page	:SeedViewerServeFeature:
fid	:fig|426430.8.peg.1252:
show_prot_sequence	:1:

>fig|426430.8.peg.1252
MGQNDLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIR
RTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLSNPEQIQRYIQQLEDLE


PEGs with Identical Sequence
PEG Genome Function
fig|1006543.3.peg.1194 Staphylococcus aureus subsp. aureus T0131 Signal recognition particle associated protein
fig|1028799.3.peg.1065 Staphylococcus aureus subsp. aureus VC40 Signal recognition particle associated protein
fig|1074252.3.peg.1088 Staphylococcus aureus subsp. aureus HO 5096 0412 Signal recognition particle associated protein
fig|1075076.3.peg.1100 Staphylococcus aureus ST228/10388 Signal recognition particle associated protein
fig|1075077.3.peg.1104 Staphylococcus aureus ST228/10497 Signal recognition particle associated protein
fig|1075078.3.peg.1099 Staphylococcus aureus ST228/15532 Signal recognition particle associated protein
fig|1075079.3.peg.1096 Staphylococcus aureus ST228/16035 Signal recognition particle associated protein
fig|1075082.3.peg.1101 Staphylococcus aureus ST228/18412 Signal recognition particle associated protein
fig|1112349.3.peg.503 Staphylococcus aureus subsp. aureus NN50 Signal recognition particle associated protein
fig|1116214.3.peg.1105 Staphylococcus aureus subsp. aureus VRS1 Signal recognition particle associated protein
fig|1116215.3.peg.1161 Staphylococcus aureus subsp. aureus VRS2 Signal recognition particle associated protein
fig|1116216.3.peg.1072 Staphylococcus aureus subsp. aureus VRS3a Signal recognition particle associated protein
fig|1116217.3.peg.1135 Staphylococcus aureus subsp. aureus VRS4 Signal recognition particle associated protein
fig|1116218.3.peg.1112 Staphylococcus aureus subsp. aureus VRS5 Signal recognition particle associated protein
fig|1116219.3.peg.1061 Staphylococcus aureus subsp. aureus VRS6 Signal recognition particle associated protein
fig|1116220.3.peg.1181 Staphylococcus aureus subsp. aureus VRS7 Signal recognition particle associated protein
fig|1116221.3.peg.1088 Staphylococcus aureus subsp. aureus VRS8 Signal recognition particle associated protein
fig|1116222.3.peg.1126 Staphylococcus aureus subsp. aureus VRS9 Signal recognition particle associated protein
fig|1116223.3.peg.1128 Staphylococcus aureus subsp. aureus VRS10 Signal recognition particle associated protein
fig|1116224.3.peg.1185 Staphylococcus aureus subsp. aureus VRS11a Signal recognition particle associated protein
fig|1116225.3.peg.1154 Staphylococcus aureus subsp. aureus VRS11b Signal recognition particle associated protein
fig|1118959.3.peg.1145 Staphylococcus aureus subsp. aureus M013 Signal recognition particle associated protein
fig|1123523.3.peg.1171 Staphylococcus aureus subsp. aureus 11819-97 Signal recognition particle associated protein
fig|1134842.3.peg.519 Staphylococcus aureus subsp. aureus CM05 Signal recognition particle associated protein
fig|1137129.3.peg.1194 Staphylococcus aureus subsp. aureus 091751 Signal recognition particle associated protein
fig|1137130.3.peg.762 Staphylococcus aureus subsp. aureus 103564 Signal recognition particle associated protein
fig|1137132.3.peg.58 Staphylococcus aureus subsp. aureus 112808A Signal recognition particle associated protein
fig|1137133.3.peg.121 Staphylococcus aureus subsp. aureus MRGR3 Signal recognition particle associated protein
fig|1144271.3.peg.165 Staphylococcus aureus subsp. aureus 118 Signal recognition particle associated protein
fig|1144272.3.peg.1547 Staphylococcus aureus subsp. aureus GR1 Signal recognition particle associated protein
fig|1147034.3.peg.1361 Staphylococcus aureus PM1 Signal recognition particle associated protein
fig|1155079.3.peg.1870 Staphylococcus aureus subsp. aureus DR10 Signal recognition particle associated protein
fig|1155084.3.peg.1050 Staphylococcus aureus subsp. aureus 71193 Signal recognition particle associated protein
fig|1156994.3.peg.665 Staphylococcus aureus HI049 Signal recognition particle associated protein
fig|1156995.3.peg.1826 Staphylococcus aureus HI010 Signal recognition particle associated protein
fig|1156996.3.peg.666 Staphylococcus aureus HI049B Signal recognition particle associated protein
fig|1156997.3.peg.1182 Staphylococcus aureus HI010B Signal recognition particle associated protein
fig|1156998.3.peg.646 Staphylococcus aureus HIF003_B2N-C Signal recognition particle associated protein
fig|1156999.3.peg.1117 Staphylococcus aureus HI022 Signal recognition particle associated protein
fig|1157000.3.peg.1155 Staphylococcus aureus HI049C Signal recognition particle associated protein
fig|1157001.3.peg.1701 Staphylococcus aureus HI168 Signal recognition particle associated protein
fig|1157002.3.peg.875 Staphylococcus aureus HI111 Signal recognition particle associated protein
fig|1157003.3.peg.1728 Staphylococcus aureus HI013 Signal recognition particle associated protein
fig|1157004.3.peg.1887 Staphylococcus aureus M0001 Signal recognition particle associated protein
