(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00023252

fig|526978.3.peg.3309   Bacillus cereus BDRD-Cer4                                                                        ENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEIAVNQDG−−DYNKALENAKRLAGYLMNKEGIGADH−−−−−−−−IYKHQQWSG−−−−−−−−−−−KKCPDILISRGNWAGFVQGIQWYANINAQIDTPLQDKNDSFNPNENN−−−PAEPS−−−−−−−−−−−−−−−−−MELVVNGSGINV−−−−−−RSDAG−−−−−−−−−−−−−−−IEHRVVRKASNGDRYKVLAVKNG−−−−WYKVGNGEWIFYDPSWIKIN                                                                                                      
fig|526969.3.peg.3032   Bacillus cereus m1550                                                                        ENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEIAVNQDG−−DYNKALENAKRLAGYLMNKEGIGADH−−−−−−−−IYKHQQWSG−−−−−−−−−−−KKCPDILISRGNWAGFVQGIQWYANINAQIDTPLQDKNDSFNPNENN−−−PAEPS−−−−−−−−−−−−−−−−−MELVVNGSGINV−−−−−−RSDAG−−−−−−−−−−−−−−−IEHRVVRKASNGDRYKVLAVKNG−−−−WYKVGNGEWIFYDPSWIKIN                                                                                                      
fig|526989.3.peg.5472   Bacillus cereus F65185                                                                        ENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEIAVNQDG−−DYNKALENAKRLAGYLMNKEGIGADH−−−−−−−−IYKHQQWSG−−−−−−−−−−−KKCPDILISRGNWAGFVQGIQWYANINAQIDTPLQDKNDSFNPNENN−−−PAEPS−−−−−−−−−−−−−−−−−MELVVNGSGINV−−−−−−RSDAG−−−−−−−−−−−−−−−IEHRVVRKASNGDRYKVLAVKNG−−−−WYKVGNGEWIFYDPSWIKIN                                                                                                      
fig|526974.3.peg.3791   Bacillus cereus BDRD-ST24                                                                        ENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEIAVNQDG−−DYNKALENAKRLAGYLMNKEGIGADH−−−−−−−−IYKHQQWSG−−−−−−−−−−−KKCPDILISRGNWAGFVQGIQWYANINAQIDTPLQDKNDSFNPNENN−−−PAEPS−−−−−−−−−−−−−−−−−MELVVNGSGINV−−−−−−RSDAG−−−−−−−−−−−−−−−IEHRVVRKASNGDRYKVLAVKNG−−−−WYKVGNGEWIFYDPSWIKIN                                                                                                      
fig|527023.3.peg.5337   Bacillus thuringiensis serovar kurstaki str. T03a001                                                                        ENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEIAVNQDG−−DYNKALENAKRLAGYLMNKEGIGADH−−−−−−−−IYKHQQWSG−−−−−−−−−−−KKCPDILISRGNWAGFVQGIQWYANINAQIDTPLQDKNDSFNPNENN−−−PAEPS−−−−−−−−−−−−−−−−−MELVVNGSGINV−−−−−−RSDAG−−−−−−−−−−−−−−−IEHRVVRKASNGDRYKVLAVKNG−−−−WYKVGNGEWIFYDPSWIKIN                                                                                                      
fig|527020.3.peg.333   Bacillus thuringiensis IBL 4222                                                                        ENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEIAVNQDG−−DYNKALENAKRLAGYLMNKEGIGADH−−−−−−−−IYKHQQWSG−−−−−−−−−−−KKCPDILISRGNWAGFVQGIQWYANINAQIDTPLQDKNDSFNPNENN−−−PAEPS−−−−−−−−−−−−−−−−−MELVVNGSGINV−−−−−−RSDAG−−−−−−−−−−−−−−−IEHRVVRKASNGDRYKVLAVKNG−−−−WYKVGNGEWIFYDPSWIKIN                                                                                                      
fig|226900.1.peg.3109   Bacillus cereus ATCC 14579                                                                        ENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEIAVNQDG−−DYNKALENAKRLAGYLMNKEGIGADH−−−−−−−−IYKHQQWSG−−−−−−−−−−−KKCPDILISRGNWAGFVQGIQWYANINAQIDTPLQDKNDSFNPNENN−−−PAEPS−−−−−−−−−−−−−−−−−MELVVNGSGINV−−−−−−RSDAG−−−−−−−−−−−−−−−IEHRVVRKASNGDRYKVLAVKNG−−−−WYKVGNGEWIFYDPSWIKIN                                                                                                      
fig|714359.3.peg.3153   Bacillus thuringiensis BMB171                                                                        ENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEIAVNQDG−−DYNKALENAKRLAGYLMNKEGIGADH−−−−−−−−IYKHQQWSG−−−−−−−−−−−KKCPDILISRGNWAGFVQGIQWYANINAQIDTPLQDKNDSFNPNENN−−−PAEPS−−−−−−−−−−−−−−−−−MELVVNGSGINV−−−−−−RSDAG−−−−−−−−−−−−−−−IEHRVVRKASNGDRYKVLAVKNG−−−−WYKVGNGEWIFYDPSWIKIN                                                                                                      
fig|527030.3.peg.4703   Bacillus thuringiensis serovar huazhongensis BGSC 4BD1                                                                        ENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEIAVNQDG−−DYNKALENAKRLAGYLMNKEGIGADH−−−−−−−−IYKHQQWSG−−−−−−−−−−−KKCPDILISRGNWAGFVQGIQWYANINAQIDTPLQDKNDSFNPNENN−−−PAEPS−−−−−−−−−−−−−−−−−MELVVNGSGINV−−−−−−RSDAG−−−−−−−−−−−−−−−IEHRVVRKASNGDRYKVLAVKNG−−−−WYKVGNGEWIFYDPSWIKIN                                                                                                      
fig|405531.7.peg.3191   Bacillus cereus G9842                                                                        ENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEIAVNQDG−−DYNKALENAKRLAGYLMNKEGIGADH−−−−−−−−IYKHQQWSG−−−−−−−−−−−KKCPDILISRGNWAGFVQGIQWYANINAQIDTPLQDKNDSFNPNENN−−−PAEPS−−−−−−−−−−−−−−−−−MELVVNGSGINV−−−−−−RSDAG−−−−−−−−−−−−−−−IEHRVVRKASNGDRYKVLAVKNG−−−−WYKVGNGEWIFYDPSWIKIN                                                                                                      
fig|405532.4.peg.2998   Bacillus cereus B4264                                                                        ENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEIAVNQDG−−DYNKALENAKRLAGYLMNKEGIGADH−−−−−−−−IYKHQQWSG−−−−−−−−−−−KKCPDILISRGNWAGFVQGIQWYANINAQIDTPLQDKNDSFNPNENN−−−PAEPS−−−−−−−−−−−−−−−−−MELVVNGSGINV−−−−−−RSDAG−−−−−−−−−−−−−−−IEHRVVRKASNGDRYKVLAVKNG−−−−WYKVGNGEWIFYDPSWIKIN                                                                                                      
