page	:SeedViewerServeFeature:
fid	:fig|1005466.3.peg.4903:
show_prot_sequence	:1:

>fig|1005466.3.peg.4903
MTTKKADYIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQR
LHDSAKIYRFPVSQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDV
IIAAFPWGAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGY
QEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVREQ
VLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTGETEDK
WGWLDQVNQ


PEGs with Identical Sequence
PEG Genome Function
fig|1001989.3.peg.3724 Escherichia coli PCN033 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1004153.3.peg.4088 Escherichia coli AA86 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005396.3.peg.4740 Escherichia coli 88.1467 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005397.3.peg.4649 Escherichia coli 88.0221 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005398.3.peg.4679 Escherichia coli 88.1042 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005399.3.peg.4604 Escherichia coli 89.0511 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005400.3.peg.4938 Escherichia coli 90.0091 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005401.3.peg.4538 Escherichia coli 90.0039 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005402.3.peg.4724 Escherichia coli 90.2281 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005403.3.peg.4541 Escherichia coli 93.0055 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005404.3.peg.4710 Escherichia coli 93.0056 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005405.3.peg.4654 Escherichia coli 94.0618 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005406.3.peg.4783 Escherichia coli 95.0183 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005407.3.peg.4214 Escherichia coli 95.1288 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005408.3.peg.4804 Escherichia coli 95.0943 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005410.3.peg.4689 Escherichia coli 96.0428 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005411.3.peg.4661 Escherichia coli 96.0427 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005412.3.peg.4770 Escherichia coli 96.0939 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005413.3.peg.4721 Escherichia coli 96.0932 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005414.3.peg.4698 Escherichia coli 96.0109 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005415.3.peg.4691 Escherichia coli 96.0107 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005416.3.peg.4645 Escherichia coli 97.0003 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005418.3.peg.1799 Escherichia coli 97.1742 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005419.3.peg.4594 Escherichia coli 97.0010 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005420.3.peg.4400 Escherichia coli 97.0007 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005421.3.peg.4629 Escherichia coli 99.0672 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005422.3.peg.4702 Escherichia coli 99.0678 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005423.3.peg.4771 Escherichia coli 99.0670 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005424.3.peg.4554 Escherichia coli 99.0713 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005430.3.peg.4470 Escherichia coli 99.0816 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005431.3.peg.4659 Escherichia coli 99.0848 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005432.3.peg.4523 Escherichia coli 99.0839 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005433.3.peg.4395 Escherichia coli 99.0815 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005434.3.peg.4566 Escherichia coli 99.0814 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005435.3.peg.4707 Escherichia coli 99.1762 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005436.3.peg.4369 Escherichia coli 99.1805 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005437.3.peg.4763 Escherichia coli 99.1793 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005438.3.peg.4230 Escherichia coli 99.1775 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005439.3.peg.4701 Escherichia coli 99.1781 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005440.3.peg.4448 Escherichia coli 99.1753 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005441.3.peg.4788 Escherichia coli 0.1304 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005442.3.peg.4110 Escherichia coli 0.1288 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005450.3.peg.4771 Escherichia coli 3.4870 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005452.3.peg.4785 Escherichia coli 5.2239 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005455.3.peg.4843 Escherichia coli 6.0172 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005460.3.peg.4630 Escherichia coli 8.2524 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005461.3.peg.4901 Escherichia coli 8.0586 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005462.3.peg.3978 Escherichia coli 8.0566 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005463.3.peg.4519 Escherichia coli 8.0416 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005464.3.peg.3949 Escherichia coli 8.0569 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005466.3.peg.4903 Escherichia coli 10.0833 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005467.3.peg.4546 Escherichia coli 10.0869 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005469.3.peg.4512 Escherichia coli 10.0821 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005470.3.peg.4813 Escherichia coli FDA504 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005471.3.peg.4554 Escherichia coli FDA505 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005472.3.peg.4782 Escherichia coli FDA507 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005473.3.peg.4840 Escherichia coli FDA517 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005474.3.peg.5106 Escherichia coli FDA506 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005475.3.peg.4707 Escherichia coli FRIK1996 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005476.3.peg.4756 Escherichia coli FRIK1985 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005477.3.peg.4848 Escherichia coli FRIK1999 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005478.3.peg.4507 Escherichia coli FRIK1990 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005479.3.peg.5187 Escherichia coli FRIK2001 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005480.3.peg.4851 Escherichia coli FRIK1997 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005481.3.peg.4744 Escherichia coli 93-001 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005482.3.peg.4855 Escherichia coli FRIK523 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005483.3.peg.5116 Escherichia coli FRIK920 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005484.3.peg.4987 Escherichia coli NE037 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005485.3.peg.4988 Escherichia coli NE1487 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005486.3.peg.4741 Escherichia coli NE098 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005487.3.peg.4599 Escherichia coli PA2 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005488.3.peg.4610 Escherichia coli PA3 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005489.3.peg.4804 Escherichia coli PA4 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005490.3.peg.4574 Escherichia coli PA5 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005491.3.peg.5892 Escherichia coli PA7 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005492.3.peg.4818 Escherichia coli PA8 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005493.3.peg.4784 Escherichia coli PA9 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005494.3.peg.4764 Escherichia coli PA10 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005495.3.peg.4700 Escherichia coli PA14 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005496.3.peg.4833 Escherichia coli PA15 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005497.3.peg.5122 Escherichia coli PA22 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005498.3.peg.4657 Escherichia coli PA23 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005499.3.peg.4488 Escherichia coli PA24 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005500.3.peg.4453 Escherichia coli PA25 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005501.3.peg.4698 Escherichia coli PA28 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005502.3.peg.4553 Escherichia coli PA31 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005503.3.peg.4609 Escherichia coli PA32 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005504.3.peg.4566 Escherichia coli PA33 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005505.3.peg.4817 Escherichia coli PA34 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005506.3.peg.4428 Escherichia coli PA38 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005507.3.peg.4557 Escherichia coli PA39 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005508.3.peg.5076 Escherichia coli PA40 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005509.3.peg.4637 Escherichia coli PA41 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005510.3.peg.4853 Escherichia coli PA42 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005511.3.peg.4868 Escherichia coli PA45 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005512.3.peg.4508 Escherichia coli PA47 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005513.3.peg.4213 Escherichia coli PA48 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005515.3.peg.4590 Escherichia coli TW06591 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005516.3.peg.4635 Escherichia coli TW07945 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005517.3.peg.108 Escherichia coli TW10246 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005518.3.peg.158 Escherichia coli TW11039 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005519.3.peg.4702 Escherichia coli TW09098 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005520.3.peg.5202 Escherichia coli TW09109 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005521.3.peg.4315 Escherichia coli TW09195 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005522.3.peg.5379 Escherichia coli TW10119 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005523.3.peg.4541 Escherichia coli EC4203 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005524.3.peg.4526 Escherichia coli EC4196 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005525.3.peg.4430 Escherichia coli TW14313 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005526.3.peg.4538 Escherichia coli TW14301 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005527.3.peg.4481 Escherichia coli EC4421 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005528.3.peg.4728 Escherichia coli EC4422 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005529.3.peg.4841 Escherichia coli EC4013 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005530.3.peg.4555 Escherichia coli EC4402 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005531.3.peg.4493 Escherichia coli EC4439 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005532.3.peg.4582 Escherichia coli EC4436 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005533.3.peg.4803 Escherichia coli EC4437 