hypothetical protein
fig|1158497.3.peg.1876 Staphylococcus aureus M1481 FIG01108752: hypothetical protein
fig|1158498.3.peg.241 Staphylococcus aureus M1520 FIG01108752: hypothetical protein
fig|1158499.3.peg.1976 Staphylococcus aureus M1521 FIG01108752: hypothetical protein
fig|1158500.3.peg.2152 Staphylococcus aureus M1531 FIG01108752: hypothetical protein
fig|1158501.3.peg.1879 Staphylococcus aureus M1533 FIG01108752: hypothetical protein
fig|1158502.3.peg.2374 Staphylococcus aureus M1544 FIG01108752: hypothetical protein
fig|1158503.3.peg.2324 Staphylococcus aureus M1556 FIG01108752: hypothetical protein
fig|1158504.3.peg.2477 Staphylococcus aureus M1563 FIG01108752: hypothetical protein
fig|1158505.3.peg.654 Staphylococcus aureus M1565 FIG01108752: hypothetical protein
fig|1158506.3.peg.2315 Staphylococcus aureus M1578 FIG01108752: hypothetical protein
fig|1158507.3.peg.474 Staphylococcus aureus M0006 FIG01108752: hypothetical protein
fig|1158509.3.peg.242 Staphylococcus aureus M0077 FIG01108752: hypothetical protein
fig|1158510.3.peg.2339 Staphylococcus aureus M0108 FIG01108752: hypothetical protein
fig|1158511.3.peg.474 Staphylococcus aureus M0144 FIG01108752: hypothetical protein
fig|1158512.3.peg.2345 Staphylococcus aureus M0154 FIG01108752: hypothetical protein
fig|1158513.3.peg.1909 Staphylococcus aureus M0177 FIG01108752: hypothetical protein
fig|1158514.3.peg.1971 Staphylococcus aureus M0200 FIG01108752: hypothetical protein
fig|1158515.3.peg.2349 Staphylococcus aureus M0212 FIG01108752: hypothetical protein
fig|1158516.3.peg.1888 Staphylococcus aureus M0216 FIG01108752: hypothetical protein
fig|1158517.3.peg.241 Staphylococcus aureus M0235 FIG01108752: hypothetical protein
fig|1158518.3.peg.642 Staphylococcus aureus M0250 FIG01108752: hypothetical protein
fig|1158520.3.peg.1642 Staphylococcus aureus M0280 FIG01108752: hypothetical protein
fig|1158521.3.peg.2360 Staphylococcus aureus M0306 FIG01108752: hypothetical protein
fig|1158522.3.peg.472 Staphylococcus aureus M0334 FIG01108752: hypothetical protein
fig|1158523.3.peg.264 Staphylococcus aureus M0350 FIG01108752: hypothetical protein
fig|1158524.3.peg.2356 Staphylococcus aureus M0351 FIG01108752: hypothetical protein
fig|1158525.3.peg.2287 Staphylococcus aureus M0363 FIG01108752: hypothetical protein
fig|1158526.3.peg.542 Staphylococcus aureus M0367 FIG01108752: hypothetical protein
fig|1158527.3.peg.1541 Staphylococcus aureus M0374 FIG01108752: hypothetical protein
fig|1158528.3.peg.242 Staphylococcus aureus M0375 FIG01108752: hypothetical protein
fig|1158530.3.peg.244 Staphylococcus aureus M0424 FIG01108752: hypothetical protein
fig|1158531.3.peg.2270 Staphylococcus aureus M0438 FIG01108752: hypothetical protein
fig|1158535.3.peg.2314 Staphylococcus aureus M0562 FIG01108752: hypothetical protein
fig|1158536.3.peg.727 Staphylococcus aureus M0571 FIG01108752: hypothetical protein
fig|1158537.3.peg.2342 Staphylococcus aureus M0584 FIG01108752: hypothetical protein
fig|1158538.3.peg.376 Staphylococcus aureus M0586 FIG01108752: hypothetical protein
