page	:SeedViewerServeFeature:
fid	:fig|1116050.3.peg.3553:
show_prot_sequence	:1:

>fig|1116050.3.peg.3553
MHITYDLPVAIDDIIEAKQRLAGRIYKTGMPRSNYFSERCKGEIFLKFENMQRTGSFKIR
GAFNKLSSLTDAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVMPKGAPKSKVAATCDY
SAEVVLHGDNFNDTIAKVSEIVEMEGRIFIPPYDDPKVIAGQGTIGLEIMEDLYDVDNVI
VPIGGGGLIAGIAVAIKSINPTIRVIGVQSENVHGMAASFHSGEITTHRTTGTLADGCDV
SRPGNLTYEIVRELVDDIVLVSEDEIRNSMIALIQRNKVVTEGAGALACAALLSGKLDQY
IQNRKTVSIISGGNIDLSRVSQITGFVDA


PEGs with Identical Sequence
PEG Genome Function
fig|1001989.3.peg.3045 Escherichia coli PCN033 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1004153.3.peg.3350 Escherichia coli AA86 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005396.3.peg.4002 Escherichia coli 88.1467 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005397.3.peg.3914 Escherichia coli 88.0221 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005398.3.peg.3941 Escherichia coli 88.1042 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005399.3.peg.3867 Escherichia coli 89.0511 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005401.3.peg.3806 Escherichia coli 90.0039 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005402.3.peg.3989 Escherichia coli 90.2281 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005403.3.peg.3803 Escherichia coli 93.0055 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005404.3.peg.3965 Escherichia coli 93.0056 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005405.3.peg.3909 Escherichia coli 94.0618 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005406.3.peg.4002 Escherichia coli 95.0183 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005407.3.peg.3519 Escherichia coli 95.1288 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005408.3.peg.4061 Escherichia coli 95.0943 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005410.3.peg.3934 Escherichia coli 96.0428 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005411.3.peg.3928 Escherichia coli 96.0427 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005412.3.peg.4026 Escherichia coli 96.0939 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005413.3.peg.3979 Escherichia coli 96.0932 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005414.3.peg.3969 Escherichia coli 96.0109 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005415.3.peg.3958 Escherichia coli 96.0107 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005416.3.peg.3963 Escherichia coli 97.0003 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005418.3.peg.3774 Escherichia coli 97.1742 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005419.3.peg.3824 Escherichia coli 97.0010 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005421.3.peg.3893 Escherichia coli 99.0672 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005422.3.peg.4097 Escherichia coli 99.0678 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005424.3.peg.3944 Escherichia coli 99.0713 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005430.3.peg.3755 Escherichia coli 99.0816 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005431.3.peg.3924 Escherichia coli 99.0848 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005432.3.peg.3796 Escherichia coli 99.0839 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005433.3.peg.3706 Escherichia coli 99.0815 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005434.3.peg.3897 Escherichia coli 99.0814 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005435.3.peg.4076 Escherichia coli 99.1762 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005436.3.peg.3625 Escherichia coli 99.1805 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005437.3.peg.4047 Escherichia coli 99.1793 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005438.3.peg.3558 Escherichia coli 99.1775 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005439.3.peg.4062 Escherichia coli 99.1781 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005440.3.peg.3797 Escherichia coli 99.1753 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005441.3.peg.4026 Escherichia coli 0.1304 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005442.3.peg.3315 Escherichia coli 0.1288 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005450.3.peg.3991 Escherichia coli 3.4870 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005452.3.peg.4043 Escherichia coli 5.2239 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005455.3.peg.4103 Escherichia coli 6.0172 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005460.3.peg.3863 Escherichia coli 8.2524 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005461.3.peg.4160 Escherichia coli 8.0586 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005462.3.peg.3278 Escherichia coli 8.0566 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005463.3.peg.3857 Escherichia coli 8.0416 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005464.3.peg.3275 Escherichia coli 8.0569 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005466.3.peg.4125 Escherichia coli 10.0833 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005467.3.peg.3801 Escherichia coli 10.0869 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005469.3.peg.3881 Escherichia coli 10.0821 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005470.3.peg.4084 Escherichia coli FDA504 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005471.3.peg.3802 Escherichia coli FDA505 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005472.3.peg.4037 Escherichia coli FDA507 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005473.3.peg.4114 Escherichia coli FDA517 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005474.3.peg.4361 Escherichia coli FDA506 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005475.3.peg.3973 Escherichia coli FRIK1996 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005476.3.peg.4042 Escherichia coli FRIK1985 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005477.3.peg.4104 Escherichia coli FRIK1999 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005478.3.peg.3797 Escherichia coli FRIK1990 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005479.3.peg.4445 Escherichia coli FRIK2001 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005480.3.peg.4085 Escherichia coli FRIK1997 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005481.3.peg.4022 Escherichia coli 93-001 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005482.3.peg.4115 Escherichia coli FRIK523 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005483.3.peg.4526 Escherichia coli FRIK920 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005484.3.peg.4247 Escherichia coli NE037 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005485.3.peg.4249 Escherichia coli NE1487 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005486.3.peg.3997 Escherichia coli NE098 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005487.3.peg.3937 Escherichia coli PA2 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005488.3.peg.3886 Escherichia coli PA3 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005489.3.peg.4059 Escherichia coli PA4 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005490.3.peg.3854 Escherichia coli PA5 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005491.3.peg.5153 Escherichia coli PA7 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005492.3.peg.4157 Escherichia coli PA8 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005493.3.peg.4032 Escherichia coli PA9 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005494.3.peg.4044 Escherichia coli PA10 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005495.3.peg.3982 Escherichia coli PA14 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005496.3.peg.4107 Escherichia coli PA15 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005497.3.peg.4287 Escherichia coli PA22 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005498.3.peg.3916 Escherichia coli PA23 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005499.3.peg.3771 Escherichia coli PA24 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005500.3.peg.3725 Escherichia coli PA25 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005501.3.peg.3942 Escherichia coli PA28 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005502.3.peg.3840 Escherichia coli PA31 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005503.3.peg.3893 Escherichia coli PA32 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005504.3.peg.3850 Escherichia coli PA33 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005505.3.peg.4052 Escherichia coli PA34 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005507.3.peg.3834 Escherichia coli PA39 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005508.3.peg.4339 Escherichia coli PA40 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005509.3.peg.3922 Escherichia coli PA41 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005510.3.peg.4126 Escherichia coli PA42 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005511.3.peg.4122 Escherichia coli PA45 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005512.3.peg.3817 Escherichia coli PA47 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005513.3.peg.3600 Escherichia coli PA48 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005515.3.peg.3802 Escherichia coli TW06591 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005516.3.peg.3884 Escherichia coli TW07945 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005517.3.peg.4438 Escherichia coli TW10246 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005518.3.peg.4460 Escherichia coli TW11039 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005519.3.peg.3952 Escherichia coli TW09098 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005520.3.peg.4425 Escherichia coli TW09109 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005521.3.peg.3630 Escherichia coli TW09195 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005522.3.peg.4604 Escherichia coli TW10119 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005523.3.peg.3820 Escherichia coli EC4203 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005524.3.peg.3801 Escherichia coli EC4196 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005525.3.peg.3693 Escherichia coli TW14313 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005526.3.peg.3816 Escherichia coli TW14301 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005527.3.peg.3754 Escherichia coli EC4421 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005528.3.peg.4002 Escherichia coli EC4422 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005529.3.peg.4080 Escherichia coli EC4013 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005530.3.peg.3844 Escherichia coli EC4402 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005531.3.peg.3774 Escherichia coli EC4439 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005532.3.peg.3841 Escherichia coli EC4436 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005533.3.peg.4060 Escherichia coli EC4437 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005534.3.peg.3956 Escherichia coli EC4448 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005535.3.peg.4194 Escherichia coli EC1738 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005536.3.peg.4122 Escherichia coli EC1734 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005537.3.peg.3937 Escherichia coli EC1735 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005538.3.peg.3903 Escherichia coli EC1736 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005539.3.peg.3821 Escherichia coli EC1737 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005540.3.peg.3779 Escherichia coli EC1845 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005541.3.peg.3890 Escherichia coli EC1846 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005542.3.peg.3902 Escherichia coli EC1847 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005543.3.peg.4150 Escherichia coli EC1848 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005544.3.peg.3870 Escherichia coli EC1849 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005545.3.peg.4072 Escherichia coli EC1850 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005546.3.peg.3920 