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005534.3.peg.4675 Escherichia coli EC4448 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005535.3.peg.4867 Escherichia coli EC1738 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005536.3.peg.4963 Escherichia coli EC1734 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005537.3.peg.4697 Escherichia coli EC1735 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005538.3.peg.4663 Escherichia coli EC1736 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005539.3.peg.4573 Escherichia coli EC1737 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005540.3.peg.4496 Escherichia coli EC1845 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005541.3.peg.4616 Escherichia coli EC1846 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005542.3.peg.4632 Escherichia coli EC1847 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005543.3.peg.4891 Escherichia coli EC1848 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005544.3.peg.4645 Escherichia coli EC1849 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005545.3.peg.4804 Escherichia coli EC1850 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005546.3.peg.4666 Escherichia coli EC1856 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005547.3.peg.4527 Escherichia coli EC1862 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005548.3.peg.4378 Escherichia coli EC1863 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005549.3.peg.4813 Escherichia coli EC1864 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005550.3.peg.4801 Escherichia coli EC1865 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005551.3.peg.4522 Escherichia coli EC1866 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005553.3.peg.4817 Escherichia coli EC1869 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005554.3.peg.4594 Escherichia coli EC1870 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005555.3.peg.4785 Escherichia coli TT12B Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005557.3.peg.5006 Escherichia coli MA6 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005558.3.peg.5120 Escherichia coli 5905 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005559.3.peg.4650 Escherichia coli CB7326 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005561.3.peg.4626 Escherichia coli 5412 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005562.3.peg.4167 Escherichia coli TW15901 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005563.3.peg.4155 Escherichia coli ARS4.2123 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005564.3.peg.4293 Escherichia coli TW00353 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005565.3.peg.4313 Escherichia coli 3006 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005566.3.peg.4292 Escherichia coli 07798 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1005567.3.peg.3913 Escherichia coli N1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1033813.3.peg.3946 Escherichia coli NA114 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1038844.15.peg.4887 Escherichia coli O104:H4 str. TY-2482 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1038844.18.peg.3296 Escherichia coli O104:H4 str. TY-2482 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1038844.4.peg.1157 Escherichia coli TY-2482 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1038927.4.peg.3111 Escherichia coli O104:H4 str. GOS1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1038927.5.peg.4247 Escherichia coli O104:H4 str. GOS2 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1038927.6.peg.4312 Escherichia coli O104:H4 str. H112180282 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1038927.7.peg.4645 Escherichia coli O104:H4 str. H112180283 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1038927.8.peg.4685 Escherichia coli O104:H4 str. H112180540 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1038927.9.peg.1974 Escherichia coli O104:H4 str. C227-11 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1040638.5.peg.4330 Escherichia coli O104:H4 str. LB226692 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1042803.5.peg.4226 Escherichia coli O104:H4 str. 01-09591 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1042804.3.peg.4973 Escherichia coli O104:H4 str. H112180280 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1048254.3.peg.2913 Escherichia coli O104:H4 str. C227-11 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1048256.3.peg.4793 Escherichia coli O104:H4 str. C236-11 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1048265.3.peg.3292 Escherichia coli O104:H4 str. 04-8351 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1048266.3.peg.4712 Escherichia coli O104:H4 str. 09-7901 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1048334.3.peg.4785 Escherichia coli O104:H4 str. 11-3677 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1048765.4.peg.837 Escherichia coli O104:H4 str. H112180541 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1050617.5.peg.4618 Escherichia coli UMNF18 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1051346.3.peg.4480 Escherichia coli 95.0083 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1051347.3.peg.4579 Escherichia coli 3.4880 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1051348.3.peg.4695 Escherichia coli 7.1982 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1051349.3.peg.4547 Escherichia coli PA11 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1051350.3.peg.4390 Escherichia coli PA13 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1051351.3.peg.4516 Escherichia coli PA19 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1051352.3.peg.4876 Escherichia coli PA35 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1051353.3.peg.4384 Escherichia coli ATCC 700728 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1055539.3.peg.3439 Escherichia coli O91 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1055539.4.peg.3645 Escherichia coli O91 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1068608.3.peg.2417 Escherichia coli XH140A Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1068614.3.peg.2596 Escherichia coli O104:H4 str. 11-4404 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1068615.3.peg.2606 Escherichia coli O104:H4 str. 11-4522 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1068616.3.peg.3351 Escherichia coli O104:H4 str. 11-4623 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1068617.3.peg.1031 Escherichia coli O104:H4 str. 11-4632 C1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1068618.3.peg.974 Escherichia coli O104:H4 str. 11-4632 C2 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1068619.3.peg.2597 Escherichia coli O104:H4 str. 11-4632 C3 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1068620.3.peg.4256 Escherichia coli O104:H4 str. 11-4632 C4 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1068621.3.peg.983 Escherichia coli O104:H4 str. 11-4632 C5 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1068622.3.peg.2925 Escherichia coli O104:H4 str. Ec11-5538 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1068623.3.peg.4764 Escherichia coli O104:H4 str. Ec11-5536 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1068624.3.peg.4765 Escherichia coli O104:H4 str. Ec11-5537 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1069495.4.peg.4418 Escherichia coli XH001 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1072459.4.peg.4463 Escherichia coli O7:K1 str. CE10 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1078029.12.peg.1976 Escherichia coli O113:H21 str. CL-3 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1078030.10.peg.229 Escherichia coli O91:H21 str. B2F1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1078031.3.peg.81 Escherichia coli O121:H19 str. MT#2 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1078035.3.peg.3793 Escherichia coli O145:H28 str. 4865/96 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1081887.3.peg.4634 Escherichia coli 09BKT078844 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1089445.3.peg.4178 Escherichia coli AI27 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1090926.6.peg.851 Escherichia coli W26 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1090929.3.peg.3940 Escherichia coli O127:H27 str. C43/90 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1090930.3.peg.3896 Escherichia coli ONT:H33 str. C48/93 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1101440.4.peg.4045 Escherichia coli O103:H25 str. NIPH-11060424 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1110693.3.peg.3199 Escherichia coli str. K-12 substr. MDS42 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1115997.3.peg.4935 Escherichia coli Envira 8/11 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1115998.3.peg.4935 Escherichia coli Envira 10/1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1115999.3.peg.4253 Escherichia coli Jurua 18/11 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116000.3.peg.4227 Escherichia coli Jurua 20/10 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116001.3.peg.4660 Escherichia coli ThroopD Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116002.3.peg.4809 Escherichia coli C-34666 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116003.3.peg.4218 Escherichia coli 174900 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116004.3.peg.4155 Escherichia coli 2729250 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116005.3.peg.3787 Escherichia coli 2730350 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116006.3.peg.4410 Escherichia coli 2730450 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116007.3.peg.4691 Escherichia coli 2731150 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116008.3.peg.4113 Escherichia coli 2735000 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116009.3.peg.4386 Escherichia coli 2741950 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116010.3.peg.4094 Escherichia coli 2747800 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116011.3.peg.4178 Escherichia coli 2749250 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116012.3.peg.4498 Escherichia coli 2756500 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116013.3.peg.4321 Escherichia coli 2762100 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116014.3.peg.4062 Escherichia coli 2770900 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116015.3.peg.4090 Escherichia coli 2780750 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116017.3.peg.4102 Escherichia coli 2788150 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116019.3.peg.4390 Escherichia coli 2850750 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116020.3.peg.4424 Escherichia coli 2853500 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116021.3.peg.4185 Escherichia coli 2860050 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116022.3.peg.4475 Escherichia coli 2860650 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116025.3.peg.4377 Escherichia coli 2864350 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116027.3.peg.4322 Escherichia coli 2866350 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116028.3.peg.4379 Escherichia coli 2866450 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116029.3.peg.4405 Escherichia coli 2866550 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116030.3.peg.4243 