fig|526980.3.peg.4146   Bacillus cereus ATCC 10876                                                                        ENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEIAVNQDG−−DYNKALENAKRLAGYLMNKEGIGADH−−−−−−−−IYKHQQWSG−−−−−−−−−−−KKCPDILISRGNWAGFVQGIQWYANINAQIDTPLQDKNDSFNPNENN−−−PAEPS−−−−−−−−−−−−−−−−−MELVVNGSGINV−−−−−−RSDAG−−−−−−−−−−−−−−−IEHRVVRKASNGDRYKVLAVKNG−−−−WYKVGNGEWIFYDPSWIKIN                                                                                                      
fig|527019.3.peg.1944   Bacillus thuringiensis IBL 200                                                                        ENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEIAVNQDG−−DYNKALENAKRLAGYLMNKEGIGADH−−−−−−−−IYKHQQWSG−−−−−−−−−−−KKCPDILISRGNWAGFVQGIQWYANINAQIDTPLQDKNDSFNPNENN−−−PAEPS−−−−−−−−−−−−−−−−−MELVVNGSGINV−−−−−−RSDAG−−−−−−−−−−−−−−−IEHRVVRKASNGDRYKVLAVKNG−−−−WYKVGNGEWIFYDPSWIKIN                                                                                                      
fig|526982.3.peg.4378   Bacillus cereus Rock1-15                                                                        ENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEIAVNQDG−−DYNKALENAKRLAGYLMNKEGIGADH−−−−−−−−IYKHQQWSG−−−−−−−−−−−KKCPDILISRGNWAGFVQGIQWYANINAQIDTPLQDKNDSFNPNENN−−−PAEPS−−−−−−−−−−−−−−−−−MELVVNGSGINV−−−−−−RSDAG−−−−−−−−−−−−−−−IEHRVVRKASNGDRYKVLAVKNG−−−−WYKVGIGEWIFYDPSWIKIN                                                                                                      
fig|405533.4.peg.1661   Bacillus cereus AH1134                                                                        ENHAKYLYKQA−−TEGTFRTASWHFTVDDRQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEIAVNQDG−−DYNKALENAKRLAGYLMNKEGIGADH−−−−−−−−IYKHQQWSG−−−−−−−−−−−KKCPDILISRGNWAGFVQGIQWYANINAQIDTPLQDKNDSFNPNENN−−−PAEPS−−−−−−−−−−−−−−−−−MELVVNGSGINV−−−−−−RSDAG−−−−−−−−−−−−−−−IEHRVVRKASNGDRYKVLAVKNG−−−−WYKVGNGEWIFYDPSWIKIN                                                                                                      
fig|527027.3.peg.324   Bacillus thuringiensis serovar pakistani str. T13001                                                                        ENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEIAVNQDG−−DYNKALENAKRLAGYLMNKEGIGADH−−−−−−−−IYKHQQWSG−−−−−−−−−−−KKCPDILISRGNWAGFVQGIQWYANINAQIDTPLQDKTDSFNPNENN−−−PAEPS−−−−−−−−−−−−−−−−−MELVVNGSGINV−−−−−−RSDAG−−−−−−−−−−−−−−−IEHRVVRKASNGDRYKVLAVKNG−−−−WYKVGNGEWIFYDPSWIKIN                                                                                                      
fig|526987.3.peg.2370   Bacillus cereus Rock4-2                                                                        ENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEIAVNQDG−−DYNKALENAKRLAGYLMNKEGIGADH−−−−−−−−IYKHQQWSG−−−−−−−−−−−KKCPDILISRGNWAGFVQGIQWYANINAQIDTPLQDKNDSFNPNENN−−−PAEPS−−−−−−−−−−−−−−−−−MELVVNGSGINV−−−−−−RSDAG−−−−−−−−−−−−−−−IEHRVVRKASTGDRYKVLAVKNG−−−−WYKVGNGEWIFYDPSWIKIN                                                                                                      
fig|526967.3.peg.3335   Bacillus cereus 172560W                                                                        ENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEIAVNQDG−−DYNKALENAKRLAGYLMNKEGIGADH−−−−−−−−IYKHQQWSG−−−−−−−−−−−KKCPDILISRGNWAGFVQGIQWYANINAQIDTPLQDKNDSFNPNENN−−−PAEPS−−−−−−−−−−−−−−−−−MELVVNGSGINV−−−−−−RSDAG−−−−−−−−−−−−−−−IEHRVVRKASTGDRYKVLAVKNG−−−−WYKVGNGEWIFYDPSWIKIN                                                                                                      
fig|527026.3.peg.188   Bacillus thuringiensis serovar sotto str. T04001                                                                        ENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEIAVNQDG−−DYNKALENAKRLAGYLMNKEGIGADH−−−−−−−−IYKHQQWSG−−−−−−−−−−−KKCPDILISRGNWAGFVQGIQWYANINAQIDTPLQDKNESFDPNENN−−−PAEPS−−−−−−−−−−−−−−−−−MELVVNGSGINV−−−−−−RSDAG−−−−−−−−−−−−−−−IEHRVVRKASNGDRYKVLAVKNG−−−−WYKVGNGEWIFYDPSWIKIN                                                                                                      
fig|527025.3.peg.4899   Bacillus thuringiensis serovar thuringiensis str. T01001                                                                        ENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEIAVNQDG−−DYNKALENAKRLAGYLMNKEGIGADH−−−−−−−−IYKHQQWSG−−−−−−−−−−−KKCPDILISRGNWAGFVQGIQWYANINAQIDTPLQDKNESFDPNENN−−−PAEPS−−−−−−−−−−−−−−−−−MELVVNGSGINV−−−−−−RSDAG−−−−−−−−−−−−−−−IEHRVVRKASNGDRYKVLAVKNG−−−−WYKVGNGEWIFYDPSWIKIN                                                                                                      
fig|527031.3.peg.4732   Bacillus thuringiensis serovar berliner ATCC 10792                                                                        ENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEIAVNQDG−−DYNKALENAKRLAGYLMNKEGIGADH−−−−−−−−IYKHQQWSG−−−−−−−−−−−KKCPDILISRGNWAGFVQGIQWYANINAQIDTPLQDKNESFDPNENN−−−PAEPS−−−−−−−−−−−−−−−−−MELVVNGSGINV−−−−−−RSDAG−−−−−−−−−−−−−−−IEHRVVRKASNGDRYKVLAVKNG−−−−WYKVGNGEWIFYDPSWIKIN                                                                                                      
