page	:SeedViewerServeFeature:
fid	:fig|426430.8.peg.2362:
show_prot_sequence	:1:

>fig|426430.8.peg.2362
MKQFEIVTEPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKL
AQIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVP
IWKKEIWEDGSKWQGHQKGNYEEAKREE


PEGs with Identical Sequence
PEG Genome Function
fig|1006543.3.peg.2252 Staphylococcus aureus subsp. aureus T0131 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1028799.3.peg.2030 Staphylococcus aureus subsp. aureus VC40 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1112349.3.peg.2387 Staphylococcus aureus subsp. aureus NN50 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1118959.3.peg.2129 Staphylococcus aureus subsp. aureus M013 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1123523.3.peg.2220 Staphylococcus aureus subsp. aureus 11819-97 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1137130.3.peg.1445 Staphylococcus aureus subsp. aureus 103564 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1137131.3.peg.238 Staphylococcus aureus subsp. aureus 122051 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1137132.3.peg.617 Staphylococcus aureus subsp. aureus 112808A Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1137133.3.peg.1633 Staphylococcus aureus subsp. aureus MRGR3 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1144271.3.peg.1230 Staphylococcus aureus subsp. aureus 118 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1144272.3.peg.2471 Staphylococcus aureus subsp. aureus GR1 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1147034.3.peg.1635 Staphylococcus aureus PM1 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1155079.3.peg.2007 Staphylococcus aureus subsp. aureus DR10 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1155084.3.peg.2055 Staphylococcus aureus subsp. aureus 71193 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1156994.3.peg.1747 Staphylococcus aureus HI049 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1156995.3.peg.208 Staphylococcus aureus HI010 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1156996.3.peg.1749 Staphylococcus aureus HI049B Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1156997.3.peg.2269 Staphylococcus aureus HI010B Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1156998.3.peg.1657 Staphylococcus aureus HIF003_B2N-C Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1156999.3.peg.2197 Staphylococcus aureus HI022 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1157000.3.peg.2244 Staphylococcus aureus HI049C Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1157001.3.peg.108 Staphylococcus aureus HI168 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1157002.3.peg.1961 Staphylococcus aureus HI111 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1157003.3.peg.107 Staphylococcus aureus HI013 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1157016.3.peg.364 Staphylococcus aureus M0221 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1157024.3.peg.232 Staphylococcus aureus M0340 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1157028.3.peg.205 Staphylococcus aureus M0408 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1157032.3.peg.1824 Staphylococcus aureus M0468 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1158465.3.peg.110 Staphylococcus aureus M1064 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1158485.3.peg.951 Staphylococcus aureus M1311 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1158495.3.peg.2214 Staphylococcus aureus M1462 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1158508.3.peg.2173 Staphylococcus aureus M0055 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1158529.3.peg.2306 Staphylococcus aureus M0396 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1158530.3.peg.105 Staphylococcus aureus M0424 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1158534.3.peg.2131 Staphylococcus aureus M0513 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1158539.3.peg.2279 Staphylococcus aureus M0633 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1158683.3.peg.1731 Staphylococcus aureus M0531 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1158707.3.peg.109 Staphylococcus aureus M1007 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1163749.3.peg.1667 Staphylococcus aureus subsp. aureus LCT-SA112 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1169255.3.peg.950 Staphylococcus aureus M0946 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1169259.3.peg.738 Staphylococcus aureus M1034 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1169268.3.peg.107 Staphylococcus aureus M1223 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1169271.3.peg.893 Staphylococcus aureus M1256 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1213728.3.peg.1844 Staphylococcus aureus M0831 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1213730.3.peg.936 Staphylococcus aureus M0877 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1221451.3.peg.245 Staphylococcus aureus subsp. aureus 120 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1221452.3.peg.855 Staphylococcus aureus subsp. aureus 333 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1221453.3.peg.201 Staphylococcus aureus subsp. aureus 3989 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1224928.3.peg.1858 Staphylococcus aureus M0312 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1226740.3.peg.497 Staphylococcus aureus subsp. aureus VH60 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1229492.3.peg.2136 Staphylococcus aureus 08BA02176 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1231382.3.peg.1140 Staphylococcus aureus KT/Y21 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1231383.3.peg.1013 Staphylococcus aureus KT/314250 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1233245.3.peg.2335 Staphylococcus aureus M2 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1235275.3.peg.2446 Staphylococcus aureus PPUKM-261-2009 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1235276.3.peg.2496 Staphylococcus aureus PPUKM-332-2009 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1235278.3.peg.2444 Staphylococcus aureus PPUKM-775-2009 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1241616.3.peg.1637 Staphylococcus aureus subsp. aureus DSM 20231 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1242970.3.peg.2265 Staphylococcus aureus CN79 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1265302.3.peg.2280 Staphylococcus aureus subsp. aureus PB32 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1278071.4.peg.196 Staphylococcus aureus 3957 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1278072.4.peg.168 Staphylococcus aureus LVP2 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1278074.4.peg.392 