fig|1158539.3.peg.2418 Staphylococcus aureus M0633 FIG01108752: hypothetical protein
fig|1158682.3.peg.2412 Staphylococcus aureus M0528 FIG01108752: hypothetical protein
fig|1158684.3.peg.2327 Staphylococcus aureus M0536 FIG01108752: hypothetical protein
fig|1158685.3.peg.482 Staphylococcus aureus M0539 FIG01108752: hypothetical protein
fig|1158686.3.peg.468 Staphylococcus aureus M0547 FIG01108752: hypothetical protein
fig|1158687.3.peg.2322 Staphylococcus aureus M0565 FIG01108752: hypothetical protein
fig|1158688.3.peg.1525 Staphylococcus aureus M0580 FIG01108752: hypothetical protein
fig|1158689.3.peg.1962 Staphylococcus aureus M0602 FIG01108752: hypothetical protein
fig|1158690.3.peg.2336 Staphylococcus aureus M0622 FIG01108752: hypothetical protein
fig|1158691.3.peg.2300 Staphylococcus aureus M0676 FIG01108752: hypothetical protein
fig|1158692.3.peg.2160 Staphylococcus aureus M0687 FIG01108752: hypothetical protein
fig|1158693.3.peg.243 Staphylococcus aureus M0692 FIG01108752: hypothetical protein
fig|1158694.3.peg.342 Staphylococcus aureus M0719 FIG01108752: hypothetical protein
fig|1158695.3.peg.2317 Staphylococcus aureus M0769 FIG01108752: hypothetical protein
fig|1158696.3.peg.719 Staphylococcus aureus M0770 FIG01108752: hypothetical protein
fig|1158697.3.peg.2317 Staphylococcus aureus M0780 FIG01108752: hypothetical protein
fig|1158698.3.peg.471 Staphylococcus aureus M0799 FIG01108752: hypothetical protein
fig|1158699.3.peg.2423 Staphylococcus aureus M0823 FIG01108752: hypothetical protein
fig|1158700.3.peg.348 Staphylococcus aureus M0844 FIG01108752: hypothetical protein
fig|1158701.3.peg.727 Staphylococcus aureus M0934 FIG01108752: hypothetical protein
fig|1158702.3.peg.2313 Staphylococcus aureus M0943 FIG01108752: hypothetical protein
fig|1158703.3.peg.2301 Staphylococcus aureus M0944 FIG01108752: hypothetical protein
fig|1158704.3.peg.1888 Staphylococcus aureus M0953 FIG01108752: hypothetical protein
fig|1158705.3.peg.1920 Staphylococcus aureus M0998 FIG01108752: hypothetical protein
fig|1158706.3.peg.2319 Staphylococcus aureus M0999 FIG01108752: hypothetical protein
fig|1158707.3.peg.247 Staphylococcus aureus M1007 FIG01108752: hypothetical protein
fig|1158708.3.peg.1880 Staphylococcus aureus M1010 FIG01108752: hypothetical protein
fig|1158709.3.peg.2421 Staphylococcus aureus M1015 FIG01108752: hypothetical protein
fig|1158710.3.peg.1914 Staphylococcus aureus M1016 FIG01108752: hypothetical protein
fig|1158711.3.peg.1996 Staphylococcus aureus M1036 FIG01108752: hypothetical protein
fig|1158712.3.peg.2316 Staphylococcus aureus M1037 FIG01108752: hypothetical protein
fig|1161392.3.peg.1792 Staphylococcus aureus NN54 FIG01108752: hypothetical protein
fig|1169256.3.peg.2344 Staphylococcus aureus M0964 FIG01108752: hypothetical protein
fig|1169257.3.peg.2002 Staphylococcus aureus M0978 FIG01108752: hypothetical protein
fig|1169258.3.peg.1911 Staphylococcus aureus M0994 FIG01108752: hypothetical protein