Escherichia coli EC1856 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005547.3.peg.3813 Escherichia coli EC1862 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005548.3.peg.3624 Escherichia coli EC1863 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005549.3.peg.4049 Escherichia coli EC1864 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005550.3.peg.4116 Escherichia coli EC1865 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005551.3.peg.3758 Escherichia coli EC1866 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005553.3.peg.4055 Escherichia coli EC1869 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005554.3.peg.3825 Escherichia coli EC1870 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005555.3.peg.4045 Escherichia coli TT12B Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005557.3.peg.4266 Escherichia coli MA6 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005558.3.peg.4373 Escherichia coli 5905 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005559.3.peg.3911 Escherichia coli CB7326 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005561.3.peg.3885 Escherichia coli 5412 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005562.3.peg.3441 Escherichia coli TW15901 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005563.3.peg.3483 Escherichia coli ARS4.2123 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005564.3.peg.3574 Escherichia coli TW00353 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005565.3.peg.3604 Escherichia coli 3006 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1005566.3.peg.3623 Escherichia coli 07798 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1038844.15.peg.4658 Escherichia coli O104:H4 str. TY-2482 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1038844.18.peg.2540 Escherichia coli O104:H4 str. TY-2482 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1038844.4.peg.4087 Escherichia coli TY-2482 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1038927.4.peg.4816 Escherichia coli O104:H4 str. GOS1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1038927.5.peg.3077 Escherichia coli O104:H4 str. GOS2 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1038927.6.peg.1350 Escherichia coli O104:H4 str. H112180282 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1038927.7.peg.377 Escherichia coli O104:H4 str. H112180283 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1038927.8.peg.632 Escherichia coli O104:H4 str. H112180540 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1038927.9.peg.4749 Escherichia coli O104:H4 str. C227-11 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1040638.5.peg.3579 Escherichia coli O104:H4 str. LB226692 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1042803.5.peg.3497 Escherichia coli O104:H4 str. 01-09591 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1042804.3.peg.3371 Escherichia coli O104:H4 str. H112180280 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1048254.3.peg.2171 Escherichia coli O104:H4 str. C227-11 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1048256.3.peg.4052 Escherichia coli O104:H4 str. C236-11 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1048265.3.peg.2604 Escherichia coli O104:H4 str. 04-8351 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1048266.3.peg.4023 Escherichia coli O104:H4 str. 09-7901 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1048334.3.peg.4041 Escherichia coli O104:H4 str. 11-3677 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1048765.4.peg.4956 Escherichia coli O104:H4 str. H112180541 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1050617.5.peg.3944 Escherichia coli UMNF18 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1051346.3.peg.3793 Escherichia coli 95.0083 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1051347.3.peg.3945 Escherichia coli 3.4880 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1051348.3.peg.4083 Escherichia coli 7.1982 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1051349.3.peg.3804 Escherichia coli PA11 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1051350.3.peg.3678 Escherichia coli PA13 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1051351.3.peg.3781 Escherichia coli PA19 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1051352.3.peg.4187 Escherichia coli PA35 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1051353.3.peg.3691 Escherichia coli ATCC 700728 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1068608.3.peg.3303 Escherichia coli XH140A Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1068614.3.peg.1850 Escherichia coli O104:H4 str. 11-4404 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1068615.3.peg.1872 Escherichia coli O104:H4 str. 11-4522 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1068616.3.peg.2608 Escherichia coli O104:H4 str. 11-4623 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1068617.3.peg.233 Escherichia coli O104:H4 str. 11-4632 C1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1068618.3.peg.229 Escherichia coli O104:H4 str. 11-4632 C2 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1068619.3.peg.1850 Escherichia coli O104:H4 str. 11-4632 C3 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1068620.3.peg.3512 Escherichia coli O104:H4 str. 11-4632 C4 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1068621.3.peg.232 Escherichia coli O104:H4 str. 11-4632 C5 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1068622.3.peg.2180 Escherichia coli O104:H4 str. Ec11-5538 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1068623.3.peg.4021 Escherichia coli O104:H4 str. Ec11-5536 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1068624.3.peg.4023 Escherichia coli O104:H4 str. Ec11-5537 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1069495.4.peg.2723 Escherichia coli XH001 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1072459.4.peg.3702 Escherichia coli O7:K1 str. CE10 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1078029.12.peg.1756 Escherichia coli O113:H21 str. CL-3 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1078030.10.peg.1987 Escherichia coli O91:H21 str. B2F1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1078035.3.peg.2599 Escherichia coli O145:H28 str. 4865/96 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1081887.3.peg.3898 Escherichia coli 09BKT078844 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1089445.3.peg.2707 Escherichia coli AI27 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1090926.6.peg.1505 Escherichia coli W26 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1090929.3.peg.3279 Escherichia coli O127:H27 str. C43/90 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1090930.3.peg.3207 Escherichia coli ONT:H33 str. C48/93 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1101440.4.peg.3505 Escherichia coli O103:H25 str. NIPH-11060424 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1110693.3.peg.2575 Escherichia coli str. K-12 substr. MDS42 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1115997.3.peg.4239 Escherichia coli Envira 8/11 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1115998.3.peg.4170 Escherichia coli Envira 10/1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1115999.3.peg.3420 Escherichia coli Jurua 18/11 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116000.3.peg.3559 Escherichia coli Jurua 20/10 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116001.3.peg.4036 Escherichia coli ThroopD Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116002.3.peg.4086 Escherichia coli C-34666 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116003.3.peg.3565 Escherichia coli 174900 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116004.3.peg.3537 Escherichia coli 2729250 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116005.3.peg.3183 Escherichia coli 2730350 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116008.3.peg.3478 Escherichia coli 2735000 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116009.3.peg.3726 Escherichia coli 2741950 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116010.3.peg.3530 Escherichia coli 2747800 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116011.3.peg.3622 Escherichia coli 2749250 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116012.3.peg.3823 Escherichia coli 2756500 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116014.3.peg.3451 Escherichia coli 2770900 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116015.3.peg.3369 Escherichia coli 2780750 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116016.3.peg.3669 Escherichia coli 2785200 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116017.3.peg.3422 Escherichia coli 2788150 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116019.3.peg.3749 Escherichia coli 2850750 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116020.3.peg.3789 Escherichia coli 2853500 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116021.3.peg.3539 Escherichia coli 2860050 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116022.3.peg.3823 Escherichia coli 2860650 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116023.3.peg.3791 Escherichia coli 2861200 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116025.3.peg.3709 Escherichia coli 2864350 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116026.3.peg.3460 Escherichia coli 2865200 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116027.3.peg.3692 Escherichia coli 2866350 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116028.3.peg.3702 Escherichia coli 2866450 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116029.3.peg.3754 Escherichia coli 2866550 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116030.3.peg.3571 Escherichia coli 2866750 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116031.3.peg.3648 Escherichia coli 2867750 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116032.3.peg.3535 Escherichia coli 2871950 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116033.3.peg.3677 Escherichia coli 2872000 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116034.3.peg.3718 Escherichia coli 2872800 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116035.3.peg.3698 Escherichia coli 2875000 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116037.3.peg.3238 Escherichia coli BCE001_MS16 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116038.3.peg.3499 Escherichia coli P0299438.3 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116039.3.peg.3547 Escherichia coli P0299438.4 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116040.3.peg.3474 Escherichia coli P0299438.5 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116041.3.peg.3447 Escherichia coli P0299438.6 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116042.3.peg.3719 Escherichia coli P0299438.7 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116043.3.peg.3694 Escherichia coli P0299438.8 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116044.3.peg.3278 Escherichia coli P0299438.9 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116045.3.peg.3434 Escherichia coli P0299438.10 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116046.3.peg.3466 Escherichia coli P0299438.11 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116047.3.peg.3908 Escherichia coli P0299917.1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116048.3.peg.3519 Escherichia coli P0299917.2 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116049.3.peg.3170 Escherichia coli P0299917.3 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116050.3.peg.3553 Escherichia coli P0299917.4 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116051.3.peg.3454 Escherichia coli P0299917.5 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116052.3.peg.3504 Escherichia coli P0299917.6 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116053.3.peg.3461 Escherichia coli P0299917.7 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116054.3.peg.4040 Escherichia coli P0299917.8 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116055.3.peg.3992 Escherichia coli P0299917.9 