fig|1157005.3.peg.691 Staphylococcus aureus M0029 Signal recognition particle associated protein
fig|1157006.3.peg.699 Staphylococcus aureus M0035 Signal recognition particle associated protein
fig|1157007.3.peg.2261 Staphylococcus aureus M0045 Signal recognition particle associated protein
fig|1157008.3.peg.1762 Staphylococcus aureus M0060 Signal recognition particle associated protein
fig|1157009.3.peg.1720 Staphylococcus aureus M0066 Signal recognition particle associated protein
fig|1157010.3.peg.1074 Staphylococcus aureus M0102 Signal recognition particle associated protein
fig|1157011.3.peg.1741 Staphylococcus aureus M0103 Signal recognition particle associated protein
fig|1157012.3.peg.1986 Staphylococcus aureus M0150 Signal recognition particle associated protein
fig|1157013.3.peg.2027 Staphylococcus aureus M0173 Signal recognition particle associated protein
fig|1157014.3.peg.1128 Staphylococcus aureus M0192 Signal recognition particle associated protein
fig|1157015.3.peg.1917 Staphylococcus aureus M0197 Signal recognition particle associated protein
fig|1157016.3.peg.2041 Staphylococcus aureus M0221 Signal recognition particle associated protein
fig|1157017.3.peg.1297 Staphylococcus aureus M0237 Signal recognition particle associated protein
fig|1157018.3.peg.631 Staphylococcus aureus M0239 Signal recognition particle associated protein
fig|1157019.3.peg.2127 Staphylococcus aureus M0252 Signal recognition particle associated protein
fig|1157020.3.peg.708 Staphylococcus aureus M0326 Signal recognition particle associated protein
fig|1157021.3.peg.722 Staphylococcus aureus M0328 Signal recognition particle associated protein
fig|1157022.3.peg.1217 Staphylococcus aureus M0329 Signal recognition particle associated protein
fig|1157023.3.peg.1828 Staphylococcus aureus M0330 Signal recognition particle associated protein
fig|1157024.3.peg.1899 Staphylococcus aureus M0340 Signal recognition particle associated protein
fig|1157025.3.peg.1185 Staphylococcus aureus M0347 Signal recognition particle associated protein
fig|1157026.3.peg.1140 Staphylococcus aureus M0364 Signal recognition particle associated protein
fig|1157027.3.peg.1767 Staphylococcus aureus M0391 Signal recognition particle associated protein
fig|1157029.3.peg.1121 Staphylococcus aureus M0427 Signal recognition particle associated protein
fig|1157030.3.peg.1174 Staphylococcus aureus M0450 Signal recognition particle associated protein
fig|1157031.3.peg.331 Staphylococcus aureus M0467 Signal recognition particle associated protein
fig|1157032.3.peg.738 Staphylococcus aureus M0468 Signal recognition particle associated protein
fig|1157033.3.peg.1109 Staphylococcus aureus M0478 Signal recognition particle associated protein
fig|1157034.3.peg.1217 Staphylococcus aureus M0489 Signal recognition particle associated protein
fig|1157035.3.peg.625 Staphylococcus aureus M0494 Signal recognition particle associated protein
fig|1157036.3.peg.1139 Staphylococcus aureus B53639 Signal recognition particle associated protein
fig|1157037.3.peg.1145 Staphylococcus aureus B40723 Signal recognition particle associated protein
fig|1157038.3.peg.1124 Staphylococcus aureus B40950 Signal recognition particle associated protein
fig|1157039.3.peg.1156 Staphylococcus aureus B147830 Signal recognition particle associated protein
fig|1158461.3.peg.657 Staphylococcus aureus M0628 Signal recognition particle associated protein
fig|1158462.3.peg.1900 Staphylococcus aureus M0529 Signal recognition particle associated protein
fig|1158463.3.peg.1930 Staphylococcus aureus M1063 Signal recognition particle associated protein
fig|1158464.3.peg.726 Staphylococcus aureus M1076 Signal recognition particle associated protein
fig|1158465.3.peg.1770 Staphylococcus aureus M1064 Signal recognition particle associated protein
fig|1158466.3.peg.1838 Staphylococcus aureus M1092 Signal recognition particle associated protein
fig|1158467.3.peg.931 Staphylococcus aureus M1093 Signal recognition particle associated protein
fig|1158468.3.peg.1158 Staphylococcus aureus M1095 Signal recognition particle associated protein
fig|1158469.3.peg.1989 Staphylococcus aureus M1103 Signal recognition particle associated protein
fig|1158470.3.peg.1690 Staphylococcus aureus M1119 Signal recognition particle associated protein
fig|1158471.3.peg.1108 Staphylococcus aureus M1167 Signal recognition particle associated protein
fig|1158472.3.peg.1930 Staphylococcus aureus M1170 Signal recognition particle associated protein
fig|1158473.3.peg.692 Staphylococcus aureus M1188 Signal recognition particle associated protein
fig|1158474.3.peg.325 Staphylococcus aureus M1198 Signal recognition particle associated protein
fig|1158475.3.peg.2291 Staphylococcus aureus M1199 Signal recognition particle associated protein
fig|1158476.3.peg.326 Staphylococcus aureus M1215 Signal recognition particle associated protein
fig|1158477.3.peg.619 Staphylococcus aureus M1216 Signal recognition particle associated protein