Staphylococcus aureus VH221 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1278075.4.peg.72 Staphylococcus aureus LVP5 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1283278.3.peg.2026 Staphylococcus aureus KLT6 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1288493.3.peg.1465 Staphylococcus aureus subsp. aureus S1800 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|1323661.3.peg.2262 Staphylococcus aureus CA-347 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|196620.1.peg.2189 Staphylococcus aureus subsp. aureus MW2 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|196620.5.peg.2261 Staphylococcus aureus subsp. aureus MW2 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|282458.1.peg.2227 Staphylococcus aureus subsp. aureus MRSA252 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|282458.4.peg.2368 Staphylococcus aureus subsp. aureus MRSA252 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|282459.1.peg.2139 Staphylococcus aureus subsp. aureus MSSA476 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|282459.5.peg.2246 Staphylococcus aureus subsp. aureus MSSA476 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|367830.3.peg.1963 Staphylococcus aureus subsp. aureus USA300 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|426430.6.peg.2108 Staphylococcus aureus subsp. aureus str. Newman Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|426430.8.peg.2362 Staphylococcus aureus subsp. aureus str. Newman Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|450394.6.peg.1481 Staphylococcus aureus subsp. aureus USA300_TCH959 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|451515.3.peg.2367 Staphylococcus aureus subsp. aureus USA300_FPR3757 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|451516.9.peg.2356 Staphylococcus aureus subsp. aureus USA300_TCH1516 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|452948.4.peg.1415 Staphylococcus aureus 930918-3 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|455227.3.peg.492 Staphylococcus aureus D30 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|543538.3.peg.2072 Staphylococcus aureus subsp. aureus CGS00 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|543539.3.peg.588 Staphylococcus aureus subsp. aureus CGS01 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|546342.3.peg.142 Staphylococcus aureus subsp. aureus str. JKD6008 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|546342.4.peg.2425 Staphylococcus aureus subsp. aureus str. JKD6008 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|546343.3.peg.206 Staphylococcus aureus subsp. aureus str. JKD6009 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|548470.3.peg.1082 Staphylococcus aureus subsp. aureus MN8 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|548473.3.peg.328 Staphylococcus aureus subsp. aureus TCH60 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|548473.6.peg.903 Staphylococcus aureus subsp. aureus TCH60 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|548474.3.peg.611 Staphylococcus aureus subsp. aureus TCH130 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|548475.3.peg.1902 Staphylococcus aureus subsp. aureus TCH70 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|553567.3.peg.224 Staphylococcus aureus A5948 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|553583.3.peg.234 Staphylococcus aureus A9635 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|553590.4.peg.870 Staphylococcus aureus A9754 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|553594.3.peg.1153 Staphylococcus aureus A9765 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|561307.5.peg.1624 Staphylococcus aureus subsp. aureus RN4220 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585143.3.peg.736 Staphylococcus aureus subsp. aureus 55/2053 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585144.3.peg.721 Staphylococcus aureus subsp. aureus 58-424 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585145.3.peg.531 Staphylococcus aureus subsp. aureus 65-1322 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585146.3.peg.102 Staphylococcus aureus subsp. aureus 68-397 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585147.3.peg.1821 Staphylococcus aureus subsp. aureus A017934/97 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585148.3.peg.2045 Staphylococcus aureus subsp. aureus Btn1260 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585149.6.peg.2440 Staphylococcus aureus subsp. aureus C101 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585150.3.peg.654 Staphylococcus aureus subsp. aureus C160 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585151.3.peg.1980 Staphylococcus aureus subsp. aureus C427 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585152.3.peg.2241 Staphylococcus aureus subsp. aureus D139 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585153.3.peg.533 Staphylococcus aureus subsp. aureus E1410 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585154.3.peg.2326 Staphylococcus aureus subsp. aureus EMRSA16 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585155.3.peg.808 Staphylococcus aureus subsp. aureus H19 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585156.3.peg.1819 Staphylococcus aureus subsp. aureus M1015 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585157.3.peg.1935 Staphylococcus aureus subsp. aureus M809 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585158.3.peg.312 Staphylococcus aureus subsp. aureus M876 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585159.3.peg.2367 Staphylococcus aureus subsp. aureus M899 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585160.3.peg.2078 Staphylococcus aureus subsp. aureus WBG10049 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585161.3.peg.2098 Staphylococcus aureus subsp. aureus WW2703/97 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|644279.4.peg.2407 Staphylococcus aureus subsp. aureus 132 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|663951.4.peg.2549 Staphylococcus aureus subsp. aureus TW20 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|754025.3.peg.1465 Staphylococcus aureus subsp. aureus MRSA131 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|754026.3.peg.1047 Staphylococcus aureus subsp. aureus MRSA177 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|762962.3.peg.2247 Staphylococcus aureus subsp. aureus ATCC 51811 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|862516.3.peg.264 Staphylococcus aureus subsp. aureus ATCC BAA-39 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904313.3.peg.244 Staphylococcus aureus subsp. aureus VCU006 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904724.3.peg.1250 Staphylococcus aureus subsp. aureus 21178 