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116056.3.peg.4138 Escherichia coli P0299917.10 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116057.3.peg.3754 Escherichia coli MP021017.1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116058.3.peg.3764 Escherichia coli MP021017.2 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116059.3.peg.3733 Escherichia coli MP021017.3 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116060.3.peg.3649 Escherichia coli MP021017.4 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116061.3.peg.3520 Escherichia coli MP021017.5 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116062.3.peg.3582 Escherichia coli MP021017.6 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116064.3.peg.3801 Escherichia coli MP021017.10 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116065.3.peg.3590 Escherichia coli MP021017.11 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116066.3.peg.3876 Escherichia coli P0301867.1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116067.3.peg.3520 Escherichia coli P0301867.3 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116069.3.peg.3800 Escherichia coli P0301867.5 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116070.3.peg.3486 Escherichia coli P0301867.7 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116071.3.peg.3651 Escherichia coli P0301867.8 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116072.3.peg.3499 Escherichia coli P0301867.11 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116073.3.peg.3551 Escherichia coli P0302293.2 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116074.3.peg.3403 Escherichia coli P0302293.3 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116075.3.peg.3898 Escherichia coli P0302293.4 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116076.3.peg.3531 Escherichia coli P0302293.6 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116077.3.peg.3706 Escherichia coli P0302293.8 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116078.3.peg.3154 Escherichia coli P0302293.9 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116079.3.peg.3717 Escherichia coli P0302293.10 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116080.3.peg.3257 Escherichia coli P0305260.6 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116081.3.peg.3315 Escherichia coli P0305260.7 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116082.3.peg.3423 Escherichia coli P0305260.8 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116083.3.peg.3285 Escherichia coli P0305260.9 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116084.3.peg.3341 Escherichia coli P0305260.10 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116086.3.peg.3344 Escherichia coli P0305260.12 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116087.3.peg.3325 Escherichia coli P0305260.13 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116088.3.peg.3304 Escherichia coli P0305260.15 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116089.3.peg.3874 Escherichia coli p0305293.1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116090.3.peg.3801 Escherichia coli p0305293.2 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116091.3.peg.3814 Escherichia coli p0305293.3 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116092.3.peg.3761 Escherichia coli p0305293.4 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116093.3.peg.3829 Escherichia coli p0305293.5 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116094.3.peg.3236 Escherichia coli p0305293.6 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116095.3.peg.3770 Escherichia coli p0305293.7 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116096.3.peg.3859 Escherichia coli p0305293.8 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116097.3.peg.3235 Escherichia coli p0305293.9 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116098.3.peg.3779 Escherichia coli p0305293.10 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116100.3.peg.3836 Escherichia coli p0305293.12 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116101.3.peg.3138 Escherichia coli p0305293.13 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116102.3.peg.3461 Escherichia coli p0305293.15 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116103.3.peg.3510 Escherichia coli 180050 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116104.3.peg.3595 Escherichia coli 180200 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116105.3.peg.3714 Escherichia coli 180600 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116106.3.peg.3101 Escherichia coli 178850 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116107.3.peg.2960 Escherichia coli 178200 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116108.3.peg.3675 Escherichia coli 178900 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116109.3.peg.3665 Escherichia coli 179550 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116110.3.peg.3573 Escherichia coli BCE008_MS-01 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116111.3.peg.3160 Escherichia coli MP021017.12 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116112.3.peg.3467 Escherichia coli BCE002_MS12 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116113.3.peg.3692 Escherichia coli BCE007_MS-11 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116115.3.peg.3421 Escherichia coli BCE019_MS-13 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116116.3.peg.3426 Escherichia coli BCE030_MS-09 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116117.3.peg.3436 Escherichia coli BCE032_MS-12 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116118.3.peg.3926 Escherichia coli BCE034_MS-14 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116119.3.peg.3957 Escherichia coli 2719100 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116120.3.peg.3713 Escherichia coli 2720900 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116122.3.peg.3935 Escherichia coli 2726800 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116126.3.peg.3363 Escherichia coli 2846750 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116127.3.peg.3455 Escherichia coli 2848050 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116128.3.peg.3678 Escherichia coli 2851500 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116129.3.peg.4005 Escherichia coli 201600.1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116130.3.peg.3573 Escherichia coli 199900.1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116131.3.peg.4100 Escherichia coli P02997067.6 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116132.3.peg.4148 Escherichia coli MP021552.7 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116133.3.peg.3603 Escherichia coli MP021552.8 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116134.3.peg.3777 Escherichia coli MP021552.11 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116135.3.peg.3575 Escherichia coli MP021552.12 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116136.3.peg.3899 Escherichia coli MP021561.2 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116137.3.peg.3950 Escherichia coli MP021561.3 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116138.3.peg.4040 Escherichia coli MP021566.1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116139.3.peg.3935 Escherichia coli MP020980.2 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116140.3.peg.3790 Escherichia coli MP020940.1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116152.3.peg.3212 Escherichia coli P0299438.2 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116153.3.peg.4079 Escherichia coli P0302308.1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116154.3.peg.3523 Escherichia coli P0302308.2 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116155.3.peg.3763 Escherichia coli P0302308.3 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116156.3.peg.3787 Escherichia coli P0302308.4 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116157.3.peg.3783 Escherichia coli P0302308.5 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116158.3.peg.3429 Escherichia coli P0302308.10 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116159.3.peg.3510 Escherichia coli P0302308.11 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116160.3.peg.3431 Escherichia coli P0302308.12 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116161.3.peg.3673 Escherichia coli P0302308.13 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116162.3.peg.3496 Escherichia coli P0302308.14 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116163.3.peg.3468 Escherichia coli P0304777.1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116164.3.peg.3635 Escherichia coli P0304777.2 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116165.3.peg.3715 Escherichia coli P0304777.3 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116166.3.peg.3373 Escherichia coli P0304777.4 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116167.3.peg.59 Escherichia coli P0304777.5 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116168.3.peg.3368 Escherichia coli P0304777.7 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116169.3.peg.5014 Escherichia coli P0304777.8 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116170.3.peg.3287 Escherichia coli P0304777.9 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116171.3.peg.3800 Escherichia coli P0304777.10 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116175.3.peg.3681 Escherichia coli P0304777.14 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116177.3.peg.4090 Escherichia coli P0304816.1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116178.3.peg.3803 Escherichia coli P0304816.2 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116179.3.peg.3408 Escherichia coli P0304816.3 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116180.3.peg.3651 Escherichia coli P0304816.4 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116181.3.peg.3803 Escherichia coli P0304816.5 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116182.3.peg.3789 Escherichia coli P0304816.6 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116183.3.peg.3407 Escherichia coli P0304816.7 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116184.3.peg.3307 Escherichia coli P0304816.8 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116186.3.peg.3426 Escherichia coli P0304816.10 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116187.3.peg.3825 Escherichia coli P0304816.11 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116188.3.peg.3299 Escherichia coli P0304816.12 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116189.3.peg.3369 Escherichia coli P0304816.13 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116190.3.peg.3738 Escherichia coli P0304816.14 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116191.3.peg.3356 Escherichia coli P0304816.15 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116192.3.peg.3343 Escherichia coli P0305260.3 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116193.3.peg.3270 Escherichia coli P0305260.4 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116194.3.peg.3295 Escherichia coli P0305260.5 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1116471.3.peg.3895 Escherichia coli BCE008_MS-13 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1125634.3.peg.3860 Escherichia coli 174750 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1125636.3.peg.3666 Escherichia coli 2854350 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1125637.3.peg.3458 Escherichia coli BCE006_MS-23 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1125638.3.peg.3889 Escherichia coli MP020980.1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1125642.3.peg.3564 Escherichia coli P0301867.13 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1125643.3.peg.3470 Escherichia coli P0302293.7 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1125644.3.peg.3166 Escherichia coli P0305260.1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1125645.3.peg.3456 Escherichia coli P0305260.2 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1125646.3.peg.3878 Escherichia coli p0305293.14 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1125647.3.peg.3663 