fig|1158478.3.peg.326 Staphylococcus aureus M1229 Signal recognition particle associated protein
fig|1158479.3.peg.1109 Staphylococcus aureus M1248 Signal recognition particle associated protein
fig|1158480.3.peg.2073 Staphylococcus aureus M1253 Signal recognition particle associated protein
fig|1158481.3.peg.1183 Staphylococcus aureus M1255 Signal recognition particle associated protein
fig|1158482.3.peg.1126 Staphylococcus aureus M1257 Signal recognition particle associated protein
fig|1158483.3.peg.691 Staphylococcus aureus M1277 Signal recognition particle associated protein
fig|1158484.3.peg.1132 Staphylococcus aureus M1291 Signal recognition particle associated protein
fig|1158486.3.peg.727 Staphylococcus aureus M1320 Signal recognition particle associated protein
fig|1158487.3.peg.1208 Staphylococcus aureus M1321 Signal recognition particle associated protein
fig|1158488.3.peg.346 Staphylococcus aureus M1322 Signal recognition particle associated protein
fig|1158489.3.peg.2027 Staphylococcus aureus M1359 Signal recognition particle associated protein
fig|1158490.3.peg.693 Staphylococcus aureus M1367 Signal recognition particle associated protein
fig|1158491.3.peg.1663 Staphylococcus aureus M1373 Signal recognition particle associated protein
fig|1158492.3.peg.2018 Staphylococcus aureus M1394 Signal recognition particle associated protein
fig|1158493.3.peg.674 Staphylococcus aureus M1450 Signal recognition particle associated protein
fig|1158494.3.peg.1158 Staphylococcus aureus M1451 Signal recognition particle associated protein
fig|1158495.3.peg.1350 Staphylococcus aureus M1462 Signal recognition particle associated protein
fig|1158496.3.peg.929 Staphylococcus aureus M1463 Signal recognition particle associated protein
fig|1158497.3.peg.668 Staphylococcus aureus M1481 Signal recognition particle associated protein
fig|1158498.3.peg.1639 Staphylococcus aureus M1520 Signal recognition particle associated protein
fig|1158499.3.peg.747 Staphylococcus aureus M1521 Signal recognition particle associated protein
fig|1158500.3.peg.1004 Staphylococcus aureus M1531 Signal recognition particle associated protein
fig|1158501.3.peg.733 Staphylococcus aureus M1533 Signal recognition particle associated protein
fig|1158502.3.peg.1216 Staphylococcus aureus M1544 Signal recognition particle associated protein
fig|1158503.3.peg.1102 Staphylococcus aureus M1556 Signal recognition particle associated protein
fig|1158504.3.peg.1322 Staphylococcus aureus M1563 Signal recognition particle associated protein
fig|1158505.3.peg.2161 Staphylococcus aureus M1565 Signal recognition particle associated protein
fig|1158506.3.peg.1142 Staphylococcus aureus M1578 Signal recognition particle associated protein
fig|1158507.3.peg.2001 Staphylococcus aureus M0006 Signal recognition particle associated protein
fig|1158508.3.peg.1075 Staphylococcus aureus M0055 Signal recognition particle associated protein
fig|1158509.3.peg.1719 Staphylococcus aureus M0077 Signal recognition particle associated protein
fig|1158510.3.peg.1180 Staphylococcus aureus M0108 Signal recognition particle associated protein
fig|1158511.3.peg.1955 Staphylococcus aureus M0144 Signal recognition particle associated protein
fig|1158512.3.peg.1161 Staphylococcus aureus M0154 Signal recognition particle associated protein
fig|1158513.3.peg.745 Staphylococcus aureus M0177 Signal recognition particle associated protein
fig|1158514.3.peg.755 Staphylococcus aureus M0200 Signal recognition particle associated protein
fig|1158515.3.peg.1193 Staphylococcus aureus M0212 Signal recognition particle associated protein
fig|1158516.3.peg.702 Staphylococcus aureus M0216 Signal recognition particle associated protein
fig|1158517.3.peg.1719 Staphylococcus aureus M0235 Signal recognition particle associated protein
fig|1158518.3.peg.2120 Staphylococcus aureus M0250 Signal recognition particle associated protein
fig|1158520.3.peg.397 Staphylococcus aureus M0280 Signal recognition particle associated protein
fig|1158521.3.peg.1213 Staphylococcus aureus M0306 Signal recognition particle associated protein
fig|1158522.3.peg.1981 Staphylococcus aureus M0334 Signal recognition particle associated protein
fig|1158523.3.peg.1739 Staphylococcus aureus M0350 Signal recognition particle associated protein
fig|1158524.3.peg.1181 Staphylococcus aureus M0351 Signal recognition particle associated protein
fig|1158525.3.peg.1133 Staphylococcus aureus M0363 Signal recognition particle associated protein
fig|1158526.3.peg.2022 Staphylococcus aureus M0367 Signal recognition particle associated protein
fig|1158527.3.peg.322 Staphylococcus aureus M0374 Signal recognition particle associated protein
fig|1158528.3.peg.1734 Staphylococcus aureus M0375 Signal recognition particle associated protein
fig|1158529.3.peg.1297 Staphylococcus aureus M0396 Signal recognition particle associated protein
fig|1158530.3.peg.1795 Staphylococcus aureus M0424 Signal recognition particle associated protein