fig|1169260.3.peg.2286 Staphylococcus aureus M1044 FIG01108752: hypothetical protein
fig|1169261.3.peg.243 Staphylococcus aureus M1061 FIG01108752: hypothetical protein
fig|1169262.3.peg.2330 Staphylococcus aureus M1062 FIG01108752: hypothetical protein
fig|1169263.3.peg.2322 Staphylococcus aureus M1068 FIG01108752: hypothetical protein
fig|1169264.3.peg.2260 Staphylococcus aureus M1083 FIG01108752: hypothetical protein
fig|1169265.3.peg.346 Staphylococcus aureus M1109 FIG01108752: hypothetical protein
fig|1169266.3.peg.2260 Staphylococcus aureus M1126 FIG01108752: hypothetical protein
fig|1169267.3.peg.1830 Staphylococcus aureus M1142 FIG01108752: hypothetical protein
fig|1169268.3.peg.244 Staphylococcus aureus M1223 FIG01108752: hypothetical protein
fig|1169269.3.peg.2311 Staphylococcus aureus M1224 FIG01108752: hypothetical protein
fig|1169270.3.peg.2413 Staphylococcus aureus M1244 FIG01108752: hypothetical protein
fig|1169272.3.peg.2334 Staphylococcus aureus M1275 FIG01108752: hypothetical protein
fig|1169273.3.peg.2293 Staphylococcus aureus M1286 FIG01108752: hypothetical protein
fig|1169274.3.peg.2363 Staphylococcus aureus M1309 YoeB toxin protein
fig|1169275.3.peg.2308 Staphylococcus aureus M1374 FIG01108752: hypothetical protein
fig|1169276.3.peg.2310 Staphylococcus aureus M1405 FIG01108752: hypothetical protein
fig|1169277.3.peg.2399 Staphylococcus aureus M1510 FIG01108752: hypothetical protein
fig|1213721.3.peg.341 Staphylococcus aureus M0648 FIG01108752: hypothetical protein
fig|1213722.3.peg.243 Staphylococcus aureus M0660 FIG01108752: hypothetical protein
fig|1213723.3.peg.2303 Staphylococcus aureus M0663 FIG01108752: hypothetical protein
fig|1213724.3.peg.2344 Staphylococcus aureus M0673 FIG01108752: hypothetical protein
fig|1213725.3.peg.2323 Staphylococcus aureus M0695 FIG01108752: hypothetical protein
fig|1213726.3.peg.2366 Staphylococcus aureus M0792 FIG01108752: hypothetical protein
fig|1213727.3.peg.2330 Staphylococcus aureus M0822 FIG01108752: hypothetical protein
fig|1213728.3.peg.1982 Staphylococcus aureus M0831 FIG01108752: hypothetical protein
fig|1213729.3.peg.2290 Staphylococcus aureus M0871 FIG01108752: hypothetical protein
fig|1213732.3.peg.2356 Staphylococcus aureus M0892 FIG01108752: hypothetical protein
fig|1213733.3.peg.2348 Staphylococcus aureus M0900 FIG01108752: hypothetical protein
fig|1213734.3.peg.2336 Staphylococcus aureus M0927 FIG01108752: hypothetical protein
fig|1214901.3.peg.724 Staphylococcus aureus M0646 FIG01108752: hypothetical protein
fig|1216363.3.peg.2397 Staphylococcus aureus subsp. aureus 06BA18369 FIG01108752: hypothetical protein
fig|1221451.3.peg.2080 Staphylococcus aureus subsp. aureus 120 FIG01108752: hypothetical protein
fig|1221452.3.peg.990 Staphylococcus aureus subsp. aureus 333 FIG01108752: hypothetical protein
fig|1221453.3.peg.63 Staphylococcus aureus subsp. aureus 3989 FIG01108752: hypothetical protein
fig|1224919.3.peg.395 Staphylococcus aureus M0104 FIG01108752: hypothetical protein
fig|1224920.3.peg.271 Staphylococcus aureus M0171 FIG01108752: hypothetical protein