Escherichia coli P0301904.3 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1125648.3.peg.3638 Escherichia coli P0299483.1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1125649.3.peg.3849 Escherichia coli P0299483.2 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1125650.3.peg.3604 Escherichia coli P0299483.3 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1125651.3.peg.3963 Escherichia coli P0304799.3 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1125652.3.peg.3546 Escherichia coli 179100 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1126911.3.peg.4536 Escherichia coli C639_08 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1126932.3.peg.1570 Escherichia coli C844_97 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1127356.3.peg.2205 Escherichia coli 4_1_47FAA Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1127356.4.peg.2205 Escherichia coli 4_1_47FAA Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1133852.3.peg.698 Escherichia coli O104:H4 str. 2011C-3493 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1133853.3.peg.697 Escherichia coli O104:H4 str. 2009EL-2071 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1134782.3.peg.705 Escherichia coli O104:H4 str. 2009EL-2050 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1136217.3.peg.3536 Escherichia coli O104:H4 str. ON2010 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1136218.3.peg.3962 Escherichia coli O104:H4 str. ON2011 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1137135.3.peg.1075 Escherichia coli O157:H43 str. T22 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1144302.3.peg.3150 Escherichia coli SCI-07 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1144303.3.peg.662 Escherichia coli J53 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1163386.3.peg.4117 Escherichia coli LCT-EC106 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1163391.3.peg.4243 Escherichia coli O111:H11 str. CVM9545 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1163738.3.peg.1508 Escherichia coli O26:H11 str. CVM9952 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1165939.3.peg.161 Escherichia coli O111 str. CVM9455 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1165940.3.peg.3545 Escherichia coli O103:H25 str. CVM9340 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1165942.3.peg.1843 Escherichia coli O111:H8 str. CVM9602 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1165943.3.peg.1539 Escherichia coli O111:H8 str. CVM9574 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1165944.3.peg.2140 Escherichia coli O111:H8 str. CVM9634 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1165945.3.peg.5404 Escherichia coli O111:H8 str. CVM9570 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1165946.3.peg.3881 Escherichia coli O111:H11 str. CVM9534 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1165947.3.peg.159 Escherichia coli O111:H11 str. CVM9553 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1165949.3.peg.1291 Escherichia coli O26:H11 str. CVM9942 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1165950.3.peg.1793 Escherichia coli O26:H11 str. CVM10021 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1165951.3.peg.3764 Escherichia coli O26:H11 str. CVM10026 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1165952.3.peg.129 Escherichia coli O26:H11 str. CVM10030 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1165953.3.peg.2211 Escherichia coli O26:H11 str. CVM10224 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1167694.3.peg.1817 Escherichia coli O32:H37 str. P4 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169316.3.peg.4066 Escherichia coli KTE3 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169317.3.peg.4354 Escherichia coli KTE7 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169318.3.peg.3263 Escherichia coli KTE13 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169320.3.peg.3987 Escherichia coli KTE35 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169323.3.peg.3430 Escherichia coli KTE231 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169325.3.peg.3651 Escherichia coli KTE4 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169326.3.peg.3518 Escherichia coli KTE5 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169327.3.peg.801 Escherichia coli KTE6 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169329.3.peg.3989 Escherichia coli KTE9 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169330.3.peg.515 Escherichia coli KTE10 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169332.3.peg.3283 Escherichia coli KTE12 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169333.3.peg.3715 Escherichia coli KTE14 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169334.3.peg.3134 Escherichia coli KTE15 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169335.3.peg.4265 Escherichia coli KTE16 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169336.3.peg.3731 Escherichia coli KTE17 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169337.3.peg.3746 Escherichia coli KTE18 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169338.3.peg.2835 Escherichia coli KTE19 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169339.3.peg.4181 Escherichia coli KTE20 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169340.3.peg.4154 Escherichia coli KTE21 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169341.3.peg.3182 Escherichia coli KTE22 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169342.3.peg.3668 Escherichia coli KTE23 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169343.3.peg.3966 Escherichia coli KTE24 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169344.3.peg.4076 Escherichia coli KTE25 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169345.3.peg.3845 Escherichia coli KTE26 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169346.3.peg.4202 Escherichia coli KTE27 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169347.3.peg.3520 Escherichia coli KTE28 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169348.3.peg.3065 Escherichia coli KTE29 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169352.3.peg.3975 Escherichia coli KTE34 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169353.3.peg.3949 Escherichia coli KTE36 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169354.3.peg.4110 Escherichia coli KTE37 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169355.3.peg.3968 Escherichia coli KTE38 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169356.3.peg.4008 Escherichia coli KTE39 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169357.3.peg.3211 Escherichia coli KTE40 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169358.3.peg.3896 Escherichia coli KTE41 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169359.3.peg.3991 Escherichia coli KTE42 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169360.3.peg.3332 Escherichia coli KTE43 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169361.3.peg.4288 Escherichia coli KTE44 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169362.3.peg.3852 Escherichia coli KTE45 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169363.3.peg.3656 Escherichia coli KTE82 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169365.3.peg.3306 Escherichia coli KTE232 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169366.3.peg.3064 Escherichia coli KTE88 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169367.3.peg.3554 Escherichia coli KTE90 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169368.3.peg.3494 Escherichia coli KTE94 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169369.3.peg.3471 Escherichia coli KTE95 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169370.3.peg.3074 Escherichia coli KTE97 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169371.3.peg.3342 Escherichia coli KTE99 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169372.3.peg.3316 Escherichia coli KTE104 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169373.3.peg.3337 Escherichia coli KTE105 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169374.3.peg.3219 Escherichia coli KTE106 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169375.3.peg.3240 Escherichia coli KTE109 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169377.3.peg.3598 Escherichia coli KTE113 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169379.3.peg.3555 Escherichia coli KTE120 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169381.3.peg.3461 Escherichia coli KTE124 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169382.3.peg.3511 Escherichia coli KTE125 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169383.3.peg.3391 Escherichia coli KTE128 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169386.3.peg.3284 Escherichia coli KTE133 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169387.3.peg.3313 Escherichia coli KTE137 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169388.3.peg.3198 Escherichia coli KTE138 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169389.3.peg.3226 Escherichia coli KTE139 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169390.3.peg.3362 Escherichia coli KTE145 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169391.3.peg.3345 Escherichia coli KTE148 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169392.3.peg.3320 Escherichia coli KTE150 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169393.3.peg.3297 Escherichia coli KTE153 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169394.3.peg.3207 Escherichia coli KTE157 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169395.3.peg.3277 Escherichia coli KTE160 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169396.3.peg.3511 Escherichia coli KTE163 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169397.3.peg.3344 Escherichia coli KTE166 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169398.3.peg.3107 Escherichia coli KTE167 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169399.3.peg.3353 Escherichia coli KTE168 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169400.3.peg.3509 Escherichia coli KTE174 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169401.3.peg.3317 Escherichia coli KTE176 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169402.3.peg.3395 Escherichia coli KTE177 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169403.3.peg.3416 Escherichia coli KTE179 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169404.3.peg.3429 Escherichia coli KTE180 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169663.3.peg.1230 Escherichia coli NCCP15647 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169664.3.peg.1052 Escherichia coli AD30 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169862.3.peg.3978 Escherichia coli NCCP15658 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1169863.3.peg.2929 Escherichia coli NCCP15657 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181724.3.peg.4197 Escherichia coli KTE173 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181725.3.peg.4273 Escherichia coli KTE175 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181726.3.peg.4121 Escherichia coli KTE178 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181727.3.peg.3236 Escherichia coli KTE181 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181729.3.peg.2407 Escherichia coli KTE183 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181730.3.peg.4745 Escherichia coli KTE184 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181731.3.peg.3844 Escherichia coli KTE185 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181732.3.peg.1228 Escherichia coli KTE186 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181733.3.peg.3728 Escherichia coli KTE187 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181734.3.peg.3776 Escherichia coli KTE188 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181735.3.peg.3596 Escherichia coli KTE189 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181736.3.peg.3773 Escherichia coli KTE190 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181737.3.peg.3937 Escherichia coli KTE191 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181738.3.peg.3666 