fig|1158531.3.peg.1126 Staphylococcus aureus M0438 Signal recognition particle associated protein
fig|1158533.3.peg.744 Staphylococcus aureus M0510 Signal recognition particle associated protein
fig|1158535.3.peg.1143 Staphylococcus aureus M0562 Signal recognition particle associated protein
fig|1158536.3.peg.2200 Staphylococcus aureus M0571 Signal recognition particle associated protein
fig|1158537.3.peg.1131 Staphylococcus aureus M0584 Signal recognition particle associated protein
fig|1158538.3.peg.1830 Staphylococcus aureus M0586 Signal recognition particle associated protein
fig|1158539.3.peg.1173 Staphylococcus aureus M0633 Signal recognition particle associated protein
fig|1158682.3.peg.1168 Staphylococcus aureus M0528 Signal recognition particle associated protein
fig|1158683.3.peg.648 Staphylococcus aureus M0531 Signal recognition particle associated protein
fig|1158684.3.peg.1176 Staphylococcus aureus M0536 Signal recognition particle associated protein
fig|1158685.3.peg.1975 Staphylococcus aureus M0539 Signal recognition particle associated protein
fig|1158686.3.peg.1971 Staphylococcus aureus M0547 Signal recognition particle associated protein
fig|1158687.3.peg.1124 Staphylococcus aureus M0565 Signal recognition particle associated protein
fig|1158688.3.peg.322 Staphylococcus aureus M0580 Signal recognition particle associated protein
fig|1158689.3.peg.695 Staphylococcus aureus M0602 Signal recognition particle associated protein
fig|1158690.3.peg.1122 Staphylococcus aureus M0622 Signal recognition particle associated protein
fig|1158691.3.peg.1142 Staphylococcus aureus M0676 Signal recognition particle associated protein
fig|1158692.3.peg.949 Staphylococcus aureus M0687 Signal recognition particle associated protein
fig|1158693.3.peg.1749 Staphylococcus aureus M0692 Signal recognition particle associated protein
fig|1158694.3.peg.1825 Staphylococcus aureus M0719 Signal recognition particle associated protein
fig|1158695.3.peg.1111 Staphylococcus aureus M0769 Signal recognition particle associated protein
fig|1158696.3.peg.2259 Staphylococcus aureus M0770 Signal recognition particle associated protein
fig|1158697.3.peg.1107 Staphylococcus aureus M0780 Signal recognition particle associated protein
fig|1158698.3.peg.1971 Staphylococcus aureus M0799 Signal recognition particle associated protein
fig|1158699.3.peg.1152 Staphylococcus aureus M0823 Signal recognition particle associated protein
fig|1158700.3.peg.1821 Staphylococcus aureus M0844 Signal recognition particle associated protein
fig|1158701.3.peg.2177 Staphylococcus aureus M0934 Signal recognition particle associated protein
fig|1158702.3.peg.1104 Staphylococcus aureus M0943 Signal recognition particle associated protein
fig|1158703.3.peg.1026 Staphylococcus aureus M0944 Signal recognition particle associated protein
fig|1158704.3.peg.743 Staphylococcus aureus M0953 Signal recognition particle associated protein
fig|1158705.3.peg.731 Staphylococcus aureus M0998 Signal recognition particle associated protein
fig|1158706.3.peg.1145 Staphylococcus aureus M0999 Signal recognition particle associated protein
fig|1158707.3.peg.1792 Staphylococcus aureus M1007 Signal recognition particle associated protein
fig|1158708.3.peg.735 Staphylococcus aureus M1010 Signal recognition particle associated protein
fig|1158709.3.peg.1277 Staphylococcus aureus M1015 Signal recognition particle associated protein
fig|1158710.3.peg.766 Staphylococcus aureus M1016 Signal recognition particle associated protein
fig|1158711.3.peg.778 Staphylococcus aureus M1036 Signal recognition particle associated protein
fig|1158712.3.peg.1105 Staphylococcus aureus M1037 Signal recognition particle associated protein
fig|1161392.3.peg.486 Staphylococcus aureus NN54 Signal recognition particle associated protein
fig|1169256.3.peg.1131 Staphylococcus aureus M0964 Signal recognition particle associated protein
fig|1169257.3.peg.793 Staphylococcus aureus M0978 Signal recognition particle associated protein
fig|1169258.3.peg.694 Staphylococcus aureus M0994 Signal recognition particle associated protein
fig|1169260.3.peg.1146 Staphylococcus aureus M1044 Signal recognition particle associated protein
fig|1169261.3.peg.1777 Staphylococcus aureus M1061 Signal recognition particle associated protein
fig|1169262.3.peg.1112 Staphylococcus aureus M1062 Signal recognition particle associated protein
fig|1169263.3.peg.1106 Staphylococcus aureus M1068 Signal recognition particle associated protein
fig|1169264.3.peg.1091 Staphylococcus aureus M1083 Signal recognition particle associated protein
fig|1169265.3.peg.1901 Staphylococcus aureus M1109 Signal recognition particle associated protein
fig|1169266.3.peg.1072 Staphylococcus aureus M1126 Signal recognition particle associated protein
fig|1169267.3.peg.682 Staphylococcus aureus M1142 Signal recognition particle associated protein
fig|1169268.3.peg.1772 Staphylococcus aureus M1223 Signal recognition particle associated protein
fig|1169269.3.peg.1123 Staphylococcus aureus M1224 Signal recognition particle associated protein