Escherichia coli 2866750 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116031.3.peg.4317 Escherichia coli 2867750 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116032.3.peg.4268 Escherichia coli 2871950 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116033.3.peg.4354 Escherichia coli 2872000 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116034.3.peg.4357 Escherichia coli 2872800 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116035.3.peg.4349 Escherichia coli 2875000 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116037.3.peg.4135 Escherichia coli BCE001_MS16 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116038.3.peg.4141 Escherichia coli P0299438.3 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116039.3.peg.4316 Escherichia coli P0299438.4 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116040.3.peg.4168 Escherichia coli P0299438.5 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116041.3.peg.4082 Escherichia coli P0299438.6 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116042.3.peg.4358 Escherichia coli P0299438.7 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116043.3.peg.4416 Escherichia coli P0299438.8 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116044.3.peg.4027 Escherichia coli P0299438.9 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116045.3.peg.4145 Escherichia coli P0299438.10 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116046.3.peg.4107 Escherichia coli P0299438.11 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116047.3.peg.4777 Escherichia coli P0299917.1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116048.3.peg.4180 Escherichia coli P0299917.2 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116049.3.peg.3803 Escherichia coli P0299917.3 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116051.3.peg.4113 Escherichia coli P0299917.5 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116052.3.peg.4166 Escherichia coli P0299917.6 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116053.3.peg.4153 Escherichia coli P0299917.7 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116056.3.peg.4797 Escherichia coli P0299917.10 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116066.3.peg.4648 Escherichia coli P0301867.1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116067.3.peg.4231 Escherichia coli P0301867.3 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116068.3.peg.4478 Escherichia coli P0301867.4 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116069.3.peg.4523 Escherichia coli P0301867.5 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116070.3.peg.4195 Escherichia coli P0301867.7 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116071.3.peg.4284 Escherichia coli P0301867.8 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116072.3.peg.4227 Escherichia coli P0301867.11 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116073.3.peg.4251 Escherichia coli P0302293.2 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116074.3.peg.4053 Escherichia coli P0302293.3 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116075.3.peg.4553 Escherichia coli P0302293.4 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116076.3.peg.4156 Escherichia coli P0302293.6 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116077.3.peg.4409 Escherichia coli P0302293.8 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116078.3.peg.4091 Escherichia coli P0302293.9 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116079.3.peg.4320 Escherichia coli P0302293.10 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116080.3.peg.3962 Escherichia coli P0305260.6 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116083.3.peg.4001 Escherichia coli P0305260.9 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116084.3.peg.4016 Escherichia coli P0305260.10 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116085.3.peg.4052 Escherichia coli P0305260.11 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116086.3.peg.4014 Escherichia coli P0305260.12 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116087.3.peg.4043 Escherichia coli P0305260.13 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116088.3.peg.4035 Escherichia coli P0305260.15 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116089.3.peg.4619 Escherichia coli p0305293.1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116090.3.peg.4402 Escherichia coli p0305293.2 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116091.3.peg.4421 Escherichia coli p0305293.3 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116092.3.peg.4385 Escherichia coli p0305293.4 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116093.3.peg.4414 Escherichia coli p0305293.5 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116094.3.peg.3849 Escherichia coli p0305293.6 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116095.3.peg.4410 Escherichia coli p0305293.7 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116096.3.peg.4496 Escherichia coli p0305293.8 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116097.3.peg.3874 Escherichia coli p0305293.9 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116098.3.peg.4407 Escherichia coli p0305293.10 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116099.3.peg.4304 Escherichia coli p0305293.11 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116100.3.peg.4445 Escherichia coli p0305293.12 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116101.3.peg.3774 Escherichia coli p0305293.13 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116102.3.peg.4110 Escherichia coli p0305293.15 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116103.3.peg.4184 Escherichia coli 180050 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116104.3.peg.4234 Escherichia coli 180200 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116105.3.peg.4368 Escherichia coli 180600 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116106.3.peg.3707 Escherichia coli 178850 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116107.3.peg.3574 Escherichia coli 178200 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116108.3.peg.4343 Escherichia coli 178900 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116109.3.peg.4301 Escherichia coli 179550 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116113.3.peg.4324 Escherichia coli BCE007_MS-11 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116115.3.peg.4231 Escherichia coli BCE019_MS-13 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116116.3.peg.4177 Escherichia coli BCE030_MS-09 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116117.3.peg.4158 Escherichia coli BCE032_MS-12 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116118.3.peg.4625 Escherichia coli BCE034_MS-14 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116119.3.peg.4620 Escherichia coli 2719100 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116120.3.peg.4449 Escherichia coli 2720900 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116121.3.peg.4300 Escherichia coli 2722950 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116122.3.peg.4639 Escherichia coli 2726800 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116123.3.peg.4358 Escherichia coli 2726950 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116126.3.peg.4098 Escherichia coli 2846750 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116128.3.peg.4311 Escherichia coli 2851500 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116129.3.peg.4693 Escherichia coli 201600.1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116131.3.peg.4767 Escherichia coli P02997067.6 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116132.3.peg.4857 Escherichia coli MP021552.7 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116133.3.peg.4305 Escherichia coli MP021552.8 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116134.3.peg.2275 Escherichia coli MP021552.11 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116136.3.peg.4608 Escherichia coli MP021561.2 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116137.3.peg.4672 Escherichia coli MP021561.3 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116138.3.peg.4763 Escherichia coli MP021566.1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116139.3.peg.4644 Escherichia coli MP020980.2 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116140.3.peg.4445 Escherichia coli MP020940.1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116152.3.peg.3936 Escherichia coli P0299438.2 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116153.3.peg.4718 Escherichia coli P0302308.1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116154.3.peg.4206 Escherichia coli P0302308.2 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116156.3.peg.4398 Escherichia coli P0302308.4 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116157.3.peg.4465 Escherichia coli P0302308.5 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116158.3.peg.4130 Escherichia coli P0302308.10 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116159.3.peg.4190 Escherichia coli P0302308.11 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116160.3.peg.4098 Escherichia coli P0302308.12 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116161.3.peg.4325 Escherichia coli P0302308.13 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116162.3.peg.4179 Escherichia coli P0302308.14 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116163.3.peg.4210 Escherichia coli P0304777.1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116164.3.peg.4374 Escherichia coli P0304777.2 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116165.3.peg.4400 Escherichia coli P0304777.3 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116166.3.peg.4062 Escherichia coli P0304777.4 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116167.3.peg.4358 Escherichia coli P0304777.5 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116168.3.peg.4032 Escherichia coli P0304777.7 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116169.3.peg.3863 Escherichia coli P0304777.8 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116170.3.peg.3967 Escherichia coli P0304777.9 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116172.3.peg.4449 Escherichia coli P0304777.11 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116173.3.peg.4040 Escherichia coli P0304777.12 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116174.3.peg.4035 Escherichia coli P0304777.13 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116175.3.peg.4430 Escherichia coli P0304777.14 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116176.3.peg.4390 Escherichia coli P0304777.15 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116177.3.peg.4761 Escherichia coli P0304816.1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116178.3.peg.4426 Escherichia coli P0304816.2 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116181.3.peg.4486 Escherichia coli P0304816.5 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116186.3.peg.4068 Escherichia coli P0304816.10 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116187.3.peg.4440 Escherichia coli P0304816.11 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116188.3.peg.4087 Escherichia coli P0304816.12 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116189.3.peg.4070 Escherichia coli P0304816.13 