Escherichia coli KTE192 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181740.3.peg.3859 Escherichia coli KTE194 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181741.3.peg.3823 Escherichia coli KTE195 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181743.3.peg.3870 Escherichia coli KTE197 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181744.3.peg.4208 Escherichia coli KTE198 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181745.3.peg.3009 Escherichia coli KTE199 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181747.3.peg.4253 Escherichia coli KTE201 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181748.3.peg.4089 Escherichia coli KTE202 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181749.3.peg.4402 Escherichia coli KTE203 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181750.3.peg.3433 Escherichia coli KTE204 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181753.3.peg.4095 Escherichia coli KTE207 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181754.3.peg.3776 Escherichia coli KTE208 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181755.3.peg.1250 Escherichia coli KTE209 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181756.3.peg.3679 Escherichia coli KTE210 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181757.3.peg.3851 Escherichia coli KTE211 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181758.3.peg.3432 Escherichia coli KTE212 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181759.3.peg.2916 Escherichia coli KTE213 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181760.3.peg.4595 Escherichia coli KTE214 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181761.3.peg.3572 Escherichia coli KTE215 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181762.3.peg.3973 Escherichia coli KTE216 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181763.3.peg.4108 Escherichia coli KTE217 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181764.3.peg.4156 Escherichia coli KTE218 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181765.3.peg.3209 Escherichia coli KTE219 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181766.3.peg.3190 Escherichia coli KTE220 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181767.3.peg.3732 Escherichia coli KTE221 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181768.3.peg.581 Escherichia coli KTE222 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181769.3.peg.3986 Escherichia coli KTE223 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181770.3.peg.3500 Escherichia coli KTE224 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181771.3.peg.4805 Escherichia coli KTE225 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181772.3.peg.3508 Escherichia coli KTE226 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181773.3.peg.4480 Escherichia coli KTE227 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181774.3.peg.2364 Escherichia coli KTE228 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181775.3.peg.2121 Escherichia coli KTE229 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181776.3.peg.3695 Escherichia coli KTE230 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181777.3.peg.1197 Escherichia coli KTE233 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181780.3.peg.3569 Escherichia coli KTE236 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181781.3.peg.3951 Escherichia coli KTE237 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1181782.3.peg.3468 Escherichia coli KTE240 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182653.3.peg.3184 Escherichia coli KTE46 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182654.3.peg.3704 Escherichia coli KTE47 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182655.3.peg.4209 Escherichia coli KTE48 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182656.3.peg.4198 Escherichia coli KTE49 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182657.3.peg.301 Escherichia coli KTE50 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182658.3.peg.4213 Escherichia coli KTE51 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182660.3.peg.4088 Escherichia coli KTE53 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182661.3.peg.4397 Escherichia coli KTE54 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182662.3.peg.4193 Escherichia coli KTE55 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182663.3.peg.1110 Escherichia coli KTE56 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182664.3.peg.919 Escherichia coli KTE57 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182665.3.peg.4049 Escherichia coli KTE58 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182666.3.peg.3973 Escherichia coli KTE59 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182667.3.peg.3852 Escherichia coli KTE60 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182668.3.peg.3521 Escherichia coli KTE61 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182669.3.peg.4268 Escherichia coli KTE62 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182670.3.peg.4105 Escherichia coli KTE63 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182671.3.peg.3386 Escherichia coli KTE64 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182672.3.peg.3386 Escherichia coli KTE65 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182673.3.peg.3911 Escherichia coli KTE66 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182674.3.peg.4309 Escherichia coli KTE67 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182675.3.peg.3747 Escherichia coli KTE68 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182676.3.peg.3898 Escherichia coli KTE69 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182677.3.peg.4013 Escherichia coli KTE70 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182678.3.peg.4083 Escherichia coli KTE71 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182679.3.peg.3622 Escherichia coli KTE72 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182680.3.peg.3440 Escherichia coli KTE73 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182681.3.peg.3652 Escherichia coli KTE74 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182682.3.peg.3975 Escherichia coli KTE75 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182683.3.peg.3500 Escherichia coli KTE76 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182684.3.peg.3710 Escherichia coli KTE77 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182685.3.peg.3702 Escherichia coli KTE78 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182686.3.peg.589 Escherichia coli KTE79 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182687.3.peg.3502 Escherichia coli KTE80 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182688.3.peg.3775 Escherichia coli KTE81 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182689.3.peg.3675 Escherichia coli KTE83 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182691.3.peg.3705 Escherichia coli KTE86 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182692.3.peg.3916 Escherichia coli KTE87 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182693.3.peg.3308 Escherichia coli KTE89 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182694.3.peg.3383 Escherichia coli KTE91 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182696.3.peg.3629 Escherichia coli KTE93 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182698.3.peg.1881 Escherichia coli KTE98 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182699.3.peg.4279 Escherichia coli KTE100 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182700.3.peg.2026 Escherichia coli KTE101 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182701.3.peg.4659 Escherichia coli KTE102 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182702.3.peg.4270 Escherichia coli KTE103 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182703.3.peg.3908 Escherichia coli KTE107 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182704.3.peg.249 Escherichia coli KTE108 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182706.3.peg.3892 Escherichia coli KTE111 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182707.3.peg.3423 Escherichia coli KTE115 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182709.3.peg.4359 Escherichia coli KTE118 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182710.3.peg.3822 Escherichia coli KTE119 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182711.3.peg.2969 Escherichia coli KTE121 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182712.3.peg.721 Escherichia coli KTE123 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182713.3.peg.802 Escherichia coli KTE126 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182714.3.peg.4404 Escherichia coli KTE127 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182717.3.peg.1388 Escherichia coli KTE134 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182719.3.peg.3553 Escherichia coli KTE136 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182720.3.peg.4013 Escherichia coli KTE140 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182721.3.peg.3735 Escherichia coli KTE141 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182722.3.peg.2517 Escherichia coli KTE142 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182723.3.peg.3693 Escherichia coli KTE143 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182726.3.peg.1936 Escherichia coli KTE147 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182728.3.peg.1165 Escherichia coli KTE154 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182729.3.peg.3562 Escherichia coli KTE155 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182730.3.peg.3900 Escherichia coli KTE156 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182733.3.peg.443 Escherichia coli KTE161 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182734.3.peg.3608 Escherichia coli KTE162 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182735.3.peg.549 Escherichia coli KTE165 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182736.3.peg.3536 Escherichia coli KTE169 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182737.3.peg.4176 Escherichia coli KTE170 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1182738.3.peg.3834 Escherichia coli KTE171 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1196033.3.peg.3337 Escherichia coli SEPT362 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1206108.3.peg.217 Escherichia coli J96 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1227813.3.peg.2926 Escherichia coli S17 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1227814.3.peg.3122 Escherichia coli O08 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1230480.3.peg.2486 Escherichia coli EC302/04 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1232150.3.peg.844 Escherichia coli O26:H11 str. CFSAN001629 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1232151.3.peg.1333 Escherichia coli O111:H11 str. CFSAN001630 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1232154.3.peg.1864 Escherichia coli O111:H8 str. CFSAN001632 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1235805.3.peg.2469 Escherichia coli SWW33 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1240385.3.peg.4240 Escherichia coli O157:H7 str. H093800014 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1240758.3.peg.2186 Escherichia coli O104:H4 str. Ec11-9450 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1240759.3.peg.1481 Escherichia coli O104:H4 str. Ec11-9941 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1240760.3.peg.2483 Escherichia coli O104:H4 str. Ec11-9990 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1240761.3.peg.2189 Escherichia coli O104:H4 str. Ec11-4984 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1240762.3.peg.3044 Escherichia coli O104:H4 str. Ec11-4986 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1240763.3.peg.1877 Escherichia coli O104:H4 str. Ec11-4987 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1240764.3.peg.3489 Escherichia coli O104:H4 str. Ec11-4988 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1240765.3.peg.4099 Escherichia coli O104:H4 str. Ec11-5603 