fig|1224921.3.peg.1314 Staphylococcus aureus M0210 FIG01108752: hypothetical protein
fig|1224922.3.peg.541 Staphylococcus aureus M0213 FIG01108752: hypothetical protein
fig|1224923.3.peg.2283 Staphylococcus aureus M0240 FIG01108752: hypothetical protein
fig|1224924.3.peg.241 Staphylococcus aureus M0270 FIG01108752: hypothetical protein
fig|1224925.3.peg.522 Staphylococcus aureus M0273 FIG01108752: hypothetical protein
fig|1224926.3.peg.1911 Staphylococcus aureus M0279 FIG01108752: hypothetical protein
fig|1224927.3.peg.1938 Staphylococcus aureus M0288 FIG01108752: hypothetical protein
fig|1224928.3.peg.1997 Staphylococcus aureus M0312 FIG01108752: hypothetical protein
fig|1224929.3.peg.2124 Staphylococcus aureus M0404 FIG01108752: hypothetical protein
fig|1224930.3.peg.341 Staphylococcus aureus M0415 FIG01108752: hypothetical protein
fig|1224931.3.peg.1811 Staphylococcus aureus M0455 FIG01108752: hypothetical protein
fig|1224932.3.peg.1885 Staphylococcus aureus M0460 FIG01108752: hypothetical protein
fig|1224933.3.peg.535 Staphylococcus aureus M0493 FIG01108752: hypothetical protein
fig|1226740.3.peg.358 Staphylococcus aureus subsp. aureus VH60 FIG01108752: hypothetical protein
fig|1231382.3.peg.427 Staphylococcus aureus KT/Y21 FIG01108752: hypothetical protein
fig|1231383.3.peg.2047 Staphylococcus aureus KT/314250 FIG01108752: hypothetical protein
fig|1235275.3.peg.2590 Staphylococcus aureus PPUKM-261-2009 FIG01108752: hypothetical protein
fig|1235276.3.peg.2636 Staphylococcus aureus PPUKM-332-2009 FIG01108752: hypothetical protein
fig|1235277.3.peg.2340 Staphylococcus aureus PPUKM-377-2009 FIG01108752: hypothetical protein
fig|1235278.3.peg.2586 Staphylococcus aureus PPUKM-775-2009 FIG01108752: hypothetical protein
fig|1241616.3.peg.1775 Staphylococcus aureus subsp. aureus DSM 20231 FIG01108752: hypothetical protein
fig|1242970.3.peg.2354 Staphylococcus aureus CN79 FIG01108752: hypothetical protein
fig|1258575.3.peg.1040 Staphylococcus aureus subsp. aureus H29 FIG01108752: hypothetical protein
fig|1265302.3.peg.2146 Staphylococcus aureus subsp. aureus PB32 FIG01108752: hypothetical protein
fig|1278071.4.peg.898 Staphylococcus aureus 3957 FIG01108752: hypothetical protein
fig|1278072.4.peg.2068 Staphylococcus aureus LVP2 FIG01108752: hypothetical protein
fig|1278074.4.peg.1136 Staphylococcus aureus VH221 FIG01108752: hypothetical protein
fig|1278075.4.peg.209 Staphylococcus aureus LVP5 FIG01108752: hypothetical protein
fig|1283278.3.peg.2160 Staphylococcus aureus KLT6 FIG01108752: hypothetical protein
fig|1288493.3.peg.338 Staphylococcus aureus subsp. aureus S1800 FIG01108752: hypothetical protein
fig|1303780.3.peg.1538 Staphylococcus aureus M0075 FIG01108752: hypothetical protein
fig|1303781.3.peg.488 Staphylococcus aureus M0294 FIG01108752: hypothetical protein
fig|1303782.3.peg.382 Staphylococcus aureus M1060 FIG01108752: hypothetical protein
fig|1303783.3.peg.1849 Staphylococcus aureus M1078 FIG01108752: hypothetical protein