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904725.3.peg.40 Staphylococcus aureus subsp. aureus 21189 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904726.3.peg.1625 Staphylococcus aureus subsp. aureus 21193 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904727.3.peg.883 Staphylococcus aureus subsp. aureus 21194 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904728.3.peg.1271 Staphylococcus aureus subsp. aureus 21195 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904729.3.peg.275 Staphylococcus aureus subsp. aureus 21196 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904730.3.peg.1240 Staphylococcus aureus subsp. aureus 21200 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904732.3.peg.366 Staphylococcus aureus subsp. aureus 21202 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904735.3.peg.2650 Staphylococcus aureus subsp. aureus 21209 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904737.3.peg.1782 Staphylococcus aureus subsp. aureus 21232 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904738.3.peg.681 Staphylococcus aureus subsp. aureus 21235 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904744.3.peg.1327 Staphylococcus aureus subsp. aureus 21259 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904745.3.peg.2210 Staphylococcus aureus subsp. aureus 21262 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904746.3.peg.150 Staphylococcus aureus subsp. aureus 21264 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904747.3.peg.683 Staphylococcus aureus subsp. aureus 21266 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904749.3.peg.819 Staphylococcus aureus subsp. aureus 21269 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904753.3.peg.825 Staphylococcus aureus subsp. aureus 21282 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904754.3.peg.2627 Staphylococcus aureus subsp. aureus 21283 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904759.3.peg.846 Staphylococcus aureus subsp. aureus 21305 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904766.3.peg.1399 Staphylococcus aureus subsp. aureus 21331 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904767.3.peg.900 Staphylococcus aureus subsp. aureus 21333 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904768.3.peg.2313 Staphylococcus aureus subsp. aureus 21334 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904772.3.peg.493 Staphylococcus aureus subsp. aureus 21342 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904774.3.peg.621 Staphylococcus aureus subsp. aureus 21345 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904776.3.peg.2517 Staphylococcus aureus subsp. aureus IS-24 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904777.3.peg.2279 Staphylococcus aureus subsp. aureus IS-55 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904778.3.peg.2337 Staphylococcus aureus subsp. aureus IS-88 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904779.3.peg.1719 Staphylococcus aureus subsp. aureus IS-91 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904782.3.peg.2313 Staphylococcus aureus subsp. aureus IS-111 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904784.3.peg.1568 Staphylococcus aureus subsp. aureus IS-125 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904785.3.peg.1197 Staphylococcus aureus subsp. aureus IS-157 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904786.3.peg.1770 Staphylococcus aureus subsp. aureus IS-160 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904787.3.peg.261 Staphylococcus aureus subsp. aureus IS-189 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|904795.7.peg.883 Staphylococcus aureus subsp. aureus CO-23 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|908247.3.peg.1217 Staphylococcus aureus 16K Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|93061.3.peg.2395 Staphylococcus aureus subsp. aureus NCTC 8325 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|93061.5.peg.2290 Staphylococcus aureus subsp. aureus NCTC 8325 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|93062.19.peg.2205 Staphylococcus aureus subsp. aureus COL Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|93062.4.peg.2326 Staphylococcus aureus subsp. aureus COL Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|931433.3.peg.133 Staphylococcus aureus subsp. aureus CIG1114 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|931435.3.peg.102 Staphylococcus aureus subsp. aureus CIG1214 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|931436.3.peg.2318 Staphylococcus aureus subsp. aureus CIG1242 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|931437.3.peg.268 Staphylococcus aureus subsp. aureus CIG1500 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|931438.3.peg.102 Staphylococcus aureus subsp. aureus CIG1605 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|931441.3.peg.2540 Staphylococcus aureus subsp. aureus CIG1835 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|931442.3.peg.104 Staphylococcus aureus subsp. aureus CIG547 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|931445.3.peg.102 Staphylococcus aureus subsp. aureus CIG1176 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|931447.3.peg.102 Staphylococcus aureus subsp. aureus CIG1233 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|931448.3.peg.107 Staphylococcus aureus subsp. aureus CIG1612 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|931449.3.peg.129 Staphylococcus aureus subsp. aureus CIG1770 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|931450.3.peg.106 Staphylococcus aureus subsp. aureus CIG2018 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|931452.3.peg.103 Staphylococcus aureus subsp. aureus CIG1267 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|931453.3.peg.101 Staphylococcus aureus subsp. aureus CIG149 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|931454.3.peg.99 Staphylococcus aureus subsp. aureus CIG1524 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|931456.3.peg.138 Staphylococcus aureus subsp. aureus CIGC341D Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|931457.3.peg.110 Staphylococcus aureus subsp. aureus CIGC345D Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|931459.3.peg.95 Staphylococcus aureus subsp. aureus CIGC128 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|931460.3.peg.2221 Staphylococcus aureus subsp. aureus CIGC93 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|948561.3.peg.1138 Staphylococcus aureus O11 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|948563.3.peg.413 Staphylococcus aureus O46 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|985006.4.peg.2073 Staphylococcus aureus subsp. aureus LGA251 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)