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1240766.3.peg.2207 Escherichia coli O104:H4 str. Ec11-5604 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1240767.3.peg.1489 Escherichia coli O104:H4 str. Ec11-6006 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1240768.3.peg.1558 Escherichia coli O104:H4 str. 11-02030 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1240769.3.peg.1290 Escherichia coli O104:H4 str. 11-02033-1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1240770.3.peg.4966 Escherichia coli O104:H4 str. 11-02092 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1240771.3.peg.497 Escherichia coli O104:H4 str. 11-02093 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1240772.3.peg.1155 Escherichia coli O104:H4 str. 11-02281 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1240773.3.peg.2579 Escherichia coli O104:H4 str. 11-02318 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1240774.3.peg.922 Escherichia coli O104:H4 str. 11-02913 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1240775.3.peg.301 Escherichia coli O104:H4 str. 11-03439 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1240776.3.peg.836 Escherichia coli O104:H4 str. 11-04080 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1240777.3.peg.838 Escherichia coli O104:H4 str. 11-03943 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1240778.3.peg.4040 Escherichia coli O104:H4 str. Ec12-0465 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1240779.3.peg.2274 Escherichia coli O104:H4 str. Ec12-0466 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1246623.3.peg.663 Escherichia coli O10:K5(L):H4 str. ATCC 23506 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1258567.3.peg.1237 Escherichia coli LCT-EC52 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1258580.3.peg.1275 Escherichia coli LCT-EC59 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1268238.3.peg.1296 Escherichia coli O5:K4(L):H4 str. ATCC 23502 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1274814.3.peg.3976 Escherichia coli APEC O78 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1279005.3.peg.2429 Escherichia coli KTE172 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1308540.3.peg.1707 Escherichia coli HM26 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1308981.3.peg.1233 Escherichia coli HM27 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1308982.3.peg.1033 Escherichia coli HM46 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1308983.3.peg.1643 Escherichia coli HM65 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1308984.3.peg.114 Escherichia coli HM69 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1317130.3.peg.2106 Escherichia coli O157 str. NCCP15739 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1317131.3.peg.2069 Escherichia coli O157 str. NCCP15738 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|1322345.3.peg.3099 Escherichia coli ATCC 25922 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|155864.1.peg.3997 Escherichia coli O157:H7 EDL933 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|155864.8.peg.3926 Escherichia coli O157:H7 EDL933 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|198214.1.peg.2961 Shigella flexneri 2a str. 301 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|198214.7.peg.3747 Shigella flexneri 2a str. 301 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|198215.1.peg.2889 Shigella flexneri 2a str. 2457T Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|198215.6.peg.3684 Shigella flexneri 2a str. 2457T Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|198215.9.peg.3012 Shigella flexneri 2a str. 2457T Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|199310.1.peg.3785 Escherichia coli CFT073 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|199310.4.peg.3649 Escherichia coli CFT073 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|216592.1.peg.4039 Escherichia coli 042 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|216592.3.peg.3543 Escherichia coli 042 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|216593.1.peg.5021 Escherichia coli E2348/69 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|216598.1.peg.2509 Shigella dysenteriae M131649 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|300267.13.peg.3955 Shigella dysenteriae Sd197 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|300268.10.peg.3612 Shigella boydii Sb227 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|300268.11.peg.3647 Shigella boydii Sb227 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|316385.7.peg.3315 Escherichia coli str. K-12 substr. DH10B Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|316401.4.peg.3843 Escherichia coli ETEC H10407 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|316407.3.peg.3001 Escherichia coli W3110 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|316407.9.peg.3149 Escherichia coli str. K-12 substr. W3110 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|316435.3.peg.1909 Escherichia coli Nissle 1917 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|331111.12.peg.3857 Escherichia coli E24377A Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|331111.3.peg.1272 Escherichia coli E24377A Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|331112.3.peg.3090 Escherichia coli HS Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|331112.6.peg.3226 Escherichia coli HS Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|340184.3.peg.1919 Escherichia coli B7A Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|340184.6.peg.2011 Escherichia coli B7A Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|340197.3.peg.2312 Escherichia coli F11 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|340197.5.peg.2426 Escherichia coli F11 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|344609.11.peg.3570 Shigella boydii CDC 3083-94 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|344609.3.peg.1221 Shigella boydii BS512 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|344610.3.peg.2793 Escherichia coli 53638 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|344610.7.peg.3123 Escherichia coli 53638 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|358708.5.peg.3415 Shigella dysenteriae 1012 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|358709.5.peg.3492 Escherichia coli 101-1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|362663.8.peg.3240 Escherichia coli 536 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|362663.9.peg.3251 Escherichia coli 536 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|364106.7.peg.3516 Escherichia coli UTI89 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|364106.8.peg.3517 Escherichia coli UTI89 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|386585.9.peg.4171 Escherichia coli O157:H7 str. Sakai Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|405955.13.peg.3542 Escherichia coli APEC O1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|405955.9.peg.2943 Escherichia coli APEC O1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|409438.11.peg.3570 Escherichia coli SE11 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|413997.3.peg.3125 Escherichia coli B str. REL606 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|431946.3.peg.3088 Escherichia coli SE15 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|439855.10.peg.3571 Escherichia coli SMS-3-5 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|444447.5.peg.1419 Escherichia coli O157:H7 str. EC4206 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|444448.5.peg.1262 Escherichia coli O157:H7 str. EC4045 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|444449.5.peg.2509 Escherichia coli O157:H7 str. EC4042 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|444450.8.peg.4345 Escherichia coli O157:H7 str. EC4115 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|444451.5.peg.933 Escherichia coli O157:H7 str. EC4196 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|444452.5.peg.2306 Escherichia coli O157:H7 str. EC4113 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|444453.5.peg.2685 Escherichia coli O157:H7 str. EC4076 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|444454.5.peg.3050 Escherichia coli O157:H7 str. EC4024 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|457400.3.peg.1074 Escherichia sp. 1_1_43 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|457401.3.peg.3072 Escherichia sp. 4_1_40B Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|469008.4.peg.640 Escherichia coli BL21(DE3) Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|469598.5.peg.1093 Escherichia sp. 3_2_53FAA Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|475609.3.peg.3304 Escherichia coli chi7122 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|478004.5.peg.946 Escherichia coli O157:H7 str. EC4401 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|478005.5.peg.3437 Escherichia coli O157:H7 str. EC4486 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|478006.5.peg.2537 Escherichia coli O157:H7 str. EC4501 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|478007.5.peg.567 Escherichia coli O157:H7 str. EC508 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|478008.5.peg.1316 Escherichia coli O157:H7 str. EC869 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|481805.3.peg.618 Escherichia coli ATCC 8739 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|481805.6.peg.615 Escherichia coli ATCC 8739 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|502346.5.peg.3259 Escherichia coli O157:H7 str. TW14588 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|511145.12.peg.3211 Escherichia coli str. K-12 substr. MG1655 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|511145.6.peg.3196 Escherichia coli str. K-12 substr. MG1655 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|511693.5.peg.3135 Escherichia coli BL21 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|525281.3.peg.3646 Escherichia coli 83972 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|536056.3.peg.613 Escherichia coli DH1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|544404.4.peg.4155 Escherichia coli O157:H7 str. TW14359 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|550674.3.peg.159 Escherichia coli B093 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|550676.3.peg.3273 Escherichia coli B185 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|550677.3.peg.3681 Escherichia coli B354 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|550682.3.peg.1969 Escherichia coli B799 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|550687.3.peg.1608 Escherichia coli E482 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|556266.3.peg.2126 Shigella sp. D9 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|562.1188.peg.3347 Escherichia coli IMT2125 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|562.371.peg.2422 Escherichia coli 1044A Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|562.372.peg.2618 Escherichia coli 1212A Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|562.373.peg.1898 Escherichia coli 1125A Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|562.374.peg.4693 Escherichia coli 536A Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|562.375.peg.763 Escherichia coli EC4100B Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|562.376.peg.1512 Escherichia coli WV_060327 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|566546.3.peg.481 Escherichia coli W Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|566546.4.peg.3350 Escherichia coli W Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|570506.3.peg.813 Escherichia coli O157:H7 str. FRIK966 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|573235.3.peg.4322 Escherichia coli O26:H11 str. 11368 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|574521.7.peg.3478 Escherichia coli O127:H6 str. E2348/69 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|585034.4.peg.3202 Escherichia coli IAI1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|585034.5.peg.3200 Escherichia coli IAI1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|585035.6.peg.3441 Escherichia coli S88 