page	:SeedViewerServeFeature:
fid	:fig|426430.8.peg.1742:
show_prot_sequence	:1:

>fig|426430.8.peg.1742
MINEREVFILIYLDNAATTKAFEEVLDTYLKVNQSMYYNPNSPHKAGLQANQLLQQAKTQ
INAMINSKTNYDVVFTSGATESNNLALKGIAYRKFDTAKEIITSVLEHPSVLEVVRYLEA
HEGFKVKYVDVKKDGSINLEHFKELMSDKVGLVTCMYVNNVTGQIQPIPQMAKVIKNYPK
AHFHVDAVQAFGKISMDLNNIDSISLSGHKFNGLKGQGVLLVNHIQNVEPTVHGGGQEYG
VRSGTVNLPNDIAMVKAMKIANENFEALNAFVTELNNDVRQFLNKYHGVYINSSTSGSPF
VLNISFPGVKGEVLVNAFSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSF
GATTTKEDIARFKEIFIIIYEEIKELLK


PEGs with Identical Sequence
PEG Genome Function
fig|1006543.3.peg.1685 Staphylococcus aureus subsp. aureus T0131 Cysteine desulfurase (EC 2.8.1.7)
fig|1028799.3.peg.1552 Staphylococcus aureus subsp. aureus VC40 Cysteine desulfurase (EC 2.8.1.7)
fig|1112349.3.peg.1297 Staphylococcus aureus subsp. aureus NN50 Cysteine desulfurase (EC 2.8.1.7)
fig|1137133.3.peg.608 Staphylococcus aureus subsp. aureus MRGR3 Cysteine desulfurase (EC 2.8.1.7)
fig|1156994.3.peg.1209 Staphylococcus aureus HI049 Cysteine desulfurase (EC 2.8.1.7)
fig|1156995.3.peg.2373 Staphylococcus aureus HI010 Cysteine desulfurase (EC 2.8.1.7)
fig|1156996.3.peg.1211 Staphylococcus aureus HI049B Cysteine desulfurase (EC 2.8.1.7)
fig|1156997.3.peg.1729 Staphylococcus aureus HI010B Cysteine desulfurase (EC 2.8.1.7)
fig|1156998.3.peg.1127 Staphylococcus aureus HIF003_B2N-C Cysteine desulfurase (EC 2.8.1.7)
fig|1156999.3.peg.1661 Staphylococcus aureus HI022 Cysteine desulfurase (EC 2.8.1.7)
fig|1157000.3.peg.1700 Staphylococcus aureus HI049C Cysteine desulfurase (EC 2.8.1.7)
fig|1157001.3.peg.2247 Staphylococcus aureus HI168 Cysteine desulfurase (EC 2.8.1.7)
fig|1157002.3.peg.1420 Staphylococcus aureus HI111 Cysteine desulfurase (EC 2.8.1.7)
fig|1157003.3.peg.2274 Staphylococcus aureus HI013 Cysteine desulfurase (EC 2.8.1.7)
fig|1157016.3.peg.2583 Staphylococcus aureus M0221 Cysteine desulfurase (EC 2.8.1.7)
fig|1157024.3.peg.2448 Staphylococcus aureus M0340 Cysteine desulfurase (EC 2.8.1.7)
fig|1157032.3.peg.1279 Staphylococcus aureus M0468 Cysteine desulfurase (EC 2.8.1.7)
fig|1158465.3.peg.2332 Staphylococcus aureus M1064 Cysteine desulfurase (EC 2.8.1.7)
fig|1158477.3.peg.1153 Staphylococcus aureus M1216 Cysteine desulfurase (EC 2.8.1.7)
fig|1158495.3.peg.1739 Staphylococcus aureus M1462 Cysteine desulfurase (EC 2.8.1.7)
fig|1158508.3.peg.1634 Staphylococcus aureus M0055 Cysteine desulfurase (EC 2.8.1.7)
fig|1158530.3.peg.2360 Staphylococcus aureus M0424 Cysteine desulfurase (EC 2.8.1.7)
fig|1158539.3.peg.1734 Staphylococcus aureus M0633 Cysteine desulfurase (EC 2.8.1.7)
fig|1158683.3.peg.1191 Staphylococcus aureus M0531 Cysteine desulfurase (EC 2.8.1.7)
fig|1158707.3.peg.2357 Staphylococcus aureus M1007 Cysteine desulfurase (EC 2.8.1.7)
fig|1169268.3.peg.2331 Staphylococcus aureus M1223 Cysteine desulfurase (EC 2.8.1.7)
fig|1213728.3.peg.1291 Staphylococcus aureus M0831 Cysteine desulfurase (EC 2.8.1.7)
fig|1224928.3.peg.1303 Staphylococcus aureus M0312 Cysteine desulfurase (EC 2.8.1.7)
fig|1235275.3.peg.1769 Staphylococcus aureus PPUKM-261-2009 Cysteine desulfurase (EC 2.8.1.7)
fig|1235276.3.peg.1831 Staphylococcus aureus PPUKM-332-2009 Cysteine desulfurase (EC 2.8.1.7)
fig|1235278.3.peg.1703 Staphylococcus aureus PPUKM-775-2009 Cysteine desulfurase (EC 2.8.1.7)
fig|1241616.3.peg.1170 Staphylococcus aureus subsp. aureus DSM 20231 Cysteine desulfurase (EC 2.8.1.7)
fig|1242970.3.peg.1652 Staphylococcus aureus CN79 Cysteine desulfurase (EC 2.8.1.7)
fig|1265302.3.peg.1331 Staphylococcus aureus subsp. aureus PB32 Cysteine desulfurase (EC 2.8.1.7)
fig|1305598.3.peg.1702 Staphylococcus aureus M1 Cysteine desulfurase (EC 2.8.1.7)