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116190.3.peg.4361 Escherichia coli P0304816.14 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116191.3.peg.4044 Escherichia coli P0304816.15 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116192.3.peg.4026 Escherichia coli P0305260.3 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116193.3.peg.4016 Escherichia coli P0305260.4 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1116194.3.peg.4011 Escherichia coli P0305260.5 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1125634.3.peg.4557 Escherichia coli 174750 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1125636.3.peg.4308 Escherichia coli 2854350 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1125637.3.peg.4175 Escherichia coli BCE006_MS-23 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1125638.3.peg.4809 Escherichia coli MP020980.1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1125641.3.peg.4251 Escherichia coli P0301867.2 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1125642.3.peg.4307 Escherichia coli P0301867.13 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1125643.3.peg.4119 Escherichia coli P0302293.7 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1125644.3.peg.3926 Escherichia coli P0305260.1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1125646.3.peg.4522 Escherichia coli p0305293.14 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1125648.3.peg.4361 Escherichia coli P0299483.1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1125649.3.peg.4476 Escherichia coli P0299483.2 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1125650.3.peg.4266 Escherichia coli P0299483.3 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1125651.3.peg.4608 Escherichia coli P0304799.3 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1126911.3.peg.1197 Escherichia coli C639_08 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1126932.3.peg.2346 Escherichia coli C844_97 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1127356.3.peg.5115 Escherichia coli 4_1_47FAA Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1127356.4.peg.5115 Escherichia coli 4_1_47FAA Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1133852.3.peg.5232 Escherichia coli O104:H4 str. 2011C-3493 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1133853.3.peg.5283 Escherichia coli O104:H4 str. 2009EL-2071 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1134782.3.peg.5209 Escherichia coli O104:H4 str. 2009EL-2050 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1136217.3.peg.4230 Escherichia coli O104:H4 str. ON2010 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1136218.3.peg.4689 Escherichia coli O104:H4 str. ON2011 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1137135.3.peg.3721 Escherichia coli O157:H43 str. T22 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1144302.3.peg.3813 Escherichia coli SCI-07 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1144303.3.peg.4519 Escherichia coli J53 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1163386.3.peg.3183 Escherichia coli LCT-EC106 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1163391.3.peg.287 Escherichia coli O111:H11 str. CVM9545 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1163738.3.peg.1017 Escherichia coli O26:H11 str. CVM9952 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1165939.3.peg.198 Escherichia coli O111 str. CVM9455 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1165940.3.peg.1289 Escherichia coli O103:H25 str. CVM9340 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1165942.3.peg.1460 Escherichia coli O111:H8 str. CVM9602 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1165943.3.peg.1056 Escherichia coli O111:H8 str. CVM9574 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1165944.3.peg.1629 Escherichia coli O111:H8 str. CVM9634 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1165945.3.peg.2144 Escherichia coli O111:H8 str. CVM9570 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1165946.3.peg.1367 Escherichia coli O111:H11 str. CVM9534 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1165947.3.peg.500 Escherichia coli O111:H11 str. CVM9553 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1165949.3.peg.3095 Escherichia coli O26:H11 str. CVM9942 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1165950.3.peg.1238 Escherichia coli O26:H11 str. CVM10021 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1165951.3.peg.518 Escherichia coli O26:H11 str. CVM10026 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1165952.3.peg.1246 Escherichia coli O26:H11 str. CVM10030 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1165953.3.peg.4879 Escherichia coli O26:H11 str. CVM10224 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1167694.3.peg.3576 Escherichia coli O32:H37 str. P4 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169315.3.peg.4972 Escherichia coli KTE1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169318.3.peg.3982 Escherichia coli KTE13 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169320.3.peg.4735 Escherichia coli KTE35 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169323.3.peg.4168 Escherichia coli KTE231 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169324.3.peg.4957 Escherichia coli KTE2 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169327.3.peg.1532 Escherichia coli KTE6 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169329.3.peg.7 Escherichia coli KTE9 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169332.3.peg.4000 Escherichia coli KTE12 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169333.3.peg.4385 Escherichia coli KTE14 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169336.3.peg.4398 Escherichia coli KTE17 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169337.3.peg.4441 Escherichia coli KTE18 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169338.3.peg.3500 Escherichia coli KTE19 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169339.3.peg.4947 Escherichia coli KTE20 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169340.3.peg.4915 Escherichia coli KTE21 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169342.3.peg.4367 Escherichia coli KTE23 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169343.3.peg.4700 Escherichia coli KTE24 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169344.3.peg.4746 Escherichia coli KTE25 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169345.3.peg.4538 Escherichia coli KTE26 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169347.3.peg.4182 Escherichia coli KTE28 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169348.3.peg.3713 Escherichia coli KTE29 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169352.3.peg.4720 Escherichia coli KTE34 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169353.3.peg.4665 Escherichia coli KTE36 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169354.3.peg.4832 Escherichia coli KTE37 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169355.3.peg.4678 Escherichia coli KTE38 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169356.3.peg.4723 Escherichia coli KTE39 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169357.3.peg.3849 Escherichia coli KTE40 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169358.3.peg.4645 Escherichia coli KTE41 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169359.3.peg.4662 Escherichia coli KTE42 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169361.3.peg.4950 Escherichia coli KTE44 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169362.3.peg.4517 Escherichia coli KTE45 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169363.3.peg.4340 Escherichia coli KTE82 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169364.3.peg.4044 Escherichia coli KTE85 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169365.3.peg.3970 Escherichia coli KTE232 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169367.3.peg.4225 Escherichia coli KTE90 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169368.3.peg.4202 Escherichia coli KTE94 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169369.3.peg.4159 Escherichia coli KTE95 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169370.3.peg.3790 Escherichia coli KTE97 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169371.3.peg.4079 Escherichia coli KTE99 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169372.3.peg.4016 Escherichia coli KTE104 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169373.3.peg.4028 Escherichia coli KTE105 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169374.3.peg.3942 Escherichia coli KTE106 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169375.3.peg.3922 Escherichia coli KTE109 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169376.3.peg.4337 Escherichia coli KTE112 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169379.3.peg.4257 Escherichia coli KTE120 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169380.3.peg.4280 Escherichia coli KTE122 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169381.3.peg.4204 Escherichia coli KTE124 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169382.3.peg.4184 Escherichia coli KTE125 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169383.3.peg.4081 Escherichia coli KTE128 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169384.3.peg.4100 Escherichia coli KTE129 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169387.3.peg.4065 Escherichia coli KTE137 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169388.3.peg.3863 Escherichia coli KTE138 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169389.3.peg.3908 Escherichia coli KTE139 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169391.3.peg.4021 Escherichia coli KTE148 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169392.3.peg.4019 Escherichia coli KTE150 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169393.3.peg.4027 Escherichia coli KTE153 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169394.3.peg.3931 Escherichia coli KTE157 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169395.3.peg.4035 Escherichia coli KTE160 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169396.3.peg.4192 Escherichia coli KTE163 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169397.3.peg.4043 Escherichia coli KTE166 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169398.3.peg.3874 Escherichia coli KTE167 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169400.3.peg.4198 Escherichia coli KTE174 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169402.3.peg.4081 Escherichia coli KTE177 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169663.3.peg.856 Escherichia coli NCCP15647 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169862.3.peg.4717 Escherichia coli NCCP15658 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1169863.3.peg.1517 Escherichia coli NCCP15657 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181724.3.peg.4869 Escherichia coli KTE173 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181725.3.peg.4956 Escherichia coli KTE175 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181726.3.peg.4791 Escherichia coli KTE178 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181727.3.peg.3925 Escherichia coli KTE181 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181728.3.peg.4266 Escherichia