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|585055.6.peg.3569 Escherichia coli 55989 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|585055.8.peg.3572 Escherichia coli 55989 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|585056.7.peg.3778 Escherichia coli UMN026 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|585057.4.peg.3740 Escherichia coli IAI39 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|585057.6.peg.3749 Escherichia coli IAI39 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|585396.4.peg.4078 Escherichia coli O111:H- str. 11128 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|585397.7.peg.3780 Escherichia coli ED1a Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|585397.9.peg.3777 Escherichia coli ED1a Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|591020.3.peg.3729 Shigella flexneri 2002017 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|591946.4.peg.3179 Escherichia coli LF82 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|595495.4.peg.805 Escherichia coli KO11 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|595495.5.peg.608 Escherichia coli KO11 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|595496.3.peg.3095 Escherichia coli BW2952 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|621.8.peg.3891 Shigella boydii ATCC 9905 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|623.7.peg.395 Shigella flexneri CDC 796-83 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|637388.3.peg.5208 Escherichia coli O157:H7 str. FRIK2000 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|655817.3.peg.3697 Escherichia coli ABU 83972 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|656372.3.peg.539 Escherichia coli E1167 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|656374.3.peg.2755 Escherichia coli E1520 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|656379.3.peg.3860 Escherichia coli FVEC1302 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|656380.3.peg.3777 Escherichia coli FVEC1412 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|656383.3.peg.1661 Escherichia coli H120 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|656388.3.peg.2093 Escherichia coli H252 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|656390.3.peg.1070 Escherichia coli H263 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|656393.3.peg.4174 Escherichia coli H299 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|656398.3.peg.3947 Escherichia coli H397 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|656404.3.peg.2565 Escherichia coli H489 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|656405.3.peg.3136 Escherichia coli H494 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|656408.3.peg.3536 Escherichia coli H591 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|656413.3.peg.2135 Escherichia coli H730 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|656414.3.peg.3587 Escherichia coli H736 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|656417.3.peg.3955 Escherichia coli M605 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|656421.3.peg.2953 Escherichia coli M919 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|656429.3.peg.3928 Escherichia coli TA007 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|656437.3.peg.3538 Escherichia coli TA143 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|656440.3.peg.3354 Escherichia coli TA206 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|656443.3.peg.3910 Escherichia coli TA271 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|656444.3.peg.4379 Escherichia coli TA280 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|6666666.5365.peg.840 Escherichia coli TY-2482-Mira-Assembly Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|6666666.5522.peg.3104 Escherichia coli TY-2482.contig.20110606 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|670888.3.peg.3133 Escherichia coli 1827-70 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|670890.3.peg.1858 Escherichia coli LT-68 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|670892.3.peg.2726 Escherichia coli 3431 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|670893.4.peg.3481 Escherichia coli EPECa14 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|670896.3.peg.3625 Escherichia coli EPECa12 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|670897.3.peg.4200 Escherichia coli 2362-75 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|670899.3.peg.2805 Escherichia coli RN587/1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|670903.3.peg.3621 Escherichia coli TX1999 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|670904.3.peg.2491 Escherichia coli 1180 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|670904.4.peg.2482 Escherichia coli OK1180 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|670905.3.peg.3402 Escherichia coli 1357 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|670905.4.peg.2417 Escherichia coli OK1357 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|679202.3.peg.996 Escherichia coli MS 85-1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|679204.3.peg.849 Escherichia coli MS 145-7 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|679205.4.peg.376 Escherichia coli MS 124-1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|679206.4.peg.1490 Escherichia coli MS 119-7 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|679207.4.peg.1968 Escherichia coli MS 107-1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|685038.3.peg.3164 Escherichia coli O83:H1 str. NRG 857C Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|696406.3.peg.3800 Escherichia coli UMNK88 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|701177.3.peg.3856 Escherichia coli O55:H7 str. CB9615 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|702430.3.peg.1096 Escherichia coli O157:H7 str. EC4009 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|702431.3.peg.307 Escherichia coli O157:H7 str. EC4192 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|702432.3.peg.3385 Escherichia coli O157:H7 str. EC4084 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|702433.3.peg.3823 Escherichia coli O157:H7 str. EC4127 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|702434.4.peg.921 Escherichia coli O157:H7 str. EC4191 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|702435.3.peg.3596 Escherichia coli O157:H7 str. EC4205 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|702436.3.peg.1250 Escherichia coli O157:H7 str. EC536 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|714962.3.peg.3580 Escherichia coli IHE3034 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|741093.3.peg.4024 Escherichia coli Xuzhou21 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|749527.3.peg.2763 Escherichia coli MS 21-1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|749528.3.peg.395 Escherichia coli MS 45-1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|749529.3.peg.1343 Escherichia coli MS 57-2 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|749530.3.peg.3467 Escherichia coli MS 60-1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|749531.3.peg.2537 Escherichia coli MS 69-1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|749532.3.peg.544 Escherichia coli MS 78-1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|749533.3.peg.3507 Escherichia coli MS 84-1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|749536.3.peg.1021 Escherichia coli MS 110-3 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|749537.3.peg.515 Escherichia coli MS 115-1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|749538.3.peg.969 Escherichia coli MS 116-1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|749539.3.peg.2693 Escherichia coli MS 117-3 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|749540.3.peg.1400 Escherichia coli MS 146-1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|749541.3.peg.489 Escherichia coli MS 153-1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|749542.3.peg.2808 Escherichia coli MS 16-3 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|749544.3.peg.742 Escherichia coli MS 175-1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|749545.3.peg.568 Escherichia coli MS 182-1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|749546.3.peg.2108 Escherichia coli MS 185-1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|749547.3.peg.4065 Escherichia coli MS 187-1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|749549.3.peg.1950 Escherichia coli MS 198-1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|752783.3.peg.1983 Escherichia coli KD1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|752784.3.peg.3218 Escherichia coli KD2 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|752786.3.peg.1018 Escherichia coli 541-1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|752787.3.peg.2807 Escherichia coli 576-1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|752788.3.peg.1792 Escherichia coli 75 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|752789.3.peg.2850 Escherichia coli HM605 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|752790.3.peg.366 Escherichia coli CUMT8 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|753642.3.peg.4844 Escherichia coli NC101 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|754078.3.peg.3418 Escherichia coli G58-1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|754079.3.peg.4237 Escherichia coli 2534-86 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|754080.3.peg.3706 Escherichia coli 3030-1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|754081.3.peg.3444 Escherichia coli STEC_O31 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|754083.3.peg.3690 Escherichia coli STEC_94C Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|754084.3.peg.3321 Escherichia coli STEC_B2F1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|754085.3.peg.3871 Escherichia coli STEC_C165-02 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|754086.3.peg.4317 Escherichia coli STEC_DG131-3 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|754087.3.peg.3751 Escherichia coli STEC_EH250 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|754089.3.peg.3479 Escherichia coli STEC_MHI813 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|754090.3.peg.4034 Escherichia coli STEC_S1191 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|754091.3.peg.3218 Shigella flexneri CCH060 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|754092.3.peg.3588 Shigella flexneri J1713 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|754093.3.peg.2075 Shigella dysenteriae 1617 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|766139.3.peg.3407 Shigella boydii 3594-74 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|766139.3.peg.3423 Shigella boydii 3594-74 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|766140.3.peg.3462 Shigella boydii 4444-74 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|766141.3.peg.3816 Shigella boydii 5216-82 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|766142.3.peg.3645 Shigella dysenteriae 155-74 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|766143.3.peg.3514 Shigella dysenteriae 225-75 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|766146.3.peg.4221 Shigella flexneri K-218 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|766149.3.peg.3912 Shigella flexneri K-304 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|766151.3.peg.4039 Shigella flexneri K-404 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|766152.3.peg.3782 Shigella flexneri K-671 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|766155.3.peg.3545 Shigella flexneri 1485-80 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|766157.3.peg.3656 Shigella flexneri 2747-71 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|766158.3.peg.3639 Shigella flexneri 2850-71 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|766159.3.peg.3646 Shigella flexneri 2930-71 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|766161.3.peg.3670 Shigella flexneri 6603-63 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|796392.4.peg.4548 Escherichia coli MS 79-10 