fig|1169270.3.peg.1210 Staphylococcus aureus M1244 Signal recognition particle associated protein
fig|1169272.3.peg.1183 Staphylococcus aureus M1275 Signal recognition particle associated protein
fig|1169273.3.peg.1122 Staphylococcus aureus M1286 Signal recognition particle associated protein
fig|1169274.3.peg.1148 Staphylococcus aureus M1309 Signal recognition particle associated protein
fig|1169275.3.peg.1106 Staphylococcus aureus M1374 Signal recognition particle associated protein
fig|1169276.3.peg.1109 Staphylococcus aureus M1405 Signal recognition particle associated protein
fig|1169277.3.peg.1161 Staphylococcus aureus M1510 Signal recognition particle associated protein
fig|1213721.3.peg.1837 Staphylococcus aureus M0648 Signal recognition particle associated protein
fig|1213722.3.peg.1748 Staphylococcus aureus M0660 Signal recognition particle associated protein
fig|1213723.3.peg.1132 Staphylococcus aureus M0663 Signal recognition particle associated protein
fig|1213724.3.peg.1128 Staphylococcus aureus M0673 Signal recognition particle associated protein
fig|1213725.3.peg.1131 Staphylococcus aureus M0695 Signal recognition particle associated protein
fig|1213726.3.peg.1160 Staphylococcus aureus M0792 Signal recognition particle associated protein
fig|1213727.3.peg.1107 Staphylococcus aureus M0822 Signal recognition particle associated protein
fig|1213728.3.peg.724 Staphylococcus aureus M0831 Signal recognition particle associated protein
fig|1213729.3.peg.1098 Staphylococcus aureus M0871 Signal recognition particle associated protein
fig|1213732.3.peg.1200 Staphylococcus aureus M0892 Signal recognition particle associated protein
fig|1213733.3.peg.1148 Staphylococcus aureus M0900 Signal recognition particle associated protein
fig|1213734.3.peg.1111 Staphylococcus aureus M0927 Signal recognition particle associated protein
fig|1214901.3.peg.2189 Staphylococcus aureus M0646 Signal recognition particle associated protein
fig|1216363.3.peg.1242 Staphylococcus aureus subsp. aureus 06BA18369 Signal recognition particle associated protein
fig|1221451.3.peg.102 Staphylococcus aureus subsp. aureus 120 Signal recognition particle associated protein
fig|1221452.3.peg.556 Staphylococcus aureus subsp. aureus 333 Signal recognition particle associated protein
fig|1221453.3.peg.2308 Staphylococcus aureus subsp. aureus 3989 Signal recognition particle associated protein
fig|1224919.3.peg.1870 Staphylococcus aureus M0104 Signal recognition particle associated protein
fig|1224920.3.peg.1756 Staphylococcus aureus M0171 Signal recognition particle associated protein
fig|1224921.3.peg.123 Staphylococcus aureus M0210 Signal recognition particle associated protein
fig|1224922.3.peg.2023 Staphylococcus aureus M0213 Signal recognition particle associated protein
fig|1224923.3.peg.1132 Staphylococcus aureus M0240 Signal recognition particle associated protein
fig|1224924.3.peg.1725 Staphylococcus aureus M0270 Signal recognition particle associated protein
fig|1224925.3.peg.2050 Staphylococcus aureus M0273 Signal recognition particle associated protein
fig|1224926.3.peg.698 Staphylococcus aureus M0279 Signal recognition particle associated protein
fig|1224927.3.peg.712 Staphylococcus aureus M0288 Signal recognition particle associated protein
fig|1224928.3.peg.749 Staphylococcus aureus M0312 Signal recognition particle associated protein
fig|1224929.3.peg.901 Staphylococcus aureus M0404 Signal recognition particle associated protein
fig|1224930.3.peg.1897 Staphylococcus aureus M0415 Signal recognition particle associated protein
fig|1224931.3.peg.724 Staphylococcus aureus M0455 Signal recognition particle associated protein
fig|1224932.3.peg.668 Staphylococcus aureus M0460 Signal recognition particle associated protein
fig|1224933.3.peg.2022 Staphylococcus aureus M0493 Signal recognition particle associated protein
fig|1226740.3.peg.2362 Staphylococcus aureus subsp. aureus VH60 Signal recognition particle associated protein
fig|1229492.3.peg.1195 Staphylococcus aureus 08BA02176 Signal recognition particle associated protein
fig|1231382.3.peg.1289 Staphylococcus aureus KT/Y21 Signal recognition particle associated protein
fig|1231383.3.peg.2218 Staphylococcus aureus KT/314250 Signal recognition particle associated protein
fig|1235275.3.peg.1258 Staphylococcus aureus PPUKM-261-2009 Signal recognition particle associated protein
fig|1235276.3.peg.1278 Staphylococcus aureus PPUKM-332-2009 Signal recognition particle associated protein
fig|1235277.3.peg.1196 Staphylococcus aureus PPUKM-377-2009 Signal recognition particle associated protein
fig|1235278.3.peg.1154 Staphylococcus aureus PPUKM-775-2009 Signal recognition particle associated protein
fig|1241616.3.peg.696 Staphylococcus aureus subsp. aureus DSM 20231 Signal recognition particle associated protein
fig|1242970.3.peg.1171 Staphylococcus aureus CN79 Signal recognition particle associated protein