coli KTE182 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181730.3.peg.679 Escherichia coli KTE184 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181731.3.peg.4972 Escherichia coli KTE185 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181733.3.peg.4408 Escherichia coli KTE187 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181734.3.peg.4614 Escherichia coli KTE188 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181735.3.peg.4310 Escherichia coli KTE189 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181736.3.peg.4455 Escherichia coli KTE190 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181737.3.peg.4687 Escherichia coli KTE191 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181738.3.peg.4350 Escherichia coli KTE192 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181739.3.peg.3100 Escherichia coli KTE193 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181741.3.peg.4584 Escherichia coli KTE195 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181743.3.peg.7 Escherichia coli KTE197 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181744.3.peg.4915 Escherichia coli KTE198 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181745.3.peg.3772 Escherichia coli KTE199 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181746.3.peg.4275 Escherichia coli KTE200 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181747.3.peg.4949 Escherichia coli KTE201 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181748.3.peg.4756 Escherichia coli KTE202 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181750.3.peg.4119 Escherichia coli KTE204 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181751.3.peg.4209 Escherichia coli KTE205 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181754.3.peg.4468 Escherichia coli KTE208 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181755.3.peg.1940 Escherichia coli KTE209 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181756.3.peg.4453 Escherichia coli KTE210 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181757.3.peg.4587 Escherichia coli KTE211 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181758.3.peg.4107 Escherichia coli KTE212 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181759.3.peg.3630 Escherichia coli KTE213 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181760.3.peg.170 Escherichia coli KTE214 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181762.3.peg.4646 Escherichia coli KTE216 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181763.3.peg.7 Escherichia coli KTE217 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181764.3.peg.4847 Escherichia coli KTE218 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181765.3.peg.3940 Escherichia coli KTE219 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181766.3.peg.3879 Escherichia coli KTE220 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181767.3.peg.4416 Escherichia coli KTE221 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181768.3.peg.1247 Escherichia coli KTE222 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181769.3.peg.4681 Escherichia coli KTE223 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181771.3.peg.546 Escherichia coli KTE225 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181772.3.peg.4197 Escherichia coli KTE226 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181774.3.peg.3051 Escherichia coli KTE228 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181776.3.peg.4538 Escherichia coli KTE230 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181777.3.peg.1890 Escherichia coli KTE233 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181778.3.peg.6 Escherichia coli KTE234 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181779.3.peg.3893 Escherichia coli KTE235 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181780.3.peg.4334 Escherichia coli KTE236 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1181781.3.peg.4711 Escherichia coli KTE237 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182653.3.peg.3849 Escherichia coli KTE46 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182654.3.peg.4378 Escherichia coli KTE47 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182655.3.peg.158 Escherichia coli KTE48 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182656.3.peg.4864 Escherichia coli KTE49 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182657.3.peg.964 Escherichia coli KTE50 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182658.3.peg.4910 Escherichia coli KTE51 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182660.3.peg.4807 Escherichia coli KTE53 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182661.3.peg.617 Escherichia coli KTE54 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182663.3.peg.1819 Escherichia coli KTE56 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182664.3.peg.4698 Escherichia coli KTE57 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182667.3.peg.4539 Escherichia coli KTE60 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182668.3.peg.4190 Escherichia coli KTE61 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182670.3.peg.4796 Escherichia coli KTE63 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182671.3.peg.4093 Escherichia coli KTE64 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182673.3.peg.4574 Escherichia coli KTE66 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182674.3.peg.183 Escherichia coli KTE67 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182675.3.peg.4434 Escherichia coli KTE68 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182676.3.peg.4572 Escherichia coli KTE69 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182677.3.peg.4687 Escherichia coli KTE70 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182678.3.peg.4795 Escherichia coli KTE71 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182680.3.peg.4137 Escherichia coli KTE73 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182681.3.peg.4368 Escherichia coli KTE74 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182682.3.peg.4716 Escherichia coli KTE75 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182683.3.peg.4175 Escherichia coli KTE76 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182684.3.peg.4368 Escherichia coli KTE77 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182685.3.peg.4385 Escherichia coli KTE78 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182686.3.peg.1274 Escherichia coli KTE79 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182687.3.peg.4254 Escherichia coli KTE80 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182688.3.peg.6 Escherichia coli KTE81 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182689.3.peg.4371 Escherichia coli KTE83 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182690.3.peg.4358 Escherichia coli KTE84 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182692.3.peg.4632 Escherichia coli KTE87 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182694.3.peg.4053 Escherichia coli KTE91 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182698.3.peg.1167 Escherichia coli KTE98 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182699.3.peg.4987 Escherichia coli KTE100 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182701.3.peg.705 Escherichia coli KTE102 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182702.3.peg.4936 Escherichia coli KTE103 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182703.3.peg.4569 Escherichia coli KTE107 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182704.3.peg.1038 Escherichia coli KTE108 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182706.3.peg.4598 Escherichia coli KTE111 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182707.3.peg.4095 Escherichia coli KTE115 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182708.3.peg.5150 Escherichia coli KTE116 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182710.3.peg.4505 Escherichia coli KTE119 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182711.3.peg.3731 Escherichia coli KTE121 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182713.3.peg.4543 Escherichia coli KTE126 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182714.3.peg.7 Escherichia coli KTE127 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182715.3.peg.4856 Escherichia coli KTE130 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182716.3.peg.4901 Escherichia coli KTE132 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182717.3.peg.698 Escherichia coli KTE134 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182718.3.peg.1199 Escherichia coli KTE135 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182719.3.peg.4260 Escherichia coli KTE136 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182720.3.peg.4726 Escherichia coli KTE140 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182721.3.peg.4417 Escherichia coli KTE141 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182722.3.peg.3234 Escherichia coli KTE142 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182723.3.peg.4414 Escherichia coli KTE143 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182724.3.peg.3754 Escherichia coli KTE144 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182725.3.peg.4895 Escherichia coli KTE146 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182726.3.peg.2610 Escherichia coli KTE147 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182728.3.peg.1868 Escherichia coli KTE154 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182729.3.peg.4253 Escherichia coli KTE155 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182730.3.peg.4594 Escherichia coli KTE156 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182731.3.peg.4707 Escherichia coli KTE158 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182732.3.peg.3855 Escherichia coli KTE159 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182733.3.peg.1357 Escherichia coli KTE161 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182734.3.peg.4274 Escherichia coli KTE162 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182735.3.peg.1224 Escherichia coli KTE165 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182737.3.peg.4871 Escherichia coli KTE170 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1182738.3.peg.4503 Escherichia coli KTE171 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1196033.3.peg.4017 Escherichia coli SEPT362 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1206108.3.peg.886 Escherichia coli J96 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1227813.3.peg.3583 Escherichia coli S17 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1227814.3.peg.3779 Escherichia coli O08 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1230480.3.peg.3304 Escherichia coli EC302/04 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1232150.3.peg.7 Escherichia coli O26:H11 str. CFSAN001629 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1232151.3.peg.4860 Escherichia coli O111:H11 str. CFSAN001630 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1232154.3.peg.890 Escherichia coli O111:H8 str. CFSAN001632 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1235805.3.peg.4534 Escherichia coli SWW33 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1240385.3.peg.4621 Escherichia coli O157:H7 str. H093800014 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1240758.3.peg.2951 