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|83333.1.peg.3063 Escherichia coli K12 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|83334.1.peg.3971 Escherichia coli O157:H7 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868133.3.peg.3593 Escherichia coli DEC1A Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868134.3.peg.3661 Escherichia coli DEC1B Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868135.3.peg.3907 Escherichia coli DEC1C Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868136.3.peg.4093 Escherichia coli DEC1D Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868137.3.peg.3771 Escherichia coli DEC1E Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868138.3.peg.3728 Escherichia coli DEC2A Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868139.3.peg.3716 Escherichia coli DEC2B Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868140.3.peg.3665 Escherichia coli DEC2C Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868141.3.peg.3790 Escherichia coli DEC2D Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868142.3.peg.3248 Escherichia coli DEC2E Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868143.3.peg.3969 Escherichia coli DEC3A Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868144.3.peg.4097 Escherichia coli DEC3B Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868145.3.peg.4333 Escherichia coli DEC3C Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868146.3.peg.4046 Escherichia coli DEC3D Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868147.3.peg.4270 Escherichia coli DEC3E Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868148.3.peg.4272 Escherichia coli DEC3F Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868149.3.peg.3776 Escherichia coli DEC4A Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868150.3.peg.3979 Escherichia coli DEC4B Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868152.3.peg.3677 Escherichia coli DEC4D Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868153.3.peg.4075 Escherichia coli DEC4E Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868154.3.peg.3852 Escherichia coli DEC4F Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868155.3.peg.3792 Escherichia coli DEC5A Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868156.3.peg.4072 Escherichia coli DEC5B Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868157.3.peg.3887 Escherichia coli DEC5C Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868158.3.peg.3875 Escherichia coli DEC5D Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868159.3.peg.3784 Escherichia coli DEC5E Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868160.3.peg.3757 Escherichia coli DEC6A Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868161.3.peg.4055 Escherichia coli DEC6B Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868162.3.peg.3861 Escherichia coli DEC6C Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868163.3.peg.3770 Escherichia coli DEC6D Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868164.3.peg.3598 Escherichia coli DEC6E Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868165.3.peg.3798 Escherichia coli DEC7A Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868166.3.peg.3308 Escherichia coli DEC7B Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868167.3.peg.3585 Escherichia coli DEC7C Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868168.3.peg.3780 Escherichia coli DEC7D Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868169.3.peg.3450 Escherichia coli DEC7E Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868170.3.peg.3725 Escherichia coli DEC8A Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868171.3.peg.4113 Escherichia coli DEC8B Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868172.3.peg.4599 Escherichia coli DEC8C Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868173.3.peg.4147 Escherichia coli DEC8D Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868174.3.peg.4192 Escherichia coli DEC8E Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868175.3.peg.4012 Escherichia coli DEC9A Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868176.3.peg.3937 Escherichia coli DEC9B Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868177.3.peg.3810 Escherichia coli DEC9C Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868178.3.peg.3975 Escherichia coli DEC9D Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868179.3.peg.4143 Escherichia coli DEC9E Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868180.3.peg.4116 Escherichia coli DEC10A Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868181.3.peg.4595 Escherichia coli DEC10B Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868182.3.peg.4571 Escherichia coli DEC10C Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868183.3.peg.4082 Escherichia coli DEC10D Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868184.3.peg.3621 Escherichia coli DEC10E Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868185.3.peg.4533 Escherichia coli DEC10F Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868196.3.peg.3392 Escherichia coli DEC13A Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868197.3.peg.3160 Escherichia coli DEC13B Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868198.3.peg.3809 Escherichia coli DEC13C Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868199.3.peg.3480 Escherichia coli DEC13D Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868200.3.peg.3538 Escherichia coli DEC13E Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868201.3.peg.3365 Escherichia coli DEC14A Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868202.3.peg.3804 Escherichia coli DEC14B Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868203.3.peg.3684 Escherichia coli DEC14C Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868206.3.peg.3798 Escherichia coli DEC15A Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868207.3.peg.3601 Escherichia coli DEC15B Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868208.3.peg.3513 Escherichia coli DEC15C Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868209.3.peg.3458 Escherichia coli DEC15D Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|868210.3.peg.3794 Escherichia coli DEC15E Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869670.3.peg.4627 Escherichia coli 97.0246 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869670.4.peg.2716 Escherichia coli 97.0246 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869671.3.peg.2537 Escherichia coli 5.0588 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869671.4.peg.2510 Escherichia coli 5.0588 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869672.3.peg.4893 Escherichia coli 97.0259 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869672.4.peg.1700 Escherichia coli 97.0259 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869673.3.peg.4021 Escherichia coli H30 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869674.3.peg.4409 Escherichia coli 95.0941 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869675.3.peg.3432 Escherichia coli 1.2264 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869675.4.peg.2305 Escherichia coli 1.2264 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869676.4.peg.1610 Escherichia coli 97.0264 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869677.3.peg.2498 Escherichia coli 96.0497 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869677.4.peg.3375 Escherichia coli 96.0497 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869678.3.peg.317 Escherichia coli 99.0741 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869678.4.peg.2118 Escherichia coli 99.0741 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869681.3.peg.5892 Escherichia coli 4.0522 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869681.4.peg.3990 Escherichia coli 4.0522 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869683.3.peg.3739 Escherichia coli 96.154 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869683.4.peg.1821 Escherichia coli 96.154 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869685.3.peg.4266 Escherichia coli 9.1649 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869686.3.peg.3510 Escherichia coli 9.0111 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869686.4.peg.4410 Escherichia coli 9.0111 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869688.4.peg.4995 Escherichia coli 2.3916 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869688.5.peg.4650 Escherichia coli 2.3916 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869690.3.peg.311 Escherichia coli 2.4168 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869690.4.peg.2129 Escherichia coli 2.4168 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869691.3.peg.999 Escherichia coli 3.2303 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869691.4.peg.1233 Escherichia coli 3.2303 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869692.3.peg.667 Escherichia coli 3003 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869692.4.peg.1418 Escherichia coli 3003 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869693.3.peg.2195 Escherichia coli TW07793 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869693.5.peg.581 Escherichia coli TW07793 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869694.3.peg.4238 Escherichia coli B41 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869694.4.peg.3025 Escherichia coli B41 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869695.3.peg.4651 Escherichia coli 900105 (10e) Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869695.4.peg.2523 Escherichia coli 900105 (10e) Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|869729.3.peg.157 Escherichia coli UM146 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|879462.4.peg.3147 Escherichia coli str. K-12 substr. MG1655star Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|885275.3.peg.3420 Escherichia coli str. 'clone D i14' Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|885276.3.peg.3424 Escherichia coli str. 'clone D i2' Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|910348.4.peg.3564 Escherichia coli P12b Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|913087.3.peg.1959 Escherichia coli TW14425 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|913088.3.peg.3436 Escherichia coli TW11681 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|913089.3.peg.1116 Escherichia coli TW10828 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|913090.3.peg.1697 Escherichia coli TW10722 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|913091.3.peg.1335 Escherichia coli TW10598 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|926026.3.peg.1799 Escherichia coli O157:H7 str. G5101 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|926027.3.peg.1855 Escherichia coli O157:H- str. 493-89 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|926028.3.peg.1938 Escherichia coli O157:H- str. H 2687 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|926029.3.peg.1920 Escherichia coli O55:H7 str. 3256-97 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|926030.3.peg.1718 Escherichia coli O55:H7 str. USDA 5905 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|926032.3.peg.1926 Escherichia coli O157:H7 str. LSU-61 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|932676.3.peg.5251 Shigella boydii ATCC 9905 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|941322.6.peg.3572 Escherichia coli O25b:H4-ST131 str. EC958 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|941435.3.peg.4474 Escherichia coli O157:H7 str. EC1212 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|945360.3.peg.475 Shigella flexneri CDC 796-83 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|945433.3.peg.3027 Escherichia coli WV_060327 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|945434.3.peg.673 Escherichia coli EC4100B Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|993513.3.peg.3318 Escherichia coli cloneA_i1 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|997824.3.peg.662 Escherichia coli O157:H7 str. 1044 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
fig|997825.3.peg.5440 Escherichia coli O157:H7 str. 1125 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)