fig|526992.3.peg.848   Bacillus cereus AH1271                                                     RYITIHETANTA−−RGANAENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEISVNQDG−−DYNKALENAKRLAGYLMNKEGISADH−−−−−−−−IYRHQQWSG−−−−−−−−−−−KNCPDILISRGNWAGFVQGIQWYANVNAQIDSPLQERNELFDSNEFN−−−PAEPS−−−−−−−−−−−−−−−−−MELVVNGDGINI−−−−−−RSGAG−−−−−−−−−−−−−−−IEHPTVRKASNGDRYKVLAVKNG−−−−WYKVGNGEWIFYNPSWIKIN                                                                                                      
fig|526971.3.peg.3853   Bacillus cereus MM3                                                     RYITIHETANTA−−RGANAENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEISVNQDG−−DYNKALENAKRLAGYLMNKEGISADH−−−−−−−−IYRHQQWSG−−−−−−−−−−−KNCPDILISRGNWNGFVQGIQWYANVNAQIDSPLQERNELFDSNEFN−−−PAEPS−−−−−−−−−−−−−−−−−MELVVNGDGINV−−−−−−RSGAG−−−−−−−−−−−−−−−LEHQTVRKASKGDRYKVLAVKNG−−−−WYKVGNGEWIFYNPSWIKIN                                                                                                      
fig|361100.6.peg.3083   Bacillus cereus Q1                                                     RYITIHETANTA−−RGANAENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEISVNQDG−−DYNKALENAKRLAGYLMNKEGISADH−−−−−−−−IYRHQQWSG−−−−−−−−−−−KNCPDILISRGNWTGFVQGIQWYANVNAQIDSPLQERNELFDSNEYN−−−PAEPN−−−−−−−−−−−−−−−−−MELVVNGDGINV−−−−−−RSGSG−−−−−−−−−−−−−−−LEHHIVRKASNGDRYKVLAVKNG−−−−WYKVGNDEWIFYNPSWIKIN                                                                                                      
fig|526975.3.peg.4142   Bacillus cereus BDRD-ST26                                                     RYITIHETANTA−−RGANAENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEISVNQDG−−DYNKALENAKRLAGYLMNKEGISADH−−−−−−−−IYRHQQWSG−−−−−−−−−−−KNCPDILISRGNWTGFVQGIQWYANVNAQIDSPLQERNELFDSNEYN−−−PAEPN−−−−−−−−−−−−−−−−−MELVVNGDGINV−−−−−−RSGSG−−−−−−−−−−−−−−−LEHHIVRKASNGDRYKVLAVKNG−−−−WYKVGNDEWIFYNPSWIKIN                                                                                                      
fig|527024.3.peg.4399   Bacillus thuringiensis serovar tochigiensis BGSC 4Y1                                                     RYITIHETANTA−−RGANAENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEISVNQDG−−DYNKALENAKRLAGYLMNKEGISADH−−−−−−−−IYRHQQWSG−−−−−−−−−−−KNCPDILISRGNWTGFVQGIQWYANVNAQIDSPLQERNELFDSNEYN−−−PAEPN−−−−−−−−−−−−−−−−−MELVVNGDGINV−−−−−−RSGSG−−−−−−−−−−−−−−−LEHHIVRKASNGDRYKVLAVKNG−−−−WYKVGNDEWIFYNPSWIKIN                                                                                                      
fig|526977.3.peg.3230   Bacillus cereus ATCC 4342                                                     RYITIHETANTA−−RGANAENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEISVNQDG−−DYNKALENAKRLAGYLMNKEGISADH−−−−−−−−IYRHQQWSG−−−−−−−−−−−KNCPDILISRGNWTGFVQGIQWYANVNAQIDSPLQERNELFDSNEYN−−−PAEPN−−−−−−−−−−−−−−−−−MELVVNGDGINV−−−−−−RSGSG−−−−−−−−−−−−−−−LEHYIVRKASNGDRYKVLAVKNG−−−−WYKVGNDEWIFYNPSWIKIN                                                                                                      
fig|526973.3.peg.4603   Bacillus cereus m1293                                                     RYITIHETANTA−−RGANAENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEIAVNQDG−−DYNKALENAKRLAGYLMNKEGISADH−−−−−−−−IYRHQQWSG−−−−−−−−−−−KNCPDILISRGNWTGFVQGIQWYANVNAQIDSPLQERNELFDSNEYN−−−PAEPN−−−−−−−−−−−−−−−−−MELVVNGDGINV−−−−−−RSGSG−−−−−−−−−−−−−−−LEHHIVRKASNGDRYKVLAVKNG−−−−WYKVGNDEWIFYNPSWIKIN                                                                                                      
fig|222523.6.peg.3146   Bacillus cereus ATCC 10987                                                     RYITIHETANTA−−RGANAENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEISVNQDG−−DYNKALENAKRLAGYLMNKEGISADH−−−−−−−−IYRHQQWSG−−−−−−−−−−−KNCPDILISRGNWTGFVQGIQWYANVNAQIDSPLQERNELFDSNEYN−−−PAEPN−−−−−−−−−−−−−−−−−MELVVNGDGINV−−−−−−RSGWG−−−−−−−−−−−−−−−LEHHIVRKASNGDRYKVFAVKNG−−−−WYKVGNDEWIFYNPSWIKIN                                                                                                      
fig|269801.5.peg.245   Bacillus cereus G9241                                                     RYITIHETANTA−−RGANAENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEISVNQDG−−DYNKALENAKRLAGYLMNKEGISADH−−−−−−−−IYRHQQWSG−−−−−−−−−−−KNCPDILISRGNWTGFVQGIQWYANVNVQIDSPLQERNELFDSNEYN−−−PAEPN−−−−−−−−−−−−−−−−−MELVVNGDGINV−−−−−−RSGAG−−−−−−−−−−−−−−−LEHQTIRKASNGDRYKVLAVKNG−−−−WYKVGNDEWIFYNPSWIKIN                                                                                                      
fig|405535.8.peg.3290   Bacillus cereus AH820                                                     RYITIHETANIA−−RGANAENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEISVNQDG−−DYNKALENAKRLAGYLMNKEGISADH−−−−−−−−IYRHQQWSG−−−−−−−−−−−KNCPDILISRGNWTGFVQGIQWYANVNAQIDSPLQERNELFDSNEYN−−−PAEPN−−−−−−−−−−−−−−−−−MELVVKGDGINV−−−−−−RSGAG−−−−−−−−−−−−−−−LEHQTVRKASNGDRYKVLAVKNG−−−−WYKVGNDEWIFYNPSWIKIN                                                                                                      
fig|527028.3.peg.4567   Bacillus thuringiensis serovar pulsiensis BGSC 4CC1                                                       ITIHETANIA−−RGANAENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEISVNQDG−−DYNKALENAKRLAGYLMNKEGISVDH−−−−−−−−IYRHQQWSG−−−−−−−−−−−KNCPDILISRGNWTGFVQGIQWYANVNAQIDSPLQERNELFNSNEYN−−−PAEPN−−−−−−−−−−−−−−−−−MELVVKGDGINV−−−−−−RSGAG−−−−−−−−−−−−−−−LEHQTVRKASNGDRYKVLAVKNG−−−−WYKVGNDEWIFYNPSWIKIN                                                                                                      