Escherichia coli O104:H4 str. Ec11-9450 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1240759.3.peg.2204 Escherichia coli O104:H4 str. Ec11-9941 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1240760.3.peg.3210 Escherichia coli O104:H4 str. Ec11-9990 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1240761.3.peg.2949 Escherichia coli O104:H4 str. Ec11-4984 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1240762.3.peg.3804 Escherichia coli O104:H4 str. Ec11-4986 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1240763.3.peg.2637 Escherichia coli O104:H4 str. Ec11-4987 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1240764.3.peg.4260 Escherichia coli O104:H4 str. Ec11-4988 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1240765.3.peg.4867 Escherichia coli O104:H4 str. Ec11-5603 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1240766.3.peg.2973 Escherichia coli O104:H4 str. Ec11-5604 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1240767.3.peg.2246 Escherichia coli O104:H4 str. Ec11-6006 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1240768.3.peg.2326 Escherichia coli O104:H4 str. 11-02030 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1240769.3.peg.2490 Escherichia coli O104:H4 str. 11-02033-1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1240770.3.peg.1011 Escherichia coli O104:H4 str. 11-02092 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1240771.3.peg.1242 Escherichia coli O104:H4 str. 11-02093 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1240772.3.peg.2565 Escherichia coli O104:H4 str. 11-02281 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1240773.3.peg.3348 Escherichia coli O104:H4 str. 11-02318 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1240774.3.peg.1691 Escherichia coli O104:H4 str. 11-02913 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1240775.3.peg.1072 Escherichia coli O104:H4 str. 11-03439 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1240776.3.peg.1607 Escherichia coli O104:H4 str. 11-04080 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1240777.3.peg.1603 Escherichia coli O104:H4 str. 11-03943 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1240778.3.peg.4806 Escherichia coli O104:H4 str. Ec12-0465 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1240779.3.peg.3044 Escherichia coli O104:H4 str. Ec12-0466 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1246623.3.peg.1124 Escherichia coli O10:K5(L):H4 str. ATCC 23506 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1258567.3.peg.1929 Escherichia coli LCT-EC52 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1258580.3.peg.1964 Escherichia coli LCT-EC59 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1274814.3.peg.4646 Escherichia coli APEC O78 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1279005.3.peg.3125 Escherichia coli KTE172 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1308540.3.peg.2838 Escherichia coli HM26 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1308981.3.peg.1028 Escherichia coli HM27 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1308982.3.peg.3468 Escherichia coli HM46 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1308984.3.peg.2155 Escherichia coli HM69 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1317130.3.peg.3685 Escherichia coli O157 str. NCCP15739 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1317131.3.peg.3611 Escherichia coli O157 str. NCCP15738 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|1322345.3.peg.1036 Escherichia coli ATCC 25922 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|155864.1.peg.4709 Escherichia coli O157:H7 EDL933 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|155864.8.peg.4667 Escherichia coli O157:H7 EDL933 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|199310.1.peg.4593 Escherichia coli CFT073 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|199310.4.peg.4403 Escherichia coli CFT073 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|216592.1.peg.1146 Escherichia coli 042 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|216592.3.peg.4299 Escherichia coli 042 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|216593.1.peg.4577 Escherichia coli E2348/69 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|216598.1.peg.2099 Shigella dysenteriae M131649 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|300267.13.peg.4691 Shigella dysenteriae Sd197 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|300268.10.peg.4503 Shigella boydii Sb227 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|300268.11.peg.4546 Shigella boydii Sb227 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|316385.5.peg.3906 Escherichia coli str. K-12 substr. DH10B Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|316385.7.peg.3988 Escherichia coli str. K-12 substr. DH10B Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|316401.4.peg.4597 Escherichia coli ETEC H10407 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|316407.3.peg.3362 Escherichia coli W3110 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|316407.9.peg.3533 Escherichia coli str. K-12 substr. W3110 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|316435.3.peg.30 Escherichia coli Nissle 1917 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|331111.12.peg.4515 Escherichia coli E24377A Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|331111.3.peg.1916 Escherichia coli E24377A Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|331112.3.peg.3732 Escherichia coli HS Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|331112.6.peg.3889 Escherichia coli HS Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|340186.3.peg.4260 Escherichia coli E110019 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|340186.5.peg.4480 Escherichia coli E110019 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|344609.11.peg.4546 Shigella boydii CDC 3083-94 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|344609.3.peg.2407 Shigella boydii BS512 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|344610.3.peg.3485 Escherichia coli 53638 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|344610.7.peg.2425 Escherichia coli 53638 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|358708.5.peg.4498 Shigella dysenteriae 1012 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|386585.9.peg.4909 Escherichia coli O157:H7 str. Sakai Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|409438.11.peg.4225 Escherichia coli SE11 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|431946.3.peg.3757 Escherichia coli SE15 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|439855.10.peg.4272 Escherichia coli SMS-3-5 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|444447.5.peg.2166 Escherichia coli O157:H7 str. EC4206 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|444448.5.peg.2002 Escherichia coli O157:H7 str. EC4045 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|444449.5.peg.3247 Escherichia coli O157:H7 str. EC4042 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|444450.8.peg.5084 Escherichia coli O157:H7 str. EC4115 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|444451.5.peg.3239 Escherichia coli O157:H7 str. EC4196 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|444452.5.peg.4618 Escherichia coli O157:H7 str. EC4113 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|444453.5.peg.2143 Escherichia coli O157:H7 str. EC4076 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|444454.5.peg.3792 Escherichia coli O157:H7 str. EC4024 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|457400.3.peg.1838 Escherichia sp. 1_1_43 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|457401.3.peg.4557 Escherichia sp. 4_1_40B Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|475609.3.peg.3965 Escherichia coli chi7122 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|478004.5.peg.559 Escherichia coli O157:H7 str. EC4401 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|478005.5.peg.2071 Escherichia coli O157:H7 str. EC4486 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|478006.5.peg.4492 Escherichia coli O157:H7 str. EC4501 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|478007.5.peg.3637 Escherichia coli O157:H7 str. EC508 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|478008.5.peg.1885 Escherichia coli O157:H7 str. EC869 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|481805.3.peg.4558 Escherichia coli ATCC 8739 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|481805.6.peg.4537 Escherichia coli ATCC 8739 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|502346.5.peg.1913 Escherichia coli O157:H7 str. TW14588 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|511145.12.peg.3887 Escherichia coli str. K-12 substr. MG1655 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|511145.6.peg.3869 Escherichia coli str. K-12 substr. MG1655 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|525281.3.peg.4908 Escherichia coli 83972 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|536056.3.peg.4474 Escherichia coli DH1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|544404.4.peg.4894 Escherichia coli O157:H7 str. TW14359 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|550672.3.peg.3843 Escherichia coli B088 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|550674.3.peg.4465 Escherichia coli B093 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|550676.3.peg.3977 Escherichia coli B185 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|550677.3.peg.4348 Escherichia coli B354 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|550682.3.peg.2653 Escherichia coli B799 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|550685.3.peg.3969 Escherichia coli E101 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|550687.3.peg.4611 Escherichia coli E482 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|550694.3.peg.4432 Escherichia fergusonii B253 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|562.1188.peg.4022 Escherichia coli IMT2125 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|562.371.peg.5545 Escherichia coli 1044A Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|562.372.peg.3842 Escherichia coli 1212A Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|562.373.peg.5935 Escherichia coli 1125A Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|562.374.peg.706 Escherichia coli 536A Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|562.376.peg.730 Escherichia coli WV_060327 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|566546.3.peg.3651 Escherichia coli W Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|566546.4.peg.4018 Escherichia coli W Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|570506.3.peg.1450 Escherichia coli O157:H7 str. FRIK966 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|573235.3.peg.4961 Escherichia coli O26:H11 str. 11368 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|574521.7.peg.4151 Escherichia coli O127:H6 str. E2348/69 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|585034.4.peg.3860 Escherichia coli IAI1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|585034.5.peg.3857 Escherichia coli IAI1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|585054.5.peg.3603 Escherichia fergusonii ATCC 35469 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|585055.6.peg.4270 Escherichia