page	:SeedViewerServeFeature:
fid	:fig|158879.11.peg.622:
show_prot_sequence	:1:

>fig|158879.11.peg.622
MNYLSNFFNTTIQLNIYIIVIVAACYIAIHQYRHKPVLNYLDVILNYIPVLTHEFGHVLF
NKLAGGRAKDLVIVTSPRERQQTLQQGFAITQSRHLAGQWLTTIGGYLMPPIMLLIGLAS
SHYQIPSFFIFTYLLIFIYFLILTSRKGSPIVVITLISIMLYFILKDENIVEIQLLVTMS
YQYILGVLLGEVLQSSWTIAKLTFQRPSPQWDGSALKELSHVPIFIYSTIWIIFNLYAVN
ILLKYTHLIN


PEGs with Identical Sequence
PEG Genome Function
fig|1075076.3.peg.585 Staphylococcus aureus ST228/10388 FIG01108264: hypothetical protein
fig|1075077.3.peg.589 Staphylococcus aureus ST228/10497 FIG01108264: hypothetical protein
fig|1075078.3.peg.584 Staphylococcus aureus ST228/15532 FIG01108264: hypothetical protein
fig|1075079.3.peg.581 Staphylococcus aureus ST228/16035 FIG01108264: hypothetical protein
fig|1075082.3.peg.585 Staphylococcus aureus ST228/18412 FIG01108264: hypothetical protein
fig|1116214.3.peg.527 Staphylococcus aureus subsp. aureus VRS1 FIG01108264: hypothetical protein
fig|1116215.3.peg.559 Staphylococcus aureus subsp. aureus VRS2 FIG01108264: hypothetical protein
fig|1116216.3.peg.552 Staphylococcus aureus subsp. aureus VRS3a FIG01108264: hypothetical protein
fig|1116217.3.peg.562 Staphylococcus aureus subsp. aureus VRS4 FIG01108264: hypothetical protein
fig|1116218.3.peg.567 Staphylococcus aureus subsp. aureus VRS5 FIG01108264: hypothetical protein
fig|1116220.3.peg.596 Staphylococcus aureus subsp. aureus VRS7 FIG01108264: hypothetical protein
fig|1116221.3.peg.569 Staphylococcus aureus subsp. aureus VRS8 FIG01108264: hypothetical protein
fig|1116222.3.peg.592 Staphylococcus aureus subsp. aureus VRS9 FIG01108264: hypothetical protein
fig|1116223.3.peg.596 Staphylococcus aureus subsp. aureus VRS10 FIG01108264: hypothetical protein
fig|1116224.3.peg.616 Staphylococcus aureus subsp. aureus VRS11a FIG01108264: hypothetical protein
fig|1116225.3.peg.616 Staphylococcus aureus subsp. aureus VRS11b FIG01108264: hypothetical protein
fig|1134842.3.peg.191 Staphylococcus aureus subsp. aureus CM05 FIG01108264: hypothetical protein
fig|1137129.3.peg.1519 Staphylococcus aureus subsp. aureus 091751 FIG01108264: hypothetical protein
fig|1157004.3.peg.1263 Staphylococcus aureus M0001 FIG01108264: hypothetical protein
fig|1157005.3.peg.119 Staphylococcus aureus M0029 FIG01108264: hypothetical protein
fig|1157006.3.peg.123 Staphylococcus aureus M0035 FIG01108264: hypothetical protein
fig|1157007.3.peg.1640 Staphylococcus aureus M0045 FIG01108264: hypothetical protein
fig|1157008.3.peg.1160 Staphylococcus aureus M0060 FIG01108264: hypothetical protein
fig|1157010.3.peg.544 Staphylococcus aureus M0102 FIG01108264: hypothetical protein
fig|1157011.3.peg.1156 Staphylococcus aureus M0103 FIG01108264: hypothetical protein
fig|1157012.3.peg.1406 Staphylococcus aureus M0150 FIG01108264: hypothetical protein
fig|1157013.3.peg.1471 Staphylococcus aureus M0173 FIG01108264: hypothetical protein
fig|1157014.3.peg.553 Staphylococcus aureus M0192 FIG01108264: hypothetical protein
fig|1157015.3.peg.1314 Staphylococcus aureus M0197 FIG01108264: hypothetical protein
fig|1157017.3.peg.625 Staphylococcus aureus M0237 FIG01108264: hypothetical protein