fig|1258575.3.peg.818 Staphylococcus aureus subsp. aureus H29 Signal recognition particle associated protein
fig|1265302.3.peg.2502 Staphylococcus aureus subsp. aureus PB32 Signal recognition particle associated protein
fig|1278071.4.peg.1804 Staphylococcus aureus 3957 Signal recognition particle associated protein
fig|1278072.4.peg.1791 Staphylococcus aureus LVP2 Signal recognition particle associated protein
fig|1278074.4.peg.1082 Staphylococcus aureus VH221 Signal recognition particle associated protein
fig|1278075.4.peg.1350 Staphylococcus aureus LVP5 Signal recognition particle associated protein
fig|1283278.3.peg.1091 Staphylococcus aureus KLT6 Signal recognition particle associated protein
fig|1288493.3.peg.644 Staphylococcus aureus subsp. aureus S1800 Signal recognition particle associated protein
fig|1303780.3.peg.328 Staphylococcus aureus M0075 Signal recognition particle associated protein
fig|1303781.3.peg.1965 Staphylococcus aureus M0294 Signal recognition particle associated protein
fig|1303782.3.peg.1853 Staphylococcus aureus M1060 Signal recognition particle associated protein
fig|1303783.3.peg.644 Staphylococcus aureus M1078 Signal recognition particle associated protein
fig|1303784.3.peg.2018 Staphylococcus aureus M1193 Signal recognition particle associated protein
fig|1303785.3.peg.1750 Staphylococcus aureus M1228 Signal recognition particle associated protein
fig|1303786.3.peg.1807 Staphylococcus aureus M1407 Signal recognition particle associated protein
fig|1303787.3.peg.1150 Staphylococcus aureus M1466 Signal recognition particle associated protein
fig|1305598.3.peg.1127 Staphylococcus aureus M1 Signal recognition particle associated protein
fig|1331008.3.peg.1040 Staphylococcus aureus subsp. aureus CBD-635 Signal recognition particle associated protein
fig|158878.1.peg.1236 Staphylococcus aureus subsp. aureus Mu50 Signal recognition particle associated protein
fig|158878.14.peg.1270 Staphylococcus aureus subsp. aureus Mu50 Signal recognition particle associated protein
fig|158879.1.peg.1114 Staphylococcus aureus subsp. aureus N315 Signal recognition particle associated protein
fig|158879.11.peg.1158 Staphylococcus aureus subsp. aureus N315 Signal recognition particle associated protein
fig|196620.1.peg.1119 Staphylococcus aureus subsp. aureus MW2 Signal recognition particle associated protein
fig|196620.5.peg.1174 Staphylococcus aureus subsp. aureus MW2 Signal recognition particle associated protein
fig|273036.3.peg.1380 Staphylococcus aureus RF122 Signal recognition particle associated protein
fig|273036.6.peg.1168 Staphylococcus aureus RF122 Signal recognition particle associated protein
fig|282459.1.peg.1163 Staphylococcus aureus subsp. aureus MSSA476 Signal recognition particle associated protein
fig|282459.5.peg.1216 Staphylococcus aureus subsp. aureus MSSA476 Signal recognition particle associated protein
fig|359786.13.peg.1375 Staphylococcus aureus subsp. aureus JH9 Signal recognition particle associated protein
fig|359786.3.peg.958 Staphylococcus aureus subsp. aureus JH9 Signal recognition particle associated protein
fig|359787.3.peg.216 Staphylococcus aureus subsp. aureus JH1 Signal recognition particle associated protein
fig|367830.3.peg.469 Staphylococcus aureus subsp. aureus USA300 Signal recognition particle associated protein
fig|418127.4.peg.1132 Staphylococcus aureus subsp. aureus Mu3 Signal recognition particle associated protein
fig|426430.6.peg.1111 Staphylococcus aureus subsp. aureus str. Newman Signal recognition particle associated protein
fig|426430.8.peg.1252 Staphylococcus aureus subsp. aureus str. Newman Signal recognition particle associated protein
fig|450394.6.peg.468 Staphylococcus aureus subsp. aureus USA300_TCH959 Signal recognition particle associated protein
fig|451515.3.peg.1240 Staphylococcus aureus subsp. aureus USA300_FPR3757 Signal recognition particle associated protein
fig|451516.9.peg.1244 Staphylococcus aureus subsp. aureus USA300_TCH1516 Signal recognition particle associated protein
fig|452948.4.peg.900 Staphylococcus aureus 930918-3 Signal recognition particle associated protein
fig|455227.3.peg.121 Staphylococcus aureus D30 Signal recognition particle associated protein
fig|505321.3.peg.1094 Staphylococcus aureus subsp. aureus str. CF-Marseille Signal recognition particle associated protein
fig|543539.3.peg.248 Staphylococcus aureus subsp. aureus CGS01 Signal recognition particle associated protein
fig|543540.3.peg.76 Staphylococcus aureus subsp. aureus CGS03 Signal recognition particle associated protein
fig|546342.3.peg.1184 Staphylococcus aureus subsp. aureus str. JKD6008 Signal recognition particle associated protein
fig|546342.4.peg.1258 Staphylococcus aureus subsp. aureus str. JKD6008 Signal recognition particle associated protein
fig|546343.3.peg.2082 Staphylococcus aureus subsp. aureus str. JKD6009 Signal recognition particle associated protein
fig|548474.3.peg.1076 Staphylococcus aureus subsp. aureus TCH130 Signal recognition particle associated protein