fig|1303784.3.peg.545 Staphylococcus aureus M1193 FIG01108752: hypothetical protein
fig|1303786.3.peg.381 Staphylococcus aureus M1407 FIG01108752: hypothetical protein
fig|1303787.3.peg.2448 Staphylococcus aureus M1466 FIG01108752: hypothetical protein
fig|1305598.3.peg.2387 Staphylococcus aureus M1 FIG01108752: hypothetical protein
fig|1331008.3.peg.427 Staphylococcus aureus subsp. aureus CBD-635 FIG01108752: hypothetical protein
fig|158878.14.peg.2491 Staphylococcus aureus subsp. aureus Mu50 FIG01108752: hypothetical protein
fig|158879.11.peg.2380 Staphylococcus aureus subsp. aureus N315 FIG01108752: hypothetical protein
fig|196620.5.peg.2406 Staphylococcus aureus subsp. aureus MW2 FIG01108752: hypothetical protein
fig|282459.5.peg.2390 Staphylococcus aureus subsp. aureus MSSA476 FIG01108752: hypothetical protein
fig|359786.13.peg.2571 Staphylococcus aureus subsp. aureus JH9 FIG01108752: hypothetical protein
fig|359786.3.peg.1521 Staphylococcus aureus subsp. aureus JH9 FIG01108752: hypothetical protein
fig|359787.3.peg.668 Staphylococcus aureus subsp. aureus JH1 FIG01108752: hypothetical protein
fig|426430.8.peg.2508 Staphylococcus aureus subsp. aureus str. Newman FIG01108752: hypothetical protein
fig|450394.6.peg.2191 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG01108752: hypothetical protein
fig|452948.4.peg.546 Staphylococcus aureus 930918-3 FIG01108752: hypothetical protein
fig|455227.3.peg.803 Staphylococcus aureus D30 FIG01108752: hypothetical protein
fig|505321.3.peg.193 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG01108752: hypothetical protein
fig|543539.3.peg.1315 Staphylococcus aureus subsp. aureus CGS01 FIG01108752: hypothetical protein
fig|543540.3.peg.2380 Staphylococcus aureus subsp. aureus CGS03 FIG01108752: hypothetical protein
fig|546342.3.peg.1513 Staphylococcus aureus subsp. aureus str. JKD6008 FIG01108752: hypothetical protein
fig|546342.4.peg.2574 Staphylococcus aureus subsp. aureus str. JKD6008 FIG01108752: hypothetical protein
fig|546343.3.peg.1345 Staphylococcus aureus subsp. aureus str. JKD6009 FIG01108752: hypothetical protein
fig|548474.3.peg.471 Staphylococcus aureus subsp. aureus TCH130 FIG01108752: hypothetical protein
fig|548475.3.peg.1760 Staphylococcus aureus subsp. aureus TCH70 FIG01108752: hypothetical protein
fig|553567.3.peg.774 Staphylococcus aureus A5948 FIG01108752: hypothetical protein
fig|553568.3.peg.2739 Staphylococcus aureus A6224 FIG01108752: hypothetical protein
fig|553573.3.peg.799 Staphylococcus aureus A8115 FIG01108752: hypothetical protein
fig|553577.3.peg.236 Staphylococcus aureus A8796 FIG01108752: hypothetical protein
fig|553580.3.peg.237 Staphylococcus aureus A8819 FIG01108752: hypothetical protein
fig|553581.3.peg.2485 Staphylococcus aureus A9299 FIG01108752: hypothetical protein
fig|553588.3.peg.2575 Staphylococcus aureus A9719 FIG01108752: hypothetical protein
fig|553590.4.peg.1013 Staphylococcus aureus A9754 FIG01108752: hypothetical protein
fig|553592.3.peg.552 Staphylococcus aureus A9763 FIG01108752: hypothetical protein
fig|553594.3.peg.364 Staphylococcus aureus A9765 FIG01108752: hypothetical protein
fig|553601.3.peg.1903 Staphylococcus aureus A10102 FIG01108752: hypothetical protein
fig|561307.5.peg.1912 Staphylococcus aureus subsp. aureus RN4220 FIG01108752: hypothetical protein
fig|585891.3.peg.2485 Staphylococcus aureus subsp. aureus Mu50-omega FIG01108752: hypothetical protein
fig|680649.3.peg.2663 Staphylococcus aureus subsp. aureus MR1 FIG01108752: hypothetical protein
fig|681288.4.peg.2434 Staphylococcus aureus subsp. aureus ED98 FIG01108752: hypothetical protein
fig|703339.3.peg.2395 Staphylococcus aureus 04-02981 FIG01108752: hypothetical protein
fig|754025.3.peg.2443 Staphylococcus aureus subsp. aureus MRSA131 FIG01108752: hypothetical protein
fig|754026.3.peg.1900 Staphylococcus aureus subsp. aureus MRSA177 FIG01108752: hypothetical protein
fig|762962.3.peg.2101 Staphylococcus aureus subsp. aureus ATCC 51811 FIG01108752: hypothetical protein
fig|862516.3.peg.410 Staphylococcus aureus subsp. aureus ATCC BAA-39 FIG01108752: hypothetical protein
fig|889933.4.peg.2191 Staphylococcus aureus subsp. aureus ECT-R 2 FIG01108752: hypothetical protein
fig|904313.3.peg.472 Staphylococcus aureus subsp. aureus VCU006 FIG01108752: hypothetical protein
fig|904723.3.peg.2296 Staphylococcus aureus subsp. aureus 21172 FIG01108752: hypothetical protein
fig|904725.3.peg.1828 Staphylococcus aureus subsp. aureus 21189 FIG01108752: hypothetical protein
fig|904729.3.peg.1293 Staphylococcus aureus subsp. aureus 21196 FIG01108752: hypothetical protein
fig|904731.3.peg.455 Staphylococcus aureus subsp. aureus 21201 FIG01108752: hypothetical protein
fig|904735.3.peg.2069 Staphylococcus aureus subsp. aureus 21209 FIG01108752: hypothetical protein
fig|904737.3.peg.2530 Staphylococcus aureus subsp. aureus 21232 FIG01108752: hypothetical protein
fig|904739.3.peg.1376 Staphylococcus aureus subsp. aureus 21236 FIG01108752: hypothetical protein
fig|904744.3.peg.1786 Staphylococcus aureus subsp. aureus 21259 FIG01108752: hypothetical protein
fig|904747.3.peg.1838 Staphylococcus aureus subsp. aureus 21266 FIG01108752: hypothetical protein
fig|904750.3.peg.2119 Staphylococcus aureus subsp. aureus 21272 FIG01108752: hypothetical protein
fig|904754.3.peg.1997 Staphylococcus aureus subsp. aureus 21283 FIG01108752: hypothetical protein
fig|904759.3.peg.1587 Staphylococcus aureus subsp. aureus 21305 FIG01108752: hypothetical protein
fig|904763.3.peg.2230 Staphylococcus aureus subsp. aureus 21318 FIG01108752: hypothetical protein
fig|904767.3.peg.1031 Staphylococcus aureus subsp. aureus 21333 FIG01108752: hypothetical protein
fig|904768.3.peg.1129 Staphylococcus aureus subsp. aureus 21334 FIG01108752: hypothetical protein
fig|904771.3.peg.2334 Staphylococcus aureus subsp. aureus 21340 FIG01108752: hypothetical protein
fig|904775.3.peg.831 Staphylococcus aureus subsp. aureus IS-3 FIG01108752: hypothetical protein
fig|904776.3.peg.124 Staphylococcus aureus subsp. aureus IS-24 FIG01108752: hypothetical protein
fig|904777.3.peg.1515 Staphylococcus aureus subsp. aureus IS-55 FIG01108752: hypothetical protein
fig|904778.3.peg.236 Staphylococcus aureus subsp. aureus IS-88 FIG01108752: hypothetical protein
fig|904779.3.peg.1124 Staphylococcus aureus subsp. aureus IS-91 FIG01108752: hypothetical protein
fig|904780.3.peg.211 Staphylococcus aureus subsp. aureus IS-99 FIG01108752: hypothetical protein
fig|904782.3.peg.2771 Staphylococcus aureus subsp. aureus IS-111 FIG01108752: hypothetical protein
fig|904783.3.peg.2589 Staphylococcus aureus subsp. aureus IS-122 FIG01108752: hypothetical protein
fig|904784.3.peg.2320 Staphylococcus aureus subsp. aureus IS-125 FIG01108752: hypothetical protein
fig|904785.3.peg.1419 Staphylococcus aureus subsp. aureus IS-157 FIG01108752: hypothetical protein
fig|904787.3.peg.401 Staphylococcus aureus subsp. aureus IS-189 FIG01108752: hypothetical protein
fig|904792.3.peg.1717 Staphylococcus aureus subsp. aureus IS-M FIG01108752: hypothetical protein
fig|904795.7.peg.1997 Staphylococcus aureus subsp. aureus CO-23 FIG01108752: hypothetical protein
fig|908247.3.peg.2069 Staphylococcus aureus 16K FIG01108752: hypothetical protein
fig|93061.5.peg.2438 Staphylococcus aureus subsp. aureus NCTC 8325 FIG01108752: hypothetical protein
fig|931432.3.peg.242 Staphylococcus aureus subsp. aureus CIG1057 FIG01108752: hypothetical protein
fig|931433.3.peg.269 Staphylococcus aureus subsp. aureus CIG1114 FIG01108752: hypothetical protein
fig|931434.3.peg.238 Staphylococcus aureus subsp. aureus CIG1165 FIG01108752: hypothetical protein
fig|931439.3.peg.259 Staphylococcus aureus subsp. aureus CIG1750 FIG01108752: hypothetical protein
fig|931440.3.peg.373 Staphylococcus aureus subsp. aureus CIG1769 FIG01108752: hypothetical protein
fig|931441.3.peg.1599 Staphylococcus aureus subsp. aureus CIG1835 FIG01108752: hypothetical protein
fig|931442.3.peg.244 Staphylococcus aureus subsp. aureus CIG547 FIG01108752: hypothetical protein
fig|931443.3.peg.240 Staphylococcus aureus subsp. aureus CIG1096 FIG01108752: hypothetical protein
fig|931444.3.peg.276 Staphylococcus aureus subsp. aureus CIG1150 FIG01108752: hypothetical protein
fig|931446.3.peg.239 Staphylococcus aureus subsp. aureus CIG1213 FIG01108752: hypothetical protein
fig|931448.3.peg.245 Staphylococcus aureus subsp. aureus CIG1612 FIG01108752: hypothetical protein
fig|931449.3.peg.266 Staphylococcus aureus subsp. aureus CIG1770 FIG01108752: hypothetical protein
fig|931450.3.peg.243 Staphylococcus aureus subsp. aureus CIG2018 FIG01108752: hypothetical protein
fig|931455.3.peg.273 Staphylococcus aureus subsp. aureus CIGC340D FIG01108752: hypothetical protein
fig|931457.3.peg.249 Staphylococcus aureus subsp. aureus CIGC345D FIG01108752: hypothetical protein
fig|931458.3.peg.240 Staphylococcus aureus subsp. aureus CIGC348 FIG01108752: hypothetical protein
fig|931459.3.peg.231 Staphylococcus aureus subsp. aureus CIGC128 FIG01108752: hypothetical protein
fig|931460.3.peg.2357 Staphylococcus aureus subsp. aureus CIGC93 FIG01108752: hypothetical protein