coli 55989 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|585055.8.peg.4273 Escherichia coli 55989 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|585056.7.peg.4463 Escherichia coli UMN026 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|585057.4.peg.3122 Escherichia coli IAI39 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|585057.6.peg.3128 Escherichia coli IAI39 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|585396.4.peg.4758 Escherichia coli O111:H- str. 11128 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|591946.4.peg.3840 Escherichia coli LF82 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|595495.4.peg.3110 Escherichia coli KO11 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|595495.5.peg.4666 Escherichia coli KO11 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|595496.3.peg.3772 Escherichia coli BW2952 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|621.8.peg.4375 Shigella boydii ATCC 9905 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|622.8.peg.3170 Shigella dysenteriae CDC 74-1112 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|623.7.peg.4031 Shigella flexneri CDC 796-83 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|637388.3.peg.2669 Escherichia coli O157:H7 str. FRIK2000 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|655817.3.peg.4439 Escherichia coli ABU 83972 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|656372.3.peg.4482 Escherichia coli E1167 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|656374.3.peg.4602 Escherichia coli E1520 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|656379.3.peg.5004 Escherichia coli FVEC1302 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|656380.3.peg.4903 Escherichia coli FVEC1412 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|656383.3.peg.4731 Escherichia coli H120 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|656393.3.peg.4939 Escherichia coli H299 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|656405.3.peg.4730 Escherichia coli H494 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|656408.3.peg.4232 Escherichia coli H591 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|656413.3.peg.2830 Escherichia coli H730 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|656414.3.peg.4300 Escherichia coli H736 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|656417.3.peg.4654 Escherichia coli M605 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|656419.3.peg.4859 Escherichia coli M718 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|656420.3.peg.4731 Escherichia coli M863 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|656421.3.peg.3625 Escherichia coli M919 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|656435.3.peg.4170 Escherichia coli TA124 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|656437.3.peg.4250 Escherichia coli TA143 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|656440.3.peg.4080 Escherichia coli TA206 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|656443.3.peg.4711 Escherichia coli TA271 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|656444.3.peg.5106 Escherichia coli TA280 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|656449.3.peg.4927 Escherichia coli TW10509 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|6666666.5522.peg.3363 Escherichia coli TY-2482.contig.20110606 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|670888.3.peg.2456 Escherichia coli 1827-70 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|670890.3.peg.1619 Escherichia coli LT-68 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|670892.3.peg.1118 Escherichia coli 3431 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|670893.4.peg.2755 Escherichia coli EPECa14 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|670896.3.peg.4375 Escherichia coli EPECa12 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|670897.3.peg.5143 Escherichia coli 2362-75 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|670899.3.peg.2135 Escherichia coli RN587/1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|670903.3.peg.4380 Escherichia coli TX1999 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|670904.3.peg.3283 Escherichia coli 1180 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|670904.4.peg.3256 Escherichia coli OK1180 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|670905.3.peg.4050 Escherichia coli 1357 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|670905.4.peg.3070 Escherichia coli OK1357 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|679202.3.peg.3664 Escherichia coli MS 85-1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|679205.4.peg.2177 Escherichia coli MS 124-1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|679206.4.peg.4974 Escherichia coli MS 119-7 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|679207.4.peg.3709 Escherichia coli MS 107-1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|685038.3.peg.3825 Escherichia coli O83:H1 str. NRG 857C Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|696406.3.peg.4492 Escherichia coli UMNK88 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|701177.3.peg.4578 Escherichia coli O55:H7 str. CB9615 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|702430.3.peg.4990 Escherichia coli O157:H7 str. EC4009 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|702431.3.peg.3402 Escherichia coli O157:H7 str. EC4192 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|702432.3.peg.3268 Escherichia coli O157:H7 str. EC4084 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|702433.3.peg.1057 Escherichia coli O157:H7 str. EC4127 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|702434.4.peg.3436 Escherichia coli O157:H7 str. EC4191 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|702435.3.peg.1151 Escherichia coli O157:H7 str. EC4205 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|702436.3.peg.898 Escherichia coli O157:H7 str. EC536 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|741093.3.peg.4762 Escherichia coli Xuzhou21 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|749527.3.peg.4537 Escherichia coli MS 21-1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|749528.3.peg.3276 Escherichia coli MS 45-1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|749529.3.peg.2583 Escherichia coli MS 57-2 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|749531.3.peg.2225 Escherichia coli MS 69-1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|749532.3.peg.498 Escherichia coli MS 78-1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|749533.3.peg.2016 Escherichia coli MS 84-1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|749537.3.peg.4878 Escherichia coli MS 115-1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|749538.3.peg.929 Escherichia coli MS 116-1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|749539.3.peg.4604 Escherichia coli MS 117-3 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|749540.3.peg.2649 Escherichia coli MS 146-1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|749541.3.peg.2174 Escherichia coli MS 153-1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|749542.3.peg.77 Escherichia coli MS 16-3 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|749544.3.peg.1076 Escherichia coli MS 175-1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|749545.3.peg.1402 Escherichia coli MS 182-1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|749546.3.peg.1322 Escherichia coli MS 185-1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|749548.3.peg.4577 Escherichia coli MS 196-1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|749549.3.peg.4400 Escherichia coli MS 198-1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|752783.3.peg.1147 Escherichia coli KD1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|752784.3.peg.2424 Escherichia coli KD2 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|752785.3.peg.4818 Escherichia coli 541-15 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|752786.3.peg.111 Escherichia coli 541-1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|752787.3.peg.4914 Escherichia coli 576-1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|752788.3.peg.1055 Escherichia coli 75 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|754078.3.peg.4134 Escherichia coli G58-1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|754079.3.peg.4954 Escherichia coli 2534-86 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|754080.3.peg.4395 Escherichia coli 3030-1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|754081.3.peg.4205 Escherichia coli STEC_O31 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|754082.3.peg.4346 Escherichia coli STEC_7v Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|754083.3.peg.4369 Escherichia coli STEC_94C Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|754084.3.peg.3977 Escherichia coli STEC_B2F1 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|754085.3.peg.4543 Escherichia coli STEC_C165-02 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|754086.3.peg.5032 Escherichia coli STEC_DG131-3 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|754087.3.peg.4454 Escherichia coli STEC_EH250 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|754089.3.peg.4150 Escherichia coli STEC_MHI813 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|754090.3.peg.4543 Escherichia coli STEC_S1191 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|754091.3.peg.4322 Shigella flexneri CCH060 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|754093.3.peg.1026 Shigella dysenteriae 1617 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|754331.3.peg.1604 Escherichia sp. TW09308 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|754332.3.peg.1154 Escherichia sp. TW10509 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|766138.3.peg.4567 Shigella boydii 965-58 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|766139.3.peg.4337 Shigella boydii 3594-74 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|766140.3.peg.4352 Shigella boydii 4444-74 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|766141.3.peg.4384 Shigella boydii 5216-82 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|766142.3.peg.4634 Shigella dysenteriae 155-74 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|766143.3.peg.4538 Shigella dysenteriae 225-75 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|766150.3.peg.4114 Shigella flexneri K-315 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|766155.3.peg.4295 Shigella flexneri 1485-80 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|796392.4.peg.1716 Escherichia coli MS 79-10 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|83334.1.peg.4675 Escherichia coli O157:H7 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868133.3.peg.4296 Escherichia coli DEC1A Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868134.3.peg.4375 Escherichia coli DEC1B Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868135.3.peg.4614 Escherichia coli DEC1C Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868136.3.peg.4638 Escherichia coli DEC1D Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868137.3.peg.4478 Escherichia coli DEC1E Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868138.3.peg.4438 Escherichia coli DEC2A Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868139.3.peg.4425 Escherichia