fig|572264.4.peg.3263   Bacillus cereus 03BB102                                                     RYITIHETANTA−−RGANAENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEISVNQDG−−DYNKALENAKRLAGYLMNKEGISADH−−−−−−−−IYRHQQWSG−−−−−−−−−−−KNCPDILISRGNWTGFVQGIQWYANVNAQIDSPLQERNELFDSNEYN−−−PAEPN−−−−−−−−−−−−−−−−−MELVVKGDGINV−−−−−−RSGAG−−−−−−−−−−−−−−−LEHQTVRKASNGDRYKVLAVKNG−−−−WYKVGNDEWIFYNPSWIKINYNV−−−−−−PNKEVQTPKDDITGG                                                                              
fig|288681.12.peg.3155   Bacillus cereus E33L                                                     RYITIHETANTA−−RGANAENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEISVNQDG−−DYNKALENAKRLAGYLMNKEGISADH−−−−−−−−IYRHQQWSG−−−−−−−−−−−KNCPDILISRGNWTGFVQGIQWYANVNAQIDSPLHERNELFDSNEYN−−−PAEPN−−−−−−−−−−−−−−−−−MELVVKGDGINV−−−−−−RSGAG−−−−−−−−−−−−−−−LEHQTVRKASNGDRYKVLAVKNG−−−−WYKVGNDEWIFYNPSWIKIN                                                                                                      
fig|451707.4.peg.815   Bacillus cereus NVH0597-99                                                     RYITIHETANTA−−RGANAENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGNGSGNRESIGIEISVNQDG−−DYNKALENAKRLAGYLMNKEGISADH−−−−−−−−IYRHQQWSG−−−−−−−−−−−KNCPDILISRGNWTGFVQGIQWYANVNAQIDSPLQERNELFDSNEYN−−−PAEPN−−−−−−−−−−−−−−−−−MELVVKGDGINV−−−−−−RSGAG−−−−−−−−−−−−−−−LEHQTVRKASNGDRYKVLAVKNG−−−−WYKVGNDEWIFYNPSWIKIN                                                                                                      
fig|526979.3.peg.3616   Bacillus cereus 95/8201                                                     RYITIHETANTA−−RGANAENHAKYLYKQA−−TKGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEISVNQDG−−DYNKALENAKRLAGYLMNKEGISADH−−−−−−−−IYRHQQWSG−−−−−−−−−−−KNCPDILISRGNWTGFVQGIQWYANVNAQIDSPLQERNELFDSNEYN−−−PAEPN−−−−−−−−−−−−−−−−−MELVVKGDGINV−−−−−−RSGAG−−−−−−−−−−−−−−−LEHQTVRKASNGDRYKVLAVKNG−−−−WYKVGNDEWIFYNPSWIKIN                                                                                                      
fig|405917.4.peg.56   Bacillus cereus W                                                     RYITIHETANTA−−RGANAENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEISVNQDG−−DYNKALENAKRLAGYLMNKEGISADH−−−−−−−−IYRHQQWSG−−−−−−−−−−−KNCPDILISRGNWTGFVQGIQWYANVNAQIDSPLQERNELFDSNEYN−−−PAEPN−−−−−−−−−−−−−−−−−MELVVKGDGINV−−−−−−RSGAG−−−−−−−−−−−−−−−LEHQTVRKASNGDRYKVLAVKNG−−−−WYKVGNDEWIFYNPSWIKIN                                                                                                      
fig|347495.3.peg.3136   Bacillus cereus F837/76                                                     RYITIHETANTA−−RGANAENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEISVNQDG−−DYNKALENAKRLAGYLMNKEGISADH−−−−−−−−IYRHQQWSG−−−−−−−−−−−KNCPDILISRGNWTGFVQGIQWYANVNAQIDSPLQERNELFDSNEYN−−−PAEPN−−−−−−−−−−−−−−−−−MELVVKGDGINV−−−−−−RSGAG−−−−−−−−−−−−−−−LEHQTVRKASNGDRYKVLAVKNG−−−−WYKVGNDEWIFYNPSWIKIN                                                                                                      
fig|526985.3.peg.5059   Bacillus cereus Rock3-42                                                     RYITIHETANTA−−RGANAENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEISVNQDG−−DYNKALENAKRLAGYLMNKEGISADH−−−−−−−−IYRHQQWSG−−−−−−−−−−−KNCPDILISRGNWTGFVQGIQWYANVNAQIDSPLQERNELFDSNEYN−−−PAEPN−−−−−−−−−−−−−−−−−MELVVKGDGINV−−−−−−RSGAG−−−−−−−−−−−−−−−LEHQTVRKASNGDRYKVLAVKNG−−−−WYKVGNDEWIFYNPSWIKIN                                                                                                      
fig|527032.3.peg.4474   Bacillus thuringiensis serovar andalousiensis BGSC 4AW1                                                     RYITIHETANTA−−RGANAENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEISVNQDG−−DYNKALENAKRLAGYLMNKEGISADH−−−−−−−−IYRHQQWSG−−−−−−−−−−−KNCPDILISRGNWTGFVQGIQWYANVNAQIDSPLQERNELFDSNEYN−−−PAEPN−−−−−−−−−−−−−−−−−MELVVKGDGINV−−−−−−RSGAG−−−−−−−−−−−−−−−LEHQTVRKASNGDRYKVLAVKNG−−−−WYKVGNDEWIFYNPSWIKIN                                                                                                      
fig|280355.3.peg.2398   Bacillus anthracis str. A1055                                                     RYITIHETANTA−−RGANAENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEISVNQDG−−DYNKALENAKRLAGYLMNKEGISADH−−−−−−−−IYRHQQWSG−−−−−−−−−−−KNCPDILISRGNWTGFVQGIQWYANVNAQIDSPLQERNELFDSNEYN−−−PAEPN−−−−−−−−−−−−−−−−−MELVVKGDGINV−−−−−−RSGAG−−−−−−−−−−−−−−−LEHQTVRKASNGDRYKVLAVKNG−−−−WYKVGNDEWIFYNPSWIKIN                                                                                                      
fig|412694.7.peg.3290   Bacillus thuringiensis str. Al Hakam                                                     RYITIHETANTA−−RGANAENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEISVNQDG−−DYNKALENAKRLAGYLMNKEGISADH−−−−−−−−IYRHQQWSG−−−−−−−−−−−KNCPDILISRGNWTGFVQGIQWYANVNAQIDSPLQERNELFDSNEYN−−−PAEPN−−−−−−−−−−−−−−−−−MELVVKGDGINV−−−−−−RSGAG−−−−−−−−−−−−−−−LEHQTVRKASNGDRYKVLAVKNG−−−−WYKVGNDEWIFYNPSWIKIN                                                                                                      
fig|527022.3.peg.5891   Bacillus thuringiensis serovar monterrey BGSC 4AJ1                                                     RYITIHETANTA−−RGANAENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEISVNQDG−−DYNKALENAKRLAGYLMNKEGISADH−−−−−−−−IYRHQQWSG−−−−−−−−−−−KNCPDILISRGNWTGFVQGIQWYANVNAQIDSPLQERNELFDSNEYN−−−PAEPN−−−−−−−−−−−−−−−−−MELVVKGDGINV−−−−−−RSGAG−−−−−−−−−−−−−−−LEHQTVRKASNGDRYKVLAVKNG−−−−WYKVGNDEWIFYNPSWIKIN                                                                                                      