fig|548475.3.peg.150 Staphylococcus aureus subsp. aureus TCH70 Signal recognition particle associated protein
fig|553565.3.peg.1563 Staphylococcus aureus A5937 Signal recognition particle associated protein
fig|553567.3.peg.2042 Staphylococcus aureus A5948 Signal recognition particle associated protein
fig|553568.3.peg.1757 Staphylococcus aureus A6224 Signal recognition particle associated protein
fig|553571.3.peg.2645 Staphylococcus aureus A6300 Signal recognition particle associated protein
fig|553573.3.peg.2433 Staphylococcus aureus A8115 Signal recognition particle associated protein
fig|553577.3.peg.1999 Staphylococcus aureus A8796 Signal recognition particle associated protein
fig|553580.3.peg.2314 Staphylococcus aureus A8819 Signal recognition particle associated protein
fig|553581.3.peg.962 Staphylococcus aureus A9299 Signal recognition particle associated protein
fig|553588.3.peg.10 Staphylococcus aureus A9719 Signal recognition particle associated protein
fig|553590.4.peg.287 Staphylococcus aureus A9754 Signal recognition particle associated protein
fig|553592.3.peg.2261 Staphylococcus aureus A9763 Signal recognition particle associated protein
fig|553594.3.peg.152 Staphylococcus aureus A9765 Signal recognition particle associated protein
fig|553601.3.peg.1158 Staphylococcus aureus A10102 Signal recognition particle associated protein
fig|561307.5.peg.199 Staphylococcus aureus subsp. aureus RN4220 Signal recognition particle associated protein
fig|585152.3.peg.1088 Staphylococcus aureus subsp. aureus D139 Signal recognition particle associated protein
fig|585155.3.peg.1416 Staphylococcus aureus subsp. aureus H19 Signal recognition particle associated protein
fig|585891.3.peg.1267 Staphylococcus aureus subsp. aureus Mu50-omega Signal recognition particle associated protein
fig|644279.4.peg.1250 Staphylococcus aureus subsp. aureus 132 Signal recognition particle associated protein
fig|663951.4.peg.1311 Staphylococcus aureus subsp. aureus TW20 Signal recognition particle associated protein
fig|680649.3.peg.112 Staphylococcus aureus subsp. aureus MR1 Signal recognition particle associated protein
fig|681288.4.peg.1213 Staphylococcus aureus subsp. aureus ED98 Signal recognition particle associated protein
fig|703339.3.peg.1211 Staphylococcus aureus 04-02981 Signal recognition particle associated protein
fig|754025.3.peg.529 Staphylococcus aureus subsp. aureus MRSA131 Signal recognition particle associated protein
fig|754026.3.peg.210 Staphylococcus aureus subsp. aureus MRSA177 Signal recognition particle associated protein
fig|762962.3.peg.822 Staphylococcus aureus subsp. aureus ATCC 51811 Signal recognition particle associated protein
fig|862516.3.peg.2081 Staphylococcus aureus subsp. aureus ATCC BAA-39 Signal recognition particle associated protein
fig|869816.3.peg.1150 Staphylococcus aureus subsp. aureus JKD6159 Signal recognition particle associated protein
fig|889933.4.peg.1071 Staphylococcus aureus subsp. aureus ECT-R 2 Signal recognition particle associated protein
fig|904313.3.peg.1786 Staphylococcus aureus subsp. aureus VCU006 Signal recognition particle associated protein
fig|904723.3.peg.371 Staphylococcus aureus subsp. aureus 21172 Signal recognition particle associated protein
fig|904724.3.peg.2639 Staphylococcus aureus subsp. aureus 21178 Signal recognition particle associated protein
fig|904725.3.peg.2207 Staphylococcus aureus subsp. aureus 21189 Signal recognition particle associated protein
fig|904726.3.peg.241 Staphylococcus aureus subsp. aureus 21193 Signal recognition particle associated protein
fig|904729.3.peg.1607 Staphylococcus aureus subsp. aureus 21196 Signal recognition particle associated protein
fig|904731.3.peg.79 Staphylococcus aureus subsp. aureus 21201 Signal recognition particle associated protein
fig|904735.3.peg.1910 Staphylococcus aureus subsp. aureus 21209 Signal recognition particle associated protein
fig|904737.3.peg.440 Staphylococcus aureus subsp. aureus 21232 Signal recognition particle associated protein
fig|904738.3.peg.1287 Staphylococcus aureus subsp. aureus 21235 Signal recognition particle associated protein
fig|904739.3.peg.1595 Staphylococcus aureus subsp. aureus 21236 Signal recognition particle associated protein
fig|904744.3.peg.2301 Staphylococcus aureus subsp. aureus 21259 Signal recognition particle associated protein
fig|904745.3.peg.130 Staphylococcus aureus subsp. aureus 21262 Signal recognition particle associated protein
fig|904747.3.peg.1327 Staphylococcus aureus subsp. aureus 21266 Signal recognition particle associated protein
fig|904749.3.peg.537 Staphylococcus aureus subsp. aureus 21269 Signal recognition particle associated protein
fig|904750.3.peg.2319 Staphylococcus aureus subsp. aureus 21272 Signal recognition particle associated protein
fig|904753.3.peg.184 Staphylococcus aureus subsp. aureus 21282 Signal recognition particle associated protein
fig|904754.3.peg.1403 Staphylococcus aureus subsp. aureus 21283 Signal recognition particle associated protein