coli DEC2B Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868140.3.peg.4377 Escherichia coli DEC2C Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868141.3.peg.4493 Escherichia coli DEC2D Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868142.3.peg.3974 Escherichia coli DEC2E Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868143.3.peg.80 Escherichia coli DEC3A Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868144.3.peg.4849 Escherichia coli DEC3B Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868145.3.peg.5134 Escherichia coli DEC3C Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868146.3.peg.5356 Escherichia coli DEC3D Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868147.3.peg.5023 Escherichia coli DEC3E Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868148.3.peg.4845 Escherichia coli DEC3F Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868149.3.peg.4188 Escherichia coli DEC4A Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868150.3.peg.4847 Escherichia coli DEC4B Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868151.3.peg.3813 Escherichia coli DEC4C Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868152.3.peg.4426 Escherichia coli DEC4D Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868153.3.peg.93 Escherichia coli DEC4E Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868154.3.peg.5320 Escherichia coli DEC4F Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868155.3.peg.4454 Escherichia coli DEC5A Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868156.3.peg.4969 Escherichia coli DEC5B Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868157.3.peg.4641 Escherichia coli DEC5C Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868158.3.peg.4625 Escherichia coli DEC5D Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868159.3.peg.4535 Escherichia coli DEC5E Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868162.3.peg.4563 Escherichia coli DEC6C Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868163.3.peg.4455 Escherichia coli DEC6D Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868164.3.peg.4336 Escherichia coli DEC6E Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868165.3.peg.4562 Escherichia coli DEC7A Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868166.3.peg.3993 Escherichia coli DEC7B Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868167.3.peg.4355 Escherichia coli DEC7C Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868168.3.peg.4543 Escherichia coli DEC7D Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868169.3.peg.4019 Escherichia coli DEC7E Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868170.3.peg.4448 Escherichia coli DEC8A Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868171.3.peg.4705 Escherichia coli DEC8B Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868172.3.peg.5307 Escherichia coli DEC8C Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868173.3.peg.4760 Escherichia coli DEC8D Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868174.3.peg.99 Escherichia coli DEC8E Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868175.3.peg.254 Escherichia coli DEC9A Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868176.3.peg.4667 Escherichia coli DEC9B Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868177.3.peg.4573 Escherichia coli DEC9C Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868178.3.peg.4662 Escherichia coli DEC9D Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868179.3.peg.4970 Escherichia coli DEC9E Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868180.3.peg.4825 Escherichia coli DEC10A Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868181.3.peg.5129 Escherichia coli DEC10B Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868182.3.peg.400 Escherichia coli DEC10C Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868183.3.peg.118 Escherichia coli DEC10D Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868185.3.peg.5152 Escherichia coli DEC10F Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868196.3.peg.4069 Escherichia coli DEC13A Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868197.3.peg.3827 Escherichia coli DEC13B Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868198.3.peg.4537 Escherichia coli DEC13C Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868199.3.peg.4144 Escherichia coli DEC13D Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868200.3.peg.4209 Escherichia coli DEC13E Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868206.3.peg.4349 Escherichia coli DEC15A Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868207.3.peg.4386 Escherichia coli DEC15B Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868208.3.peg.4275 Escherichia coli DEC15C Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868209.3.peg.4212 Escherichia coli DEC15D Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|868210.3.peg.4558 Escherichia coli DEC15E Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869669.3.peg.1211 Escherichia coli 1.2741 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869669.4.peg.3863 Escherichia coli 1.2741 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869670.3.peg.331 Escherichia coli 97.0246 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869670.4.peg.3694 Escherichia coli 97.0246 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869671.3.peg.3289 Escherichia coli 5.0588 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869671.4.peg.3256 Escherichia coli 5.0588 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869672.3.peg.4196 Escherichia coli 97.0259 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869672.4.peg.4177 Escherichia coli 97.0259 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869673.3.peg.3253 Escherichia coli H30 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869674.3.peg.537 Escherichia coli 95.0941 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869675.3.peg.201 Escherichia coli 1.2264 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869675.4.peg.3254 Escherichia coli 1.2264 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869676.4.peg.5147 Escherichia coli 97.0264 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869677.3.peg.3154 Escherichia coli 96.0497 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869677.4.peg.4029 Escherichia coli 96.0497 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869678.3.peg.4520 Escherichia coli 99.0741 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869678.4.peg.5256 Escherichia coli 99.0741 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869681.3.peg.5186 Escherichia coli 4.0522 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869681.4.peg.5722 Escherichia coli 4.0522 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869682.3.peg.5157 Escherichia coli JB1-95 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869682.4.peg.5117 Escherichia coli JB1-95 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869683.3.peg.4393 Escherichia coli 96.154 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869683.4.peg.2477 Escherichia coli 96.154 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869684.4.peg.453 Escherichia coli 5.0959 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869684.5.peg.706 Escherichia coli 5.0959 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869686.3.peg.4329 Escherichia coli 9.0111 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869686.4.peg.2932 Escherichia coli 9.0111 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869688.4.peg.5662 Escherichia coli 2.3916 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869688.5.peg.5588 Escherichia coli 2.3916 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869689.3.peg.133 Escherichia coli 3.3884 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869689.4.peg.5017 Escherichia coli 3.3884 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869690.3.peg.978 Escherichia coli 2.4168 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869690.4.peg.2795 Escherichia coli 2.4168 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869691.3.peg.314 Escherichia coli 3.2303 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869691.4.peg.4091 Escherichia coli 3.2303 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869692.3.peg.4839 Escherichia coli 3003 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869692.4.peg.757 Escherichia coli 3003 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869693.3.peg.2859 Escherichia coli TW07793 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869693.5.peg.1240 Escherichia coli TW07793 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869694.3.peg.4921 Escherichia coli B41 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869694.4.peg.4106 Escherichia coli B41 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869695.3.peg.4004 Escherichia coli 900105 (10e) Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|869695.4.peg.1871 Escherichia coli 900105 (10e) Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|879462.4.peg.3811 Escherichia coli str. K-12 substr. MG1655star Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|885275.3.peg.4103 Escherichia coli str. 'clone D i14' Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|885276.3.peg.4108 Escherichia coli str. 'clone D i2' Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|910348.4.peg.4278 Escherichia coli P12b Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|913087.3.peg.4249 Escherichia coli TW14425 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|913088.3.peg.753 Escherichia coli TW11681 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|913089.3.peg.1605 Escherichia coli TW10828 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|913090.3.peg.3043 Escherichia coli TW10722 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|913091.3.peg.1137 Escherichia coli TW10598 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|926026.3.peg.2608 Escherichia coli O157:H7 str. G5101 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|926027.3.peg.2639 Escherichia coli O157:H- str. 493-89 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|926028.3.peg.2700 Escherichia coli O157:H- str. H 2687 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|926029.3.peg.2790 Escherichia coli O55:H7 str. 3256-97 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|926030.3.peg.2561 Escherichia coli O55:H7 str. USDA 5905 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|932676.3.peg.4806 Shigella boydii ATCC 9905 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|941322.6.peg.4298 Escherichia coli O25b:H4-ST131 str. EC958 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|941429.3.peg.1477 Shigella dysenteriae CDC 74-1112 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|941435.3.peg.2571 Escherichia coli O157:H7 str. EC1212 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|945360.3.peg.2331 Shigella flexneri CDC 796-83 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|945433.3.peg.27 Escherichia coli WV_060327 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|981367.3.peg.3669 Escherichia fergusonii ECD227 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|997824.3.peg.230 Escherichia coli O157:H7 str. 1044 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
fig|997825.3.peg.1823 Escherichia coli O157:H7 str. 1125 Branched-chain amino acid aminotransferase (EC 2.6.1.42)