fig|526968.3.peg.3281   Bacillus cereus R309803                                                     RYITIHETANTA−−RGANAENHAKYLYKQA−−TEGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGDGSGNRESIGIEIAVNQDG−−DYNKALENAKRLAGYLMNKEGIGVNN−−−−−−−−IYKHQQWSG−−−−−−−−−−−KKCPDILISRGNWTGFVQGAQWYANINTQIDKPLQDKNESFNPNDNN−−−PAEPS−−−−−−−−−−−−−−−−−MELVVNGDGINV−−−−−−RSGAG−−−−−−−−−−−−−−−LEHRVVRKASKGDRYKVLAVKDG−−−−WYKVGNGEWIFYNQSWIKIDYNV−−−−−−PKKEEQKPKDDITG                                                                               
fig|527020.3.peg.3051   Bacillus thuringiensis IBL 4222                                                     RYITIHETANTE−−RGANAEAHAKYLYNQA−−TQGTFRTASWHFTVDDKQIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGNGPGNRESIGIEIAVNQDG−−DYNKALENAKRLAGYLMNKEGIPASN−−−−−−−−IVKHQHWSG−−−−−−−−−−−KKCPDIMISRGNFAGFVQGIEWYASLNNTLEGMTDTQENNNSNEVN−−−PAEPV−−−−−−−−−−−−−−−−−MELVVKGYGINI−−−−−−RSGAG−−−−−−−−−−−−−−−IENGVVGKANSGDKFRVLAVKNG−−−−WYKTEKGWIFYDPSYIKIN                                                                                                      
fig|526981.3.peg.1181   Bacillus cereus Rock1-3                                                     KYITIHETANTA−−PGANAESHAKYLYNQA−−TSGTVRTASWHFTVDDKEIYQHLP−−−−TNENGWHA−−−−−−−−−−−GDGGTGTGNRESIGIEIAVNQDG−−DYNKAVENAKKLVAHLMKQEGISASN−−−−−−−−LRRHEQWSG−−−−−−−−−−−KKCPDIIITRGTWNSFVEGANGYLNGGTGTNPPLVDEKEDVDGNETN−−−PAEPN−−−−−−−−−−−−−−−−−IELEITGTSVNV−−−−−−RSGAG−−−−−−−−−−−−−−−VNYGVVRIAKKGEKYKVLSIKDG−−−−WYEIKKGEWVKYDPSWSKLTNNA−−−−−−−QDKDPNTTKEGWVFKNNNWYYTNS                                                                    
fig|527019.3.peg.173   Bacillus thuringiensis IBL 200                                     IIPKGNRNRPAYAMNPRYITIHTTANQN−−AGADARAHARYVNNGGGSS−−−−−GVSWHFTVDDNRIVQHLP−−−−LNENGWHA−−−−−−−−−−−GDGNGTGNRSSIGIEICENRDG−−NFEKALVNAAKLVKFLMNHIGIGIGN−−−−−−−−VVSHQYWSG−−−−−−−−−−−KECPRPILKRTGGFEGFKKMIEGSTD−−−−−−−−−−−−−−−−−−−−DIN−−−GQKPN−−−−−−−−−KDAGTQGLGIAYIEGVNINL−−−−−−RRDPT−−−−−−−−−−−−−−−TSSEIIRKLNKPEAYIVWEEREG−−−−WLNVG−−NSWVKYDASYIYFARRQ−−−−−−−−−−−TSNIGKLVVVDTNELWVYGSADWNDK−−IQTVKK−−GEAFTILDELQVNGSNMYKC−−−−−KYFYITANSQFV               
fig|1053196.3.peg.6409   Bacillus cereus BMG1.7                                     IIPKGNRNRPAYSMNPRYITIHTTANQN−−AGTDARAHARYVNNGGGSS−−−−−SVSWHFTVDDNRIVQHLP−−−−LNENGWHA−−−−−−−−−−−GDGNGAGNRSSIGIEICENRDG−−NFEKALTHAAGLVKFLMAHLGLKIGN−−−−−−−−VVSHQHWSG−−−−−−−−−−−KNCPRPIFNRPGGFEGFKRMIEDSLN−−−−−−−−−−−−−−−−−−−−DMV−−−VENHN−−−−−−−−−KDAGTQGLGIAYMEGVNINL−−−−−−RRGPS−−−−−−−−−−−−−−−TSSDVIRKLNKPESYIVWEEREG−−−−WLNLG−−NSWVKYDSSYIYFARRQ−−−−−−−−−−−TSNIGKLVVVDTNELWVYGSANWNDK−−IKTVKK−−GEAFTIQDELQVNGSNMYKC−−−−−KYFYITTNSQFV               
fig|527023.3.peg.3055   Bacillus thuringiensis serovar kurstaki str. T03a001                                     IIPKGNRNRPAYSMNPRYITIHTTANQN−−AGTDARAHARYVNNGGGSS−−−−−SVSWHFTVDDNRIVQHLP−−−−LNENGWHA−−−−−−−−−−−GDGNGAGNRSSIGIEICENRDG−−NFEKALTHAAGLVKFLMAHLGLKIGN−−−−−−−−VVSHQHWSG−−−−−−−−−−−KNCPRPIFNRPGGFEGFKRMIEDSLN−−−−−−−−−−−−−−−−−−−−DMV−−−VENHN−−−−−−−−−KDAGTQGLGIAYMEGVNINL−−−−−−RRGPS−−−−−−−−−−−−−−−TSSDVIRKLNKPESYIVWEEREG−−−−WLNLG−−NSWVKYDSSYIYFARRQ−−−−−−−−−−−TSNIGKLVVVDTNELWVYGSANWNDK−−IKTVKK−−GEAFTIQDELQVNGSNMYKC−−−−−KYFYITTNSQFV               
fig|1053196.3.peg.5448   Bacillus cereus BMG1.7                                     IIPKGNRNRPAYTMNPRYITIHTTANQN−−AGADARAHARYVNNGGGSS−−−−−GVSWHFTVDDHRIVQHLP−−−−LNENGWHA−−−−−−−−−−−GDGNGAGNRSSIGIEICENRDG−−NFEKALTHAAGLVKFLMAHLGLKIGN−−−−−−−−VVSHQHWSG−−−−−−−−−−−KNCPRPIFNRPGGFEGFKRMIEDSLN−−−−−−−−−−−−−−−−−−−−DMV−−−VENHN−−−−−−−−−KDAGTQGLGIAYMEGVNINL−−−−−−RRGPS−−−−−−−−−−−−−−−TSSDVIRKLNKPESYIVWEEREG−−−−WLNLG−−NSWVKYDSSYIYFARRQ−−−−−−−−−−−TSNIGKLVVVDTNELWVYGSANWNDK−−IKTVKK−−GEAFTIQDELQVNGSNMYKC−−−−−KYFYITANSQFV               
fig|527026.3.peg.3970   Bacillus thuringiensis serovar sotto str. T04001                                     IIPKGNRNRPAYTMNPRYITIHTTANQN−−AGADARAHARYVNNGGGSS−−−−−GVSWHFTVDDHRIVQHLP−−−−LNENGWHA−−−−−−−−−−−GDGNGAGNRSSIGIEICENRDG−−NFEKALTHAAGLVKFLMAHLGLKIGN−−−−−−−−VVSHQHWSG−−−−−−−−−−−KNCPRPIFNRPGGFEGFKRMIEDSLN−−−−−−−−−−−−−−−−−−−−DMV−−−VENHN−−−−−−−−−KDAGTQGLGIAYMEGVNINL−−−−−−RRGPS−−−−−−−−−−−−−−−TSSDVIRKLNKPESYIVWEEREG−−−−WLNLG−−NSWVKYDSSYIYFARRQ−−−−−−−−−−−TSNIGKLVVVDTNELWVYGSANWNDK−−IKTVKK−−GEAFTIQDELQVNGSNMYKC−−−−−KYFYITANSQFV               
fig|1053196.3.peg.6003   Bacillus cereus BMG1.7                                                       ITFHNTYND−−−−−ATALNERNNVANNS−−T−−−−−GTSFHIAVDDKEAIQLIP−−−−FNRNAWHA−−−−−−−−−−−GDGNGPGNRNSIGIEICYSMSGGERYRKAELNAAQVIRQLMDMFNIPISK−−−−−−−−VKTHQERNG−−−−−−−−−−−KYCPHRMINEGRVQWF−−−KQQLVS−−−−GGEIQI−−−−−−−−−PETPQIPQPPI−−−−−−−−−−−−−TSGTGIVYITGQNVNL−−−−−−RKGPG−−−−−−−−−−−−−−−TQYDSIRKLNAPENYKVWGRSGG−−−−WLNLGGDQWVYENSEWLHFEADG−−−−QSSTTSQPSNDGLGVVTITADVLRVRTGP                                                                  
fig|527023.3.peg.43   Bacillus thuringiensis serovar kurstaki str. T03a001                                                       ITFHNTYND−−−−−ATALNERNNVANNS−−T−−−−−GTSFHIAVDDKEAIQLIP−−−−FNRNAWHA−−−−−−−−−−−GDGNGPGNRNSIGIEICYSMSGGERYRKAELNAAQVIRQLMDMFNIPISK−−−−−−−−VKTHQERNG−−−−−−−−−−−KYCPHRMINEGRVQWF−−−KQQLVS−−−−GGEIQI−−−−−−−−−PETPQIPQPPI−−−−−−−−−−−−−TSGTGIVYITGQNVNL−−−−−−RKGPG−−−−−−−−−−−−−−−TQYDSIRKLNAPENYKVWGRSGG−−−−WLNLGGDQWVYENSEWLHFEADG−−−−QSSTTSQPSNDGLGVVTITADVLRVRTGP                                                                  
fig|527025.3.peg.1925   Bacillus thuringiensis serovar thuringiensis str. T01001                                      DPSKYGTKCPYTMNPEFITVHNTYND−−−−−APAENEIAYMIRNN−−N−−−−−EVSFHIAVDDKEAVQGLP−−−−LERNAWAC−−−−−−−−−−−GDGNGSGNRKSISVEICYSLSGGDRYYKAENNAAIVVAQLMKQYNIPISK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KYCPHRMLAEGRWNSFIERVQNAYI−−−−GGGNTG−−−−−−−−−−ST−−−−−KPS−−−−−−−−−−−−−NNGIGVVTITADVLRV−−−−−−RTGPG−−−−−−−−−−−−−−−TNYGIVKNVYRGERYQSWGIQYG−−−−WYNVGGNQWV−−SGEYVRFEG                                                                                                     
fig|527031.3.peg.2156   Bacillus thuringiensis serovar berliner ATCC 10792                                      DPSKYGTKCPYTMNPEFITVHNTYND−−−−−APAENEIAYMIRNN−−N−−−−−EVSFHIAVDDKEAVQGLP−−−−LERNAWAC−−−−−−−−−−−GDGNGSGNRKSISVEICYSLSGGDRYYKAENNAAIVVAQLMKQYNIPISK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KYCPHRMLAEGRWNSFIERVQNAYI−−−−GGGNTG−−−−−−−−−−ST−−−−−KPS−−−−−−−−−−−−−NNGIGVVTITADVLRV−−−−−−RTGPG−−−−−−−−−−−−−−−TNYGIVKNVYRGERYQSWGIQYG−−−−WYNVGGNQWV−−SGEYVRFEG                                                                                                     
fig|527019.3.peg.1955   Bacillus thuringiensis IBL 200                                      DPSKYGTKCPYTMNPEFITVHNTYND−−−−−APAENEIAYMIRNN−−N−−−−−EVSFHIAVDDKEAVQGLP−−−−LERNAWAC−−−−−−−−−−−GDGNGSGNRKSISVEICYSLSGGDRYYKAENNAAIVVAQLMKQYNIPISK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KYCPHRMLAEGRWNSFIERVQNAYI−−−−GGGNTG−−−−−−−−−−ST−−−−−KTS−−−−−−−−−−−−−NNGIGVVTITADVLRV−−−−−−RTGPG−−−−−−−−−−−−−−−TNYGIVKNVYRGERYQSWGIQYG−−−−WYNVGGNQWV−−SGEYVRFEG                                                                                                     
fig|1053196.3.peg.283   Bacillus cereus BMG1.7                                      DPSKYGTKCPYTMNPEFITVHNTYND−−−−−APAENEIAYMIRNN−−N−−−−−EVSFHIAVDDKEAVQGLP−−−−LERNAWAC−−−−−−−−−−−GDGNGSGNRKSISVEICYSLSGGDRYYKAENNAAIVVAQIMKQYNIPINK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KYCPHRMLAEGRWNSFIERVQNAYN−−−−GGGNAG−−−−−−−−−−ST−−−−−KPS−−−−−−−−−−−−−NNGVGVVIITANVLRV−−−−−−RTGPG−−−−−−−−−−−−−−−TNYGIVKNVYRGERYQSWGIQYG−−−−WYNVGGNQWV−−SGEYVRFEG                                                                                                     
fig|527023.3.peg.1965   Bacillus thuringiensis serovar kurstaki str. T03a001                                      DPSKYGTKCPYTMNPEFITVHNTYND−−−−−APAENEIAYMIRNN−−N−−−−−EVSFHIAVDDKEAVQGLP−−−−LERNAWAC−−−−−−−−−−−GDGNGSGNRKSISVEICYSLSGGDRYYKAENNAAIVVAQIMKQYNIPINK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KYCPHRMLAEGRWNSFIERVQNAYN−−−−GGGNAG−−−−−−−−−−ST−−−−−KPS−−−−−−−−−−−−−NNGVGVVIITANVLRV−−−−−−RTGPG−−−−−−−−−−−−−−−TNYGIVKNVYRGERYQSWGIQYG−−−−WYNVGGNQWV−−SGEYVRFEG                                                                                                     
fig|527020.3.peg.3453   Bacillus thuringiensis IBL 4222                                                       ITVHNTYND−−−−−APAENEIAYMIRNN−−N−−−−−EVSFHIAVDDKEAVQGLP−−−−LERNAWAC−−−−−−−−−−−GDGNGSGNRKSISVEICYSLSGGDRYYKAENNAAIVVAQIMKQYNIPISK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KYCPHRMLAEGRWNSFIERVQNAYN−−−−GGGDTG−−−−−−−−−−ST−−−−−KPS−−−−−−−−−−−−−NNGVGVITITADVLRV−−−−−−RTGPG−−−−−−−−−−−−−−−TNYGIVKNVYRGERYQSWGIQNG−−−−WYNVGGNQWV−−SGEYVRFEG                                                                                                     
fig|527027.3.peg.3176   Bacillus thuringiensis serovar pakistani str. T13001                                      DPSKYGTKCPYTMNPEFITVHNTYND−−−−−APAENEIAYMIRNN−−N−−−−−EVSFHIAVDDKEAVQGLP−−−−LERNAWAC−−−−−−−−−−−GDGNGSGNRKSISVEICYSLSGGDRYYKAENNAAIVVAQLMKQYNIPLSK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KYCPHRMLAEGRWGSFIERVQNAYN−−−−GGGNTA−−−−−−−−−PST−−−−−KPS−−−−−−−−−−−−−NNGVGVVTITANVLRV−−−−−−RTGPG−−−−−−−−−−−−−−−TNYDIVKNVYRGERYQSWGIQNG−−−−WYNVGGDQWV−−SGEYVRFEG                                                                                                     
fig|527025.3.peg.2182   Bacillus thuringiensis serovar thuringiensis str. T01001                                      DPSKYGTKCPYTMNPEFITVHNTYND−−−−−APAENEIAYMIRNN−−N−−−−−EVSFHIAVDDKEAVQGIL−−−−LERNAWHC−−−−−−−−−−−GDGGGNGNRKSIGVEICYSLSGGDRYYKAENNAAIIVAQLMRQYNIPISK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KYCPHRMLAEGRWNSFIERVQKTYD−−−−GGGNTT−−−−−−−−−PST−−−−−QPA−−−−−−−−−−−−−NNGVGVVTITADVLRV−−−−−−RTGPG−−−−−−−−−−−−−−−TNYDIVKKVYRGERYQSWGIQNG−−−−WYNVGGDQWV−−SGEYVRFEG                                                                                                     
fig|527031.3.peg.2053   Bacillus thuringiensis serovar berliner ATCC 10792                                      DPSKYGTKCPYTMNPEFITVHNTYND−−−−−APAENEIAYMIRNN−−N−−−−−EVSFHIAVDDKEAVQGIL−−−−LERNAWHC−−−−−−−−−−−GDGGGNGNRKSIGVEICYSLSGGDRYYKAENNAAIIVAQLMRQYNIPISK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KYCPHRMLAEGRWNSFIERVQKTYD−−−−GGGNTT−−−−−−−−−PST−−−−−QPA−−−−−−−−−−−−−NNGVGVVTITADVLRV−−−−−−RTGPG−−−−−−−−−−−−−−−TNYDIVKKVYRGERYQSWGIQNG−−−−WYNVGGDQWV−−SGEYVRFEG                                                                                                     
fig|527020.3.peg.3606   Bacillus thuringiensis IBL 4222                                      DPSKYGIKCPYTMNPEFITVHNTYND−−−−−ASAENEIAYMIRNN−−N−−−−−EVSFHIAVDDKEAVQGIP−−−−LERNAWHC−−−−−−−−−−−GDGGGNGNRKSIGVEICYSLSGGDRYYKAENNAAIIMAQLMRQYNIPISK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KHCPHRMLAEGRWGSFIERVQNAYD−−−−GGGNTA−−−−−−−−−PST−−−−−QPS−−−−−−−−−−−−−NNGVGVVTITADVLRV−−−−−−RTGPG−−−−−−−−−−−−−−−TNYDIVKKVYRGERYQSWGIQNG−−−−WYNVGGDQWV−−SGEYVRFEG                                                                                                     
fig|527020.3.peg.1523   Bacillus thuringiensis IBL 4222                                      DPSKYGTKCPYTMNAEFITVHNTYND−−−−−ASAENEIAYMIRNN−−N−−−−−EVSFHIAVDDKEAVQGIP−−−−LERNAWHC−−−−−−−−−−−GDGGGNGNRKSIGVEICYSLSGGDRYYKAENNAAIVVAQLMKQFNIPISK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KYCPHRMLDEGRWNSFIERVQNAYN−−−−GGGNTA−−−−−−−−−PST−−−−−QPS−−−−−−−−−−−−−NNGVGVVTITADVLRV−−−−−−RTGPG−−−−−−−−−−−−−−−TNYDIVKKVYRGERYQSWGIQNG−−−−WYNVGGDQWV−−SGEYVRFEG                                                                                                     
fig|527020.3.peg.3712   Bacillus thuringiensis IBL 4222                                                                                               HFAVDDIEVIQGIP−−−−VDRNAWHC−−−−−−−−−−−GDGGGNGNRKSIGVEICYSLSGGPRYEKAEALSIKFVAQLLRERGWGIDR−−−−−−−−VRTHKSWTEIGVKNGNSRAVKNCPHRILDAGRWNSFLAAVQAELN−−−−−−−GSTV−−−−−−−APPVT−−−−PPPS−−−−−−−−−−−−−TDGIGVVEILVAELNV−−−−−−RESAS−−−−−−−−−−−−−−−FDSRVVKTVKKGETYQTWGLSNG−−−−LYNVGGNQWVSAGPAYVKFTPAGSSSNGTPEDLAGKRNPIGKITTTANLNVRTKPSTDGDIIRTISSG                                                     
fig|405532.4.peg.3298   Bacillus cereus B4264                                           PIKAPYSMNAEYITVHNTYND−−−−−APAKNEINYMIGNN−−N−−−−−EVSFHFAVDDIEVIQGIP−−−−VNRNAWHC−−−−−−−−−−−GDGGGNGNRKSIGVEICYSLSGGPRYEKAESLAIKFVAQLLRERGWGIDR−−−−−−−−VRTHKSWTEIGVRNGNSRAVKNCPHRILDEGRWNSFLAAVQAELT−−−−GTGATI−−−−−−−APPVT−−−−QPPS−−−−−−−−−−−−−SDGIGVVEILVPELNV−−−−−−REFAS−−−−−−−−−−−−−−−FDSRVVKTVKKGEMYQTWGLSNG−−−−LYNVGGNQWVSAGPAYVKFTPAGSSNGNPENLAGKR                                                                                     
fig|315730.11.peg.289   Bacillus weihenstephanensis KBAB4                                           PIKAPYSMNAEYITVHNTYND−−−−−APAKNEINYMVGNN−−N−−−−−EVSFHFAVDDIEVIQGIP−−−−VNRNAWHC−−−−−−−−−−−GDGSGNGNRKSIGVEICYSLSGGPRYEKAESLAIKFVAQLLRERGWGIDR−−−−−−−−VRTHKSWTEIGVRNGNSRAVKNCPHRILDEGRWNSFLAAVQAELT−−−−GTGATI−−−−−−−APPVT−−−−QPPS−−−−−−−−−−−−−SDGIGVVEILVPELNV−−−−−−REFAS−−−−−−−−−−−−−−−FDSRVVKTVKKGEMYQTWGLSNG−−−−LYNVGGNQWVSAGPAYVKFTPAGSSNGNPENLAGKRDPIGKITTTANLNVRTQSSTDGDIIRTIPNGETWNIYDISGGWARVHD                                    
fig|315730.11.peg.546   Bacillus weihenstephanensis KBAB4                                                     EFITVHNTYND−−−−−ATAENEVAYMIRND−−N−−−−−QVSFHIAVDDKEAVQGIP−−−−LERNAWHC−−−−−−−−−−−GDGGGNGNRKSIGVEICYSLNGGDRYYKAEDNAAIVVAQLMKQYNIPINK−−−−−−−−VRTHQSWNG−−−−−−−−−−−KYCPHRMLAEGRWNRFIERVQNACN−−−−GGGNNV−−−−−−−−−APT−−−PIPPS−−−−−−−−−−−−−TSGTGIAYINGNNVNL−−−−−−RKGPG−−−−−−−−−−−−−−−TGYEVIRQLVKGESYQVFGESNG−−−−WLNLGRDQWVYNDSSYIRYTGGN−−−−−APATSQSSNDDVGVVTITADVLRVRTGP                                                                  
fig|526967.3.peg.119   Bacillus cereus 172560W                                                                              MIRND−−N−−−−−QVSFHIAVDDKEAVQGIP−−−−LERNAWHC−−−−−−−−−−−GDGGGNGNRKSIGVEICYSLSGGDRYYKAEDNAAIVVAQLMKQYNIPISK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KYCPHRMLAEGRWNSFIERVQNAYN−−−−DGGNNV−−−−−−−−−PQT−−−PIPPS−−−−−−−−−−−−−SSGTGIAYIEVNNVNL−−−−−−RKGPG−−−−−−−−−−−−−−−TGYGVIRQLGKGECYQVWGELNG−−−−WLNLGGDQWVYNDSSYIRYTGES−−−−−APAPS                                                                                         
fig|405531.7.peg.2495   Bacillus cereus G9842                                                                              MIRND−−N−−−−−QVSFHIAVDDKEAIQGIP−−−−LERNAWHC−−−−−−−−−−−GDGGGNGNRKSIGVEICYSLSGGDRYYKAEDNAAIVVAQLMKQYNIPISK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KYCPHRMLAEGRWNSFIERVQNAYN−−−−GGGNNV−−−−−−−−−PQT−−−PIPPS−−−−−−−−−−−−−SSGTGIAYIEGNNVNL−−−−−−RKGPG−−−−−−−−−−−−−−−TGYGVIRQLGKGECYQVWGELNG−−−−WLNLGGDQWVYNDSSYIRYTGEN−−−−−APAPS                                                                                         
fig|405532.4.peg.2407   Bacillus cereus B4264                                                     EFITVHNTYND−−−−−ATAANEVAYMIRND−−N−−−−−QVSFHIAVDDKEAVQGIP−−−−LERNAWHC−−−−−−−−−−−GDGGGNGNLKSIGIEICYSLNGGDQYYKAEDNAAIVVAQLMKQYNIPISK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KYCPHRMLAEGRWNSFIERVQNAYN−−−−GGGNNV−−−−−−−−−PQT−−−PIPPS−−−−−−−−−−−−−SSGTGIAYIEGNNVNL−−−−−−RKGPG−−−−−−−−−−−−−−−TGYGVIRQLGKGECYQVWGELSG−−−−WLNLGGDQWVYNDSSYIRYTGEN−−−−−APAPSKPSIDGIGVVTITADVLRVRTGP                                                                  
fig|714359.3.peg.2522   Bacillus thuringiensis BMB171                                      DPSKYGTKCPYTMNPEFITVHNTYND−−−−−ATAENEVSYMIRND−−N−−−−−QVSFHIAVDDKEAVQGIP−−−−LERNAWHC−−−−−−−−−−−GDGGGNGNRKSIGVEICYSLSGGDRYYKAEDNAAIVVAQLMKQYNIPISK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KYCPHRMLAEGRWNSFFERVQNAYN−−−−GSNNPV−−−−−−−−−MQK−−−PTPPS−−−−−−−−−−−−−TDGTNVAYINGDNVNL−−−−−−RKGPG−−−−−−−−−−−−−−−TGYAVIRKLGKGECYQVWGESNG−−−−WLNLGGDQWVYNDSSYIRYTGEN−−−−−APAPS                                                                                         
fig|526982.3.peg.3753   Bacillus cereus Rock1-15                                      DPSKYGTKCPYTMNPEFITVHNTYND−−−−−AMAENEVAYMIRND−−N−−−−−QVSFHIAVDDKEAVQGIP−−−−LERNAWHC−−−−−−−−−−−GDGGGNGNRKSIGVEICYSLSGGDRYYKAEDNAAIVVAQLMKQYNIPISK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KYCPHRMLAEGRWNSFIERVQNAYN−−−−GSNNPV−−−−−−−−−MQK−−−PTPPS−−−−−−−−−−−−−TDGTNVAYINGDNVNL−−−−−−RKGPG−−−−−−−−−−−−−−−TGYAVIRKLGKGECYQVWGESNG−−−−WLNLGGDQWVYNDSSYIRYTGEN−−−−−APAPSKPSIDGIGVVTITANVLRVRTGP                                                                  
fig|526980.3.peg.4906   Bacillus cereus ATCC 10876                                      DPSKYGTKCPYTMNPEFITVHNTYND−−−−−ATAENEVSYMIRND−−N−−−−−QVSFHIAVDDKEAVQGIP−−−−LERNAWHC−−−−−−−−−−−GDGGGNGNRKSIGVEICYSLNGGDRYYKAEDNAAIVVAQLMKQYNIPISK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KYCPHRMLAEGRWNSFIERVQNAYN−−−−GGGKVT−−−−−−−−−PT−−−PIPPS−−−−−−−−−−−−−NNGTGIAYIEGNGVNL−−−−−−RKGPG−−−−−−−−−−−−−−−TGYGVIRQLGKGESYEVWGQSNG−−−−WLNLGGDQWIYNDPSYIRYTGGE−−−−−APTPS                                                                                         
fig|527027.3.peg.741   Bacillus thuringiensis serovar pakistani str. T13001                                                                              MIRND−−K−−−−−QVSFHIAVDDKEAVQGIP−−−−LERNAWHC−−−−−−−−−−−GDGGGNGNRKSIGVEICYSLNGGNLYYKAEGNAAIVVAQLMKQYNIPISK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KYCPHRMLAEGRWNSFIERVQNVYN−−−−GGGKVT−−−−−−−−−PT−−−PIPPS−−−−−−−−−−−−−TNGTGIAYIEGNGVNL−−−−−−RKGPG−−−−−−−−−−−−−−−TGYGVIRQLGKGESYEVWGQSNG−−−−WLNLGGNQWIYNDPSYIRYTGGD−−−−−APAPSKSTNDGIGVVTITADVLRVRTGP                                                                  
fig|527023.3.peg.3045   Bacillus thuringiensis serovar kurstaki str. T03a001                                                     EFITVHNTYND−−−−−ATAENEVAYMIRND−−N−−−−−QVSFHIAVDDKEAVQGIP−−−−LERNAWHT−−−−−−−−−−−GDGNGNGNRKSIGVEICYSLSGGDRYYKAEDNATIVVAQLMKQYNIPIHK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KYCPHRMLAEGRWNNFIERVQHAYN−−−−GGSSLI−−−−−−−−−NLT−−−PTPSF−−−−−−−−−−−−−SGETGIAYIGGNSVNL−−−−−−RKGPG−−−−−−−−−−−−−−−TGYGIIRQLGKGESYKVWGQSNG−−−−WLNLGGDQWIYNDSSYIGYSGES−−−−−TPTTAQTVNDGVGVVTIKADVLRVRKGP                                                                  
fig|527026.3.peg.4063   Bacillus thuringiensis serovar sotto str. T04001                                      DPSKYGIKCPYTMNPEFITVHNTYND−−−−−ATAENEVSYMIRND−−N−−−−−QVSFHIAVDDKEAVQGIP−−−−LERNAWHT−−−−−−−−−−−GDGNGNGNRKSIGVEICYSLSGGDRYYKAEDNAAIVVAQLMKQYDIPIHK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KYCPHRMLAEGRWNNFIERVQHAYN−−−−GGSSLI−−−−−−−−−NLT−−−PTPSF−−−−−−−−−−−−−SGETGIAYIGGNSINL−−−−−−RKGPG−−−−−−−−−−−−−−−TGYGIIRQLGKGESYQVWGESNG−−−−WLNLGGDQWIYNDSSYIRYTGEK−−−−−VPAPS                                                                                         
fig|315730.11.peg.4044   Bacillus weihenstephanensis KBAB4                                                     EFITVHNTYND−−−−−ATAENEVAYMIRND−−N−−−−−QVSFHIAVDDKEAVQGIP−−−−LERNAWHT−−−−−−−−−−−GDGNGNGNRKSIGVEICYSLSGGDRYYKAEDNAAIVVAQLMKQYNIPINK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KYCPHRMLAEGRWNNFIESVQNAYN−−−−GDGKVT−−−−−−−−−PT−−−LIPPS−−−−−−−−−−−−−TNGTGIAYIEGNGINL−−−−−−RKGPG−−−−−−−−−−−−−−−TGYGVIRQLGKGESYEVWGQSNG−−−−WLNLGGDQWIYNDSSYIRYTGES−−−−−APTSSQSVNNGVGIVTITADVLRVRKGPGTNYDIVKNVYQGEQYQSWGYRDGWYNVGGDQWVSG                              
fig|205919.3.peg.5286   Bacillus anthracis str. Kruger B                                                     EFITVHNTYND−−−−−ATAENEVAYMIRND−−N−−−−−QVSFHIAVDDKEAVQGIP−−−−LERNAWHT−−−−−−−−−−−GDGNGNGNRKSIGVEICYSLSGGDRYYKAEDNAAIVVAQLMKQYNIPIKK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KYCPHRMLAEGRWNNFIERVQNAYN−−−−GDGKVT−−−−−−−−−PT−−−LIPPS−−−−−−−−−−−−−TNGTGIAYIEGNGINL−−−−−−RKGLG−−−−−−−−−−−−−−−TGYGVIRQLGKGESYEVWGQSNG−−−−WLNLGGNQWIYNDSSYIRYTGES−−−−−TPTSSQSVNNGVGIVTITADVLRVRKGPGTNYDIVKNVYQGEQYQSWGYRDGWYNVGGDQWVSG                              
fig|261594.21.peg.4052   Bacillus anthracis str. 'Ames Ancestor'                                                     EFITVHNTYND−−−−−ATAENEVAYMIRND−−N−−−−−QVSFHIAVDDKEAVQGIP−−−−LERNAWHT−−−−−−−−−−−GDGNGNGNRKSIGVEICYSLSGGDRYYKAEDNAAIVVAQLMKQYNIPIKK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KYCPHRMLAEGRWNNFIERVQNAYN−−−−GDGKVT−−−−−−−−−PT−−−LIPPS−−−−−−−−−−−−−TNGTGIAYIEGNGINL−−−−−−RKGLG−−−−−−−−−−−−−−−TGYGVIRQLGKGESYEVWGQSNG−−−−WLNLGGNQWIYNDSSYIRYTGES−−−−−TPTSSQSVNNGVGIVTITADVLRVRKGPGTNYDIVKNVYQGEQYQSWGYRDGWYNVGGDQWVSG                              
fig|527023.3.peg.2114   Bacillus thuringiensis serovar kurstaki str. T03a001                                                     EFITVHNTYND−−−−−ATAENEVSYMIRNG−−N−−−−−QVSFHIAVDDKEAVQGIP−−−−LERNAWHT−−−−−−−−−−−GDGNGNGNRKSIGVEICYSLSGGDRYYKAEDNAAIVVAQLMKQYDIPIHK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KYCPHRMLAEGRWDSFIERVQNAYN−−−−GDGKVT−−−−−−−−−PT−−−LIPPS−−−−−−−−−−−−−TNGTGIAYIEGNGINL−−−−−−RKGPG−−−−−−−−−−−−−−−TGYGVIRQLGKGESYEVWGQSNG−−−−WLNLGGDQWIYNDSSYIHYTGES−−−−−TPTSSQSVNNGVGIVTITADVLRVRRGP                                                                  
fig|527019.3.peg.1018   Bacillus thuringiensis IBL 200                                                       ITVHNTYND−−−−−ATAENEVAYMIRND−−N−−−−−QVSFHVAVDDKEAVQGLP−−−−LERNAWAC−−−−−−−−−−−GDGNGSGNRESISVEICYSLSGGERYYKAEDNATIVVAQLMKQYNIPINK−−−−−−−−VRTHQSWSG−−−−−−−−−−−KYCPHRMLAEGRWTNFIERVQNACN−−−−GDGKVT−−−−−−−−−PT−−−LIPPS−−−−−−−−−−−−−NNGTGIAYIEGNGINL−−−−−−RNGPG−−−−−−−−−−−−−−−TGYGVIRQLGKGEAYEVWGQSNG−−−−WLNLGGDQWIYNDSSYIRYTGES−−−−−TPTSSQSVNNGIGIVTITADVLRVRRGP                                                                  
fig|405531.7.peg.5598   Bacillus cereus G9842                                                  PGVKFMVAHDTGNPT−−−−STAQNNVTYYENSRNEM−−−−−SASAHIFVDDKRIIECIPFLTGTPEKAWHVLYNVTKDNQLFGG−−−−DANDYAGGVELCFGGKI−−NGEEAYKRYIWVLAYACYKFGLNPANS−−−−−−−ITGHE−−−−−−−−−ILDPTRKVDPSQGLRTMGRSYSQLLKDIVREYNSCINGGEDVTI−−−−−−−−−−SK−−−PQPPT−−−−−−−−−−GGSGEP