fig|426430.6.peg.1561 Staphylococcus aureus subsp. aureus str. Newman Cysteine desulfurase (EC 2.8.1.7)
fig|426430.8.peg.1742 Staphylococcus aureus subsp. aureus str. Newman Cysteine desulfurase (EC 2.8.1.7)
fig|451515.3.peg.1813 Staphylococcus aureus subsp. aureus USA300_FPR3757 Cysteine desulfurase (EC 2.8.1.7)
fig|451516.9.peg.1802 Staphylococcus aureus subsp. aureus USA300_TCH1516 Cysteine desulfurase (EC 2.8.1.7)
fig|455227.3.peg.1058 Staphylococcus aureus D30 Cysteine desulfurase (EC 2.8.1.7)
fig|543539.3.peg.1478 Staphylococcus aureus subsp. aureus CGS01 Cysteine desulfurase (EC 2.8.1.7)
fig|546342.3.peg.934 Staphylococcus aureus subsp. aureus str. JKD6008 Cysteine desulfurase (EC 2.8.1.7)
fig|546342.4.peg.1774 Staphylococcus aureus subsp. aureus str. JKD6008 Cysteine desulfurase (EC 2.8.1.7)
fig|553567.3.peg.380 Staphylococcus aureus A5948 Cysteine desulfurase (EC 2.8.1.7)
fig|553590.4.peg.1937 Staphylococcus aureus A9754 Cysteine desulfurase (EC 2.8.1.7)
fig|553594.3.peg.1812 Staphylococcus aureus A9765 Cysteine desulfurase (EC 2.8.1.7)
fig|561307.5.peg.117 Staphylococcus aureus subsp. aureus RN4220 Cysteine desulfurase (EC 2.8.1.7)
fig|644279.4.peg.1861 Staphylococcus aureus subsp. aureus 132 Cysteine desulfurase (EC 2.8.1.7)
fig|663951.4.peg.1828 Staphylococcus aureus subsp. aureus TW20 Cysteine desulfurase (EC 2.8.1.7)
fig|754025.3.peg.43 Staphylococcus aureus subsp. aureus MRSA131 Cysteine desulfurase (EC 2.8.1.7)
fig|754026.3.peg.711 Staphylococcus aureus subsp. aureus MRSA177 Cysteine desulfurase (EC 2.8.1.7)
fig|862516.3.peg.1575 Staphylococcus aureus subsp. aureus ATCC BAA-39 Cysteine desulfurase (EC 2.8.1.7)
fig|904724.3.peg.2489 Staphylococcus aureus subsp. aureus 21178 Cysteine desulfurase (EC 2.8.1.7)
fig|904725.3.peg.1710 Staphylococcus aureus subsp. aureus 21189 Cysteine desulfurase (EC 2.8.1.7)
fig|904729.3.peg.616 Staphylococcus aureus subsp. aureus 21196 Cysteine desulfurase (EC 2.8.1.7)
fig|904735.3.peg.65 Staphylococcus aureus subsp. aureus 21209 Cysteine desulfurase (EC 2.8.1.7)
fig|904753.3.peg.2453 Staphylococcus aureus subsp. aureus 21282 Cysteine desulfurase (EC 2.8.1.7)
fig|904754.3.peg.1927 Staphylococcus aureus subsp. aureus 21283 Cysteine desulfurase (EC 2.8.1.7)
fig|904776.3.peg.2699 Staphylococcus aureus subsp. aureus IS-24 Cysteine desulfurase (EC 2.8.1.7)
fig|904777.3.peg.2376 Staphylococcus aureus subsp. aureus IS-55 Cysteine desulfurase (EC 2.8.1.7)
fig|904778.3.peg.817 Staphylococcus aureus subsp. aureus IS-88 Cysteine desulfurase (EC 2.8.1.7)
fig|904779.3.peg.2042 Staphylococcus aureus subsp. aureus IS-91 Cysteine desulfurase (EC 2.8.1.7)
fig|904782.3.peg.509 Staphylococcus aureus subsp. aureus IS-111 Cysteine desulfurase (EC 2.8.1.7)
fig|904784.3.peg.1716 Staphylococcus aureus subsp. aureus IS-125 Cysteine desulfurase (EC 2.8.1.7)
fig|904785.3.peg.878 Staphylococcus aureus subsp. aureus IS-157 Cysteine desulfurase (EC 2.8.1.7)
fig|904787.3.peg.1163 Staphylococcus aureus subsp. aureus IS-189 Cysteine desulfurase (EC 2.8.1.7)
fig|904795.7.peg.2642 Staphylococcus aureus subsp. aureus CO-23 Cysteine desulfurase (EC 2.8.1.7)
fig|908247.3.peg.203 Staphylococcus aureus 16K Cysteine desulfurase (EC 2.8.1.7)
fig|93061.5.peg.1664 Staphylococcus aureus subsp. aureus NCTC 8325 Cysteine desulfurase (EC 2.8.1.7)
fig|93062.19.peg.1723 Staphylococcus aureus subsp. aureus COL Cysteine desulfurase (EC 2.8.1.7)
fig|931442.3.peg.2338 Staphylococcus aureus subsp. aureus CIG547 Cysteine desulfurase (EC 2.8.1.7)
fig|931450.3.peg.2064 Staphylococcus aureus subsp. aureus CIG2018 Cysteine desulfurase (EC 2.8.1.7)
fig|931457.3.peg.2134 Staphylococcus aureus subsp. aureus CIGC345D Cysteine desulfurase (EC 2.8.1.7)