(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00022914

fig|1000590.6.peg.481   Staphylococcus epidermidis 14.1.R1.SE         RIYINEIKLKDDGVYCFSEE−−−−−STEGLEEVGQMLVDSDNYGFAYLLDD−−GQSYSYLIFVQETWSMLHENRDKKIII−−−−−−−−−NNHLELKHFQEELDYVLNNIEGNNNYGKEFVSAVEKTF 
fig|979220.3.peg.142   Staphylococcus epidermidis NIH05005         RIYINEIKLKDDGVYCFSEE−−−−−STEGLEEVGQMLVDSDNYGFAYLLDD−−GQSYSYLIFVQETWSMLHENRDKRIII−−−−−−−−−NNHLELKHFQEELDYