page	:SeedViewerServeFeature:
fid	:fig|426430.8.peg.2506:
show_prot_sequence	:1:

>fig|426430.8.peg.2506
MTIKVEDNKIIFSRTIEAPIEKVFDAYTTKALFEKWFHPKDASTKVFRFNAVSGGDAFYA
IKTPTMTSYTLAEYKTVKRPYLIEYIDSFATPQGAKDTKMPSMKITLSFSKSNTTKTTVT
STSVFPTKEAAQQVINMGVEQGMNQTLDQLDALLK


PEGs with Identical Sequence
PEG Genome Function
fig|1006543.3.peg.2391 Staphylococcus aureus subsp. aureus T0131 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1028799.3.peg.2167 Staphylococcus aureus subsp. aureus VC40 hypothetical protein
fig|1112349.3.peg.2526 Staphylococcus aureus subsp. aureus NN50 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1137133.3.peg.2161 Staphylococcus aureus subsp. aureus MRGR3 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1144271.3.peg.1716 Staphylococcus aureus subsp. aureus 118 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1156994.3.peg.1884 Staphylococcus aureus HI049 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1156995.3.peg.346 Staphylococcus aureus HI010 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1156996.3.peg.1886 Staphylococcus aureus HI049B Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1156997.3.peg.2406 Staphylococcus aureus HI010B Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1156998.3.peg.1794 Staphylococcus aureus HIF003_B2N-C Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1156999.3.peg.2334 Staphylococcus aureus HI022 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1157000.3.peg.2381 Staphylococcus aureus HI049C Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1157001.3.peg.243 Staphylococcus aureus HI168 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1157002.3.peg.2098 Staphylococcus aureus HI111 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1157003.3.peg.245 Staphylococcus aureus HI013 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1157016.3.peg.500 Staphylococcus aureus M0221 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1157018.3.peg.1766 Staphylococcus aureus M0239 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1157024.3.peg.369 Staphylococcus aureus M0340 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1157032.3.peg.1960 Staphylococcus aureus M0468 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1158465.3.peg.248 Staphylococcus aureus M1064 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1158495.3.peg.2350 Staphylococcus aureus M1462 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1158508.3.peg.2310 Staphylococcus aureus M0055 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1158529.3.peg.2443 Staphylococcus aureus M0396 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1158530.3.peg.242 Staphylococcus aureus M0424 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1158539.3.peg.2416 Staphylococcus aureus M0633 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1158683.3.peg.1868 Staphylococcus aureus M0531 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1158707.3.peg.245 Staphylococcus aureus M1007 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1169268.3.peg.242 Staphylococcus aureus M1223 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1213728.3.peg.1980 Staphylococcus aureus M0831 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1221451.3.peg.2082 Staphylococcus aureus subsp. aureus 120 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1221452.3.peg.988 Staphylococcus aureus subsp. aureus 333 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1221453.3.peg.65 Staphylococcus aureus subsp. aureus 3989 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1224928.3.peg.1995 Staphylococcus aureus M0312 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1226740.3.peg.360 Staphylococcus aureus subsp. aureus VH60 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1231382.3.peg.429 Staphylococcus aureus KT/Y21 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1231383.3.peg.2049 Staphylococcus aureus KT/314250 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1235275.3.peg.2588 Staphylococcus aureus PPUKM-261-2009 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1235276.3.peg.2634 Staphylococcus aureus PPUKM-332-2009 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1235278.3.peg.2584 Staphylococcus aureus PPUKM-775-2009 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1241616.3.peg.1773 Staphylococcus aureus subsp. aureus DSM 20231 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1242970.3.peg.2352 Staphylococcus aureus CN79 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1265302.3.peg.2148 Staphylococcus aureus subsp. aureus PB32 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1278071.4.peg.896 Staphylococcus aureus 3957 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1278072.4.peg.2070 Staphylococcus aureus LVP2 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1283278.3.peg.2158 Staphylococcus aureus KLT6 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|1305598.3.peg.2385 Staphylococcus aureus M1 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|196620.1.peg.2327 Staphylococcus aureus subsp. aureus MW2 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|196620.5.peg.2404 Staphylococcus aureus subsp. aureus MW2 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|282459.1.peg.2274 Staphylococcus aureus subsp. aureus MSSA476 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|282459.5.peg.2388 Staphylococcus aureus subsp. aureus MSSA476 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|367830.3.peg.436 Staphylococcus aureus subsp. aureus USA300 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|426430.6.peg.2233 Staphylococcus aureus subsp. aureus str. Newman Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|426430.8.peg.2506 Staphylococcus aureus subsp. aureus str. Newman Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|450394.6.peg.2189 Staphylococcus aureus subsp. aureus USA300_TCH959 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|451515.3.peg.2508 Staphylococcus aureus subsp. aureus USA300_FPR3757 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|451516.9.peg.2497 Staphylococcus aureus subsp. aureus USA300_TCH1516 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|452948.4.peg.549 Staphylococcus aureus 930918-3 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|455227.3.peg.805 Staphylococcus aureus D30 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|543539.3.peg.1317 Staphylococcus aureus subsp. aureus CGS01 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|546342.3.peg.1511 Staphylococcus aureus subsp. aureus str. JKD6008 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|546342.4.peg.2572 Staphylococcus aureus subsp. aureus str. JKD6008 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|546343.3.peg.1347 Staphylococcus aureus subsp. aureus str. JKD6009 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|548474.3.peg.473 Staphylococcus aureus subsp. aureus TCH130 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|548475.3.peg.1762 Staphylococcus aureus subsp. aureus TCH70 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|553567.3.peg.776 Staphylococcus aureus A5948 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|553590.4.peg.1011 Staphylococcus aureus A9754 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|553594.3.peg.362 Staphylococcus aureus A9765 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|561307.5.peg.1910 Staphylococcus aureus subsp. aureus RN4220 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|644279.4.peg.2548 Staphylococcus aureus subsp. aureus 132 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|663951.4.peg.2694 Staphylococcus aureus subsp. aureus TW20 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|754025.3.peg.2441 Staphylococcus aureus subsp. aureus MRSA131 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|754026.3.peg.1902 Staphylococcus aureus subsp. aureus MRSA177 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|762962.3.peg.2103 Staphylococcus aureus subsp. aureus ATCC 51811 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|862516.3.peg.408 Staphylococcus aureus subsp. aureus ATCC BAA-39 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|904313.3.peg.470 Staphylococcus aureus subsp. aureus VCU006 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|904724.3.peg.2792 Staphylococcus aureus subsp. aureus 21178 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|904725.3.peg.1826 Staphylococcus aureus subsp. aureus 21189 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|904726.3.peg.1759 Staphylococcus aureus subsp. aureus 21193 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|904735.3.peg.2067 Staphylococcus aureus subsp. aureus 21209 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|904737.3.peg.2532 Staphylococcus aureus subsp. aureus 21232 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|904744.3.peg.1784 Staphylococcus aureus subsp. aureus 21259 hypothetical protein
fig|904747.3.peg.1836 Staphylococcus aureus subsp. aureus 21266 hypothetical protein
fig|904753.3.peg.459 Staphylococcus aureus subsp. aureus 21282 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|904754.3.peg.1995 Staphylococcus aureus subsp. aureus 21283 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|904759.3.peg.1585 Staphylococcus aureus subsp. aureus 21305 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|904768.3.peg.1131 Staphylococcus aureus subsp. aureus 21334 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|904771.3.peg.2336 Staphylococcus aureus subsp. aureus 21340 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|904773.3.peg.2246 Staphylococcus aureus subsp. aureus 21343 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|904776.3.peg.122 Staphylococcus aureus subsp. aureus IS-24 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|904777.3.peg.1517 Staphylococcus aureus subsp. aureus IS-55 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|904778.3.peg.234 Staphylococcus aureus subsp. aureus IS-88 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|904779.3.peg.1122 Staphylococcus aureus subsp. aureus IS-91 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|904782.3.peg.2773 Staphylococcus aureus subsp. aureus IS-111 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|904784.3.peg.2318 Staphylococcus aureus subsp. aureus IS-125 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|904785.3.peg.1421 Staphylococcus aureus subsp. aureus IS-157 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|904787.3.peg.399 Staphylococcus aureus subsp. aureus IS-189 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|904795.7.peg.1999 Staphylococcus aureus subsp. aureus CO-23 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|908247.3.peg.2067 Staphylococcus aureus 16K Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|93061.3.peg.2543 Staphylococcus aureus subsp. aureus NCTC 8325 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|93061.5.peg.2436 Staphylococcus aureus subsp. aureus NCTC 8325 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|93062.19.peg.2346 Staphylococcus aureus subsp. aureus COL Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|93062.4.peg.2460 Staphylococcus aureus subsp. aureus COL Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|931433.3.peg.267 Staphylococcus aureus subsp. aureus CIG1114 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|931441.3.peg.1597 Staphylococcus aureus subsp. aureus CIG1835 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|931442.3.peg.242 Staphylococcus aureus subsp. aureus CIG547 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|931448.3.peg.243 Staphylococcus aureus subsp. aureus CIG1612 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|931449.3.peg.264 Staphylococcus aureus subsp. aureus CIG1770 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|931450.3.peg.241 Staphylococcus aureus subsp. aureus CIG2018 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|931457.3.peg.247 Staphylococcus aureus subsp. aureus CIGC345D Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|931459.3.peg.229 Staphylococcus aureus subsp. aureus CIGC128 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|931460.3.peg.2355 Staphylococcus aureus subsp. aureus CIGC93 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)