fig|904759.3.peg.2121 Staphylococcus aureus subsp. aureus 21305 Signal recognition particle associated protein
fig|904760.3.peg.88 Staphylococcus aureus subsp. aureus 21310 Signal recognition particle associated protein
fig|904763.3.peg.2088 Staphylococcus aureus subsp. aureus 21318 Signal recognition particle associated protein
fig|904766.3.peg.268 Staphylococcus aureus subsp. aureus 21331 Signal recognition particle associated protein
fig|904767.3.peg.157 Staphylococcus aureus subsp. aureus 21333 Signal recognition particle associated protein
fig|904768.3.peg.780 Staphylococcus aureus subsp. aureus 21334 Signal recognition particle associated protein
fig|904771.3.peg.1451 Staphylococcus aureus subsp. aureus 21340 Signal recognition particle associated protein
fig|904775.3.peg.464 Staphylococcus aureus subsp. aureus IS-3 Signal recognition particle associated protein
fig|904776.3.peg.2100 Staphylococcus aureus subsp. aureus IS-24 Signal recognition particle associated protein
fig|904777.3.peg.2318 Staphylococcus aureus subsp. aureus IS-55 Signal recognition particle associated protein
fig|904778.3.peg.1262 Staphylococcus aureus subsp. aureus IS-88 Signal recognition particle associated protein
fig|904779.3.peg.300 Staphylococcus aureus subsp. aureus IS-91 Signal recognition particle associated protein
fig|904780.3.peg.2659 Staphylococcus aureus subsp. aureus IS-99 Signal recognition particle associated protein
fig|904781.3.peg.429 Staphylococcus aureus subsp. aureus IS-105 Signal recognition particle associated protein
fig|904782.3.peg.1079 Staphylococcus aureus subsp. aureus IS-111 Signal recognition particle associated protein
fig|904783.3.peg.696 Staphylococcus aureus subsp. aureus IS-122 Signal recognition particle associated protein
fig|904784.3.peg.2714 Staphylococcus aureus subsp. aureus IS-125 Signal recognition particle associated protein
fig|904785.3.peg.390 Staphylococcus aureus subsp. aureus IS-157 Signal recognition particle associated protein
fig|904786.3.peg.801 Staphylococcus aureus subsp. aureus IS-160 Signal recognition particle associated protein
fig|904787.3.peg.2716 Staphylococcus aureus subsp. aureus IS-189 Signal recognition particle associated protein
fig|904792.3.peg.1405 Staphylococcus aureus subsp. aureus IS-M Signal recognition particle associated protein
fig|904795.7.peg.1455 Staphylococcus aureus subsp. aureus CO-23 Signal recognition particle associated protein
fig|908247.3.peg.1777 Staphylococcus aureus 16K Signal recognition particle associated protein
fig|93061.3.peg.1153 Staphylococcus aureus subsp. aureus NCTC 8325 Signal recognition particle associated protein
fig|93061.5.peg.1106 Staphylococcus aureus subsp. aureus NCTC 8325 Signal recognition particle associated protein
fig|93062.4.peg.1676 Staphylococcus aureus subsp. aureus COL Signal recognition particle associated protein
fig|931432.3.peg.1970 Staphylococcus aureus subsp. aureus CIG1057 Signal recognition particle associated protein
fig|931433.3.peg.1722 Staphylococcus aureus subsp. aureus CIG1114 Signal recognition particle associated protein
fig|931434.3.peg.1699 Staphylococcus aureus subsp. aureus CIG1165 Signal recognition particle associated protein
fig|931439.3.peg.1694 Staphylococcus aureus subsp. aureus CIG1750 Signal recognition particle associated protein
fig|931440.3.peg.1837 Staphylococcus aureus subsp. aureus CIG1769 Signal recognition particle associated protein
fig|931441.3.peg.1316 Staphylococcus aureus subsp. aureus CIG1835 Signal recognition particle associated protein
fig|931442.3.peg.1841 Staphylococcus aureus subsp. aureus CIG547 Signal recognition particle associated protein
fig|931443.3.peg.1714 Staphylococcus aureus subsp. aureus CIG1096 Signal recognition particle associated protein
fig|931444.3.peg.1742 Staphylococcus aureus subsp. aureus CIG1150 Signal recognition particle associated protein
fig|931446.3.peg.1732 Staphylococcus aureus subsp. aureus CIG1213 Signal recognition particle associated protein
fig|931448.3.peg.1751 Staphylococcus aureus subsp. aureus CIG1612 Signal recognition particle associated protein
fig|931449.3.peg.1727 Staphylococcus aureus subsp. aureus CIG1770 Signal recognition particle associated protein
fig|931450.3.peg.1566 Staphylococcus aureus subsp. aureus CIG2018 Signal recognition particle associated protein
fig|931455.3.peg.1619 Staphylococcus aureus subsp. aureus CIGC340D Signal recognition particle associated protein
fig|931457.3.peg.1652 Staphylococcus aureus subsp. aureus CIGC345D Signal recognition particle associated protein
fig|931458.3.peg.2053 Staphylococcus aureus subsp. aureus CIGC348 Signal recognition particle associated protein
fig|931459.3.peg.1652 Staphylococcus aureus subsp. aureus CIGC128 Signal recognition particle associated protein
fig|931460.3.peg.1279 Staphylococcus aureus subsp. aureus CIGC93 Signal recognition particle associated protein
fig|985006.4.peg.1154 Staphylococcus aureus subsp. aureus LGA251 Signal recognition particle associated protein