fig|1157018.3.peg.124 Staphylococcus aureus M0239 FIG01108264: hypothetical protein
fig|1157019.3.peg.1557 Staphylococcus aureus M0252 FIG01108264: hypothetical protein
fig|1157020.3.peg.123 Staphylococcus aureus M0326 FIG01108264: hypothetical protein
fig|1157021.3.peg.118 Staphylococcus aureus M0328 FIG01108264: hypothetical protein
fig|1157022.3.peg.579 Staphylococcus aureus M0329 FIG01108264: hypothetical protein
fig|1157023.3.peg.1253 Staphylococcus aureus M0330 FIG01108264: hypothetical protein
fig|1157026.3.peg.564 Staphylococcus aureus M0364 FIG01108264: hypothetical protein
fig|1157027.3.peg.1144 Staphylococcus aureus M0391 FIG01108264: hypothetical protein
fig|1157029.3.peg.547 Staphylococcus aureus M0427 FIG01108264: hypothetical protein
fig|1157030.3.peg.545 Staphylococcus aureus M0450 FIG01108264: hypothetical protein
fig|1157031.3.peg.2415 Staphylococcus aureus M0467 FIG01108264: hypothetical protein
fig|1157033.3.peg.508 Staphylococcus aureus M0478 FIG01108264: hypothetical protein
fig|1157034.3.peg.651 Staphylococcus aureus M0489 FIG01108264: hypothetical protein
fig|1157035.3.peg.120 Staphylococcus aureus M0494 FIG01108264: hypothetical protein
fig|1157036.3.peg.563 Staphylococcus aureus B53639 FIG01108264: hypothetical protein
fig|1157037.3.peg.569 Staphylococcus aureus B40723 FIG01108264: hypothetical protein
fig|1157038.3.peg.549 Staphylococcus aureus B40950 FIG01108264: hypothetical protein
fig|1157039.3.peg.517 Staphylococcus aureus B147830 FIG01108264: hypothetical protein
fig|1158461.3.peg.153 Staphylococcus aureus M0628 FIG01108264: hypothetical protein
fig|1158462.3.peg.1310 Staphylococcus aureus M0529 FIG01108264: hypothetical protein
fig|1158463.3.peg.1341 Staphylococcus aureus M1063 FIG01108264: hypothetical protein
fig|1158464.3.peg.157 Staphylococcus aureus M1076 FIG01108264: hypothetical protein
fig|1158466.3.peg.1249 Staphylococcus aureus M1092 FIG01108264: hypothetical protein
fig|1158467.3.peg.340 Staphylococcus aureus M1093 FIG01108264: hypothetical protein
fig|1158469.3.peg.1394 Staphylococcus aureus M1103 FIG01108264: hypothetical protein
fig|1158470.3.peg.1102 Staphylococcus aureus M1119 FIG01108264: hypothetical protein
fig|1158471.3.peg.555 Staphylococcus aureus M1167 FIG01108264: hypothetical protein
fig|1158472.3.peg.1424 Staphylococcus aureus M1170 FIG01108264: hypothetical protein
fig|1158473.3.peg.118 Staphylococcus aureus M1188 FIG01108264: hypothetical protein
fig|1158474.3.peg.2432 Staphylococcus aureus M1198 FIG01108264: hypothetical protein
fig|1158475.3.peg.1686 Staphylococcus aureus M1199 FIG01108264: hypothetical protein
fig|1158476.3.peg.2437 Staphylococcus aureus M1215 FIG01108264: hypothetical protein
fig|1158477.3.peg.117 Staphylococcus aureus M1216 FIG01108264: hypothetical protein
fig|1158478.3.peg.2404 Staphylococcus aureus M1229 FIG01108264: hypothetical protein
fig|1158479.3.peg.557 Staphylococcus aureus M1248 FIG01108264: hypothetical protein
fig|1158480.3.peg.1433 Staphylococcus aureus M1253 FIG01108264: hypothetical protein
fig|1158481.3.peg.553 Staphylococcus aureus M1255 FIG01108264: hypothetical protein
fig|1158482.3.peg.553 Staphylococcus aureus M1257 FIG01108264: hypothetical protein
fig|1158483.3.peg.118 Staphylococcus aureus M1277 FIG01108264: hypothetical protein
fig|1158484.3.peg.555 Staphylococcus aureus M1291 FIG01108264: hypothetical protein
fig|1158486.3.peg.155 Staphylococcus aureus M1320 hypothetical protein
fig|1158487.3.peg.561 Staphylococcus aureus M1321 FIG01108264: hypothetical protein
fig|1158488.3.peg.2405 Staphylococcus aureus M1322 FIG01108264: hypothetical protein
fig|1158489.3.peg.1441 Staphylococcus aureus M1359 FIG01108264: hypothetical protein
fig|1158490.3.peg.122 Staphylococcus aureus M1367 FIG01108264: hypothetical protein
fig|1158491.3.peg.1092 Staphylococcus aureus M1373 FIG01108264: hypothetical protein
fig|1158492.3.peg.1450 Staphylococcus aureus M1394 FIG01108264: hypothetical protein
fig|1158493.3.peg.122 Staphylococcus aureus M1450 FIG01108264: hypothetical protein
fig|1158494.3.peg.572 Staphylococcus aureus M1451 FIG01108264: hypothetical protein
fig|1158497.3.peg.118 Staphylococcus aureus M1481 FIG01108264: hypothetical protein
fig|1158498.3.peg.1141 Staphylococcus aureus M1520 FIG01108264: hypothetical protein
fig|1158499.3.peg.153 Staphylococcus aureus M1521 FIG01108264: hypothetical protein
fig|1158500.3.peg.476 Staphylococcus aureus M1531 FIG01108264: hypothetical protein
fig|1158501.3.peg.156 Staphylococcus aureus M1533 FIG01108264: hypothetical protein
fig|1158502.3.peg.558 Staphylococcus aureus M1544 FIG01108264: hypothetical protein
fig|1158504.3.peg.792 Staphylococcus aureus M1563 FIG01108264: hypothetical protein
fig|1158505.3.peg.1547 Staphylococcus aureus M1565 FIG01108264: hypothetical protein
fig|1158506.3.peg.555 Staphylococcus aureus M1578 FIG01108264: hypothetical protein
fig|1158507.3.peg.1392 Staphylococcus aureus M0006 FIG01108264: hypothetical protein
fig|1158509.3.peg.1138 Staphylococcus aureus M0077 FIG01108264: hypothetical protein
fig|1158510.3.peg.548 Staphylococcus aureus M0108 FIG01108264: hypothetical protein
fig|1158511.3.peg.1368 Staphylococcus aureus M0144 FIG01108264: hypothetical protein
fig|1158512.3.peg.578 Staphylococcus aureus M0154 FIG01108264: hypothetical protein
fig|1158513.3.peg.153 Staphylococcus aureus M0177 FIG01108264: hypothetical protein
fig|1158514.3.peg.174 Staphylococcus aureus M0200 FIG01108264: hypothetical protein
fig|1158515.3.peg.556 Staphylococcus aureus M0212 FIG01108264: hypothetical protein
fig|1158516.3.peg.118 Staphylococcus aureus M0216 FIG01108264: hypothetical protein
fig|1158517.3.peg.1146 Staphylococcus aureus M0235 FIG01108264: hypothetical protein
fig|1158518.3.peg.1546 Staphylococcus aureus M0250 FIG01108264: hypothetical protein
fig|1158520.3.peg.2541 Staphylococcus aureus M0280 FIG01108264: hypothetical protein
fig|1158521.3.peg.554 Staphylococcus aureus M0306 FIG01108264: hypothetical protein
fig|1158522.3.peg.1394 Staphylococcus aureus M0334 FIG01108264: hypothetical protein
fig|1158523.3.peg.1164 Staphylococcus aureus M0350 FIG01108264: hypothetical protein
fig|1158524.3.peg.605 Staphylococcus aureus M0351 FIG01108264: hypothetical protein
fig|1158525.3.peg.494 Staphylococcus aureus M0363 FIG01108264: hypothetical protein
fig|1158526.3.peg.1439 Staphylococcus aureus M0367 FIG01108264: hypothetical protein
fig|1158527.3.peg.2445 Staphylococcus aureus M0374 FIG01108264: hypothetical protein
fig|1158528.3.peg.1139 Staphylococcus aureus M0375 FIG01108264: hypothetical protein
fig|1158531.3.peg.552 Staphylococcus aureus M0438 FIG01108264: hypothetical protein
fig|1158536.3.peg.1626 Staphylococcus aureus M0571 FIG01108264: hypothetical protein
fig|1158537.3.peg.552 Staphylococcus aureus M0584 FIG01108264: hypothetical protein
fig|1158538.3.peg.1275 Staphylococcus aureus M0586 FIG01108264: hypothetical protein
fig|1158682.3.peg.608 Staphylococcus aureus M0528 FIG01108264: hypothetical protein
fig|1158684.3.peg.564 Staphylococcus aureus M0536 FIG01108264: hypothetical protein
fig|1158685.3.peg.1387 Staphylococcus aureus M0539 FIG01108264: hypothetical protein
fig|1158686.3.peg.1376 Staphylococcus aureus M0547 FIG01108264: hypothetical protein
fig|1158687.3.peg.556 Staphylococcus aureus M0565 FIG01108264: hypothetical protein
fig|1158688.3.peg.2428 Staphylococcus aureus M0580 FIG01108264: hypothetical protein
fig|1158689.3.peg.145 Staphylococcus aureus M0602 FIG01108264: hypothetical protein
fig|1158690.3.peg.556 Staphylococcus aureus M0622 FIG01108264: hypothetical protein
fig|1158691.3.peg.592 Staphylococcus aureus M0676 FIG01108264: hypothetical protein
fig|1158692.3.peg.333 Staphylococcus aureus M0687 FIG01108264: hypothetical protein
fig|1158693.3.peg.1149 Staphylococcus aureus M0692 FIG01108264: hypothetical protein
fig|1158694.3.peg.1245 Staphylococcus aureus M0719 FIG01108264: hypothetical protein
fig|1158695.3.peg.558 Staphylococcus aureus M0769 FIG01108264: hypothetical protein
fig|1158696.3.peg.1626 Staphylococcus aureus M0770 FIG01108264: hypothetical protein
fig|1158697.3.peg.558 Staphylococcus aureus M0780 FIG01108264: hypothetical protein
fig|1158698.3.peg.1376 Staphylococcus aureus M0799 FIG01108264: hypothetical protein
fig|1158699.3.peg.558 Staphylococcus aureus M0823 FIG01108264: hypothetical protein
fig|1158700.3.peg.1248 Staphylococcus aureus M0844 FIG01108264: hypothetical protein
fig|1158701.3.peg.1620 Staphylococcus aureus M0934 FIG01108264: hypothetical protein
fig|1158702.3.peg.557 Staphylococcus aureus M0943 FIG01108264: hypothetical protein
fig|1158703.3.peg.516 Staphylococcus aureus M0944 FIG01108264: hypothetical protein
fig|1158704.3.peg.155 Staphylococcus aureus M0953 FIG01108264: hypothetical protein
fig|1158705.3.peg.156 Staphylococcus aureus M0998 FIG01108264: hypothetical protein
fig|1158706.3.peg.576 Staphylococcus aureus M0999 FIG01108264: hypothetical protein
fig|1158708.3.peg.117 Staphylococcus aureus M1010 FIG01108264: hypothetical protein
fig|1158709.3.peg.699 Staphylococcus aureus M1015 FIG01108264: hypothetical protein
fig|1158710.3.peg.154 Staphylococcus aureus M1016 FIG01108264: hypothetical protein
fig|1158711.3.peg.221 Staphylococcus aureus M1036 FIG01108264: hypothetical protein
fig|1158712.3.peg.556 Staphylococcus aureus M1037 FIG01108264: hypothetical protein
fig|1161392.3.peg.1518 Staphylococcus aureus NN54 FIG01108264: hypothetical protein
fig|1169256.3.peg.558 Staphylococcus aureus M0964 FIG01108264: hypothetical protein
fig|1169258.3.peg.122 Staphylococcus aureus M0994 FIG01108264: hypothetical protein
fig|1169260.3.peg.565 Staphylococcus aureus M1044 FIG01108264: hypothetical protein
fig|1169261.3.peg.1157 Staphylococcus aureus M1061 FIG01108264: hypothetical protein
fig|1169262.3.peg.557 Staphylococcus aureus M1062 FIG01108264: hypothetical protein
fig|1169263.3.peg.555 Staphylococcus aureus M1068 FIG01108264: hypothetical protein
fig|1169264.3.peg.555 Staphylococcus aureus M1083 FIG01108264: hypothetical protein
fig|1169265.3.peg.1243 Staphylococcus aureus M1109 FIG01108264: hypothetical protein
fig|1169266.3.peg.557 Staphylococcus aureus M1126 FIG01108264: hypothetical protein
fig|1169267.3.peg.119 Staphylococcus aureus M1142 FIG01108264: hypothetical protein
fig|1169270.3.peg.610 Staphylococcus aureus M1244 FIG01108264: hypothetical protein
fig|1169272.3.peg.615 Staphylococcus aureus M1275 FIG01108264: hypothetical protein
fig|1169273.3.peg.556 Staphylococcus aureus M1286 FIG01108264: hypothetical protein
fig|1169274.3.peg.556 Staphylococcus aureus M1309 hypothetical protein
fig|1169275.3.peg.555 Staphylococcus aureus M1374 FIG01108264: hypothetical protein
fig|1169276.3.peg.557 Staphylococcus aureus M1405 FIG01108264: hypothetical protein
fig|1213721.3.peg.1254 Staphylococcus aureus M0648 FIG01108264: hypothetical protein
fig|1213722.3.peg.1154 Staphylococcus aureus M0660 FIG01108264: hypothetical protein
fig|1213723.3.peg.549 Staphylococcus aureus M0663 FIG01108264: hypothetical protein
fig|1213724.3.peg.559 Staphylococcus aureus M0673 FIG01108264: hypothetical protein
fig|1213725.3.peg.597 Staphylococcus aureus M0695 FIG01108264: hypothetical protein
fig|1213726.3.peg.556 Staphylococcus aureus M0792 FIG01108264: hypothetical protein
fig|1213727.3.peg.556 Staphylococcus aureus M0822 FIG01108264: hypothetical protein
fig|1213729.3.peg.556 Staphylococcus aureus M0871 FIG01108264: hypothetical protein
fig|1213732.3.peg.563 Staphylococcus aureus M0892 FIG01108264: hypothetical protein
fig|1213733.3.peg.531 Staphylococcus aureus M0900 FIG01108264: hypothetical protein
fig|1214901.3.peg.1614 Staphylococcus aureus M0646 FIG01108264: hypothetical protein
fig|1216363.3.peg.672 Staphylococcus aureus subsp. aureus 06BA18369 FIG01108264: hypothetical protein
fig|1224919.3.peg.1295 Staphylococcus aureus M0104 FIG01108264: hypothetical protein
fig|1224920.3.peg.1182 Staphylococcus aureus M0171 FIG01108264: hypothetical protein
fig|1224921.3.peg.2212 Staphylococcus aureus M0210 FIG01108264: hypothetical protein
fig|1224922.3.peg.1445 Staphylococcus aureus M0213 FIG01108264: hypothetical protein
fig|1224923.3.peg.507 Staphylococcus aureus M0240 FIG01108264: hypothetical protein
fig|1224924.3.peg.1135 Staphylococcus aureus M0270 FIG01108264: hypothetical protein
fig|1224925.3.peg.1423 Staphylococcus aureus M0273 FIG01108264: hypothetical protein
fig|1224926.3.peg.124 Staphylococcus aureus M0279 FIG01108264: hypothetical protein
fig|1224927.3.peg.118 Staphylococcus aureus M0288 FIG01108264: hypothetical protein
fig|1224929.3.peg.330 Staphylococcus aureus M0404 FIG01108264: hypothetical protein
fig|1224930.3.peg.1236 Staphylococcus aureus M0415 FIG01108264: hypothetical protein
fig|1224931.3.peg.154 Staphylococcus aureus M0455 FIG01108264: hypothetical protein
fig|1224932.3.peg.117 Staphylococcus aureus M0460 FIG01108264: hypothetical protein
fig|1224933.3.peg.1432 Staphylococcus aureus M0493 FIG01108264: hypothetical protein
fig|1231383.3.peg.1835 Staphylococcus aureus KT/314250 FIG01108264: hypothetical protein
fig|1235277.3.peg.611 Staphylococcus aureus PPUKM-377-2009 FIG01108264: hypothetical protein
fig|1258575.3.peg.542 Staphylococcus aureus subsp. aureus H29 FIG01108264: hypothetical protein
fig|1303780.3.peg.2440 Staphylococcus aureus M0075 FIG01108264: hypothetical protein
fig|1303781.3.peg.1400 Staphylococcus aureus M0294 FIG01108264: hypothetical protein
fig|1303782.3.peg.1279 Staphylococcus aureus M1060 FIG01108264: hypothetical protein
fig|1303783.3.peg.116 Staphylococcus aureus M1078 FIG01108264: hypothetical protein
fig|1303784.3.peg.1445 Staphylococcus aureus M1193 FIG01108264: hypothetical protein
fig|1303786.3.peg.1283 Staphylococcus aureus M1407 FIG01108264: hypothetical protein
fig|1303787.3.peg.577 Staphylococcus aureus M1466 FIG01108264: hypothetical protein
fig|158878.1.peg.635 Staphylococcus aureus subsp. aureus Mu50 FIG01108264: hypothetical protein
fig|158878.14.peg.644 Staphylococcus aureus subsp. aureus Mu50 FIG01108264: hypothetical protein
fig|158879.1.peg.606 Staphylococcus aureus subsp. aureus N315 FIG01108264: hypothetical protein
fig|158879.11.peg.622 Staphylococcus aureus subsp. aureus N315 FIG01108264: hypothetical protein
fig|196620.1.peg.597 Staphylococcus aureus subsp. aureus MW2 FIG01108264: hypothetical protein
fig|196620.5.peg.630 Staphylococcus aureus subsp. aureus MW2 FIG01108264: hypothetical protein
fig|282459.1.peg.595 Staphylococcus aureus subsp. aureus MSSA476 FIG01108264: hypothetical protein
fig|282459.5.peg.627 Staphylococcus aureus subsp. aureus MSSA476 FIG01108264: hypothetical protein
fig|359786.13.peg.713 Staphylococcus aureus subsp. aureus JH9 FIG01108264: hypothetical protein
fig|359786.3.peg.2466 Staphylococcus aureus subsp. aureus JH9 FIG01108264: hypothetical protein
fig|359787.11.peg.703 Staphylococcus aureus subsp. aureus JH1 FIG01108264: hypothetical protein
fig|359787.3.peg.714 Staphylococcus aureus subsp. aureus JH1 FIG01108264: hypothetical protein
fig|418127.4.peg.593 Staphylococcus aureus subsp. aureus Mu3 FIG01108264: hypothetical protein
fig|418127.6.peg.641 Staphylococcus aureus subsp. aureus Mu3 FIG01108264: hypothetical protein
fig|505321.3.peg.30 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG01108264: hypothetical protein
fig|543540.3.peg.2491 Staphylococcus aureus subsp. aureus CGS03 FIG01108264: hypothetical protein
fig|548475.3.peg.934 Staphylococcus aureus subsp. aureus TCH70 FIG01108264: hypothetical protein
fig|553565.3.peg.849 Staphylococcus aureus A5937 FIG01108264: hypothetical protein
fig|553568.3.peg.2047 Staphylococcus aureus A6224 FIG01108264: hypothetical protein
fig|553571.3.peg.946 Staphylococcus aureus A6300 FIG01108264: hypothetical protein
fig|553573.3.peg.333 Staphylococcus aureus A8115 FIG01108264: hypothetical protein
fig|553574.3.peg.1733 Staphylococcus aureus A8117 FIG01108264: hypothetical protein
fig|553577.3.peg.2572 Staphylococcus aureus A8796 FIG01108264: hypothetical protein
fig|553580.3.peg.2553 Staphylococcus aureus A8819 FIG01108264: hypothetical protein
fig|553581.3.peg.590 Staphylococcus aureus A9299 FIG01108264: hypothetical protein
fig|553588.3.peg.304 Staphylococcus aureus A9719 FIG01108264: hypothetical protein
fig|553592.3.peg.2700 Staphylococcus aureus A9763 FIG01108264: hypothetical protein
fig|553596.3.peg.2018 Staphylococcus aureus A9781 FIG01108264: hypothetical protein
fig|553601.3.peg.216 Staphylococcus aureus A10102 FIG01108264: hypothetical protein
fig|585891.3.peg.643 Staphylococcus aureus subsp. aureus Mu50-omega FIG01108264: hypothetical protein
fig|680649.3.peg.18 Staphylococcus aureus subsp. aureus MR1 FIG01108264: hypothetical protein
fig|703339.3.peg.619 Staphylococcus aureus 04-02981 FIG01108264: hypothetical protein
fig|762962.3.peg.1346 Staphylococcus aureus subsp. aureus ATCC 51811 FIG01108264: hypothetical protein
fig|889933.4.peg.567 Staphylococcus aureus subsp. aureus ECT-R 2 FIG01108264: hypothetical protein
fig|904723.3.peg.1717 Staphylococcus aureus subsp. aureus 21172 FIG01108264: hypothetical protein
fig|904731.3.peg.1379 Staphylococcus aureus subsp. aureus 21201 FIG01108264: hypothetical protein
fig|904739.3.peg.1798 Staphylococcus aureus subsp. aureus 21236 FIG01108264: hypothetical protein
fig|904750.3.peg.1894 Staphylococcus aureus subsp. aureus 21272 FIG01108264: hypothetical protein
fig|904763.3.peg.383 Staphylococcus aureus subsp. aureus 21318 FIG01108264: hypothetical protein
fig|904771.3.peg.662 Staphylococcus aureus subsp. aureus 21340 FIG01108264: hypothetical protein
fig|904775.3.peg.598 Staphylococcus aureus subsp. aureus IS-3 FIG01108264: hypothetical protein
fig|904780.3.peg.1793 Staphylococcus aureus subsp. aureus IS-99 FIG01108264: hypothetical protein
fig|904783.3.peg.434 Staphylococcus aureus subsp. aureus IS-122 FIG01108264: hypothetical protein
fig|904792.3.peg.381 Staphylococcus aureus subsp. aureus IS-M FIG01108264: hypothetical protein
fig|931432.3.peg.1138 Staphylococcus aureus subsp. aureus CIG1057 FIG01108264: hypothetical protein
fig|931434.3.peg.1101 Staphylococcus aureus subsp. aureus CIG1165 FIG01108264: hypothetical protein
fig|931439.3.peg.1064 Staphylococcus aureus subsp. aureus CIG1750 FIG01108264: hypothetical protein
fig|931440.3.peg.1263 Staphylococcus aureus subsp. aureus CIG1769 FIG01108264: hypothetical protein
fig|931441.3.peg.799 Staphylococcus aureus subsp. aureus CIG1835 FIG01108264: hypothetical protein
fig|931443.3.peg.1140 Staphylococcus aureus subsp. aureus CIG1096 FIG01108264: hypothetical protein
fig|931444.3.peg.1175 Staphylococcus aureus subsp. aureus CIG1150 FIG01108264: hypothetical protein
fig|931446.3.peg.1158 Staphylococcus aureus subsp. aureus CIG1213 FIG01108264: hypothetical protein
fig|931455.3.peg.1108 Staphylococcus aureus subsp. aureus CIGC340D FIG01108264: hypothetical protein
fig|931458.3.peg.1208 Staphylococcus aureus subsp. aureus CIGC348 FIG01108264: hypothetical protein
fig|931459.3.peg.1086 Staphylococcus aureus subsp. aureus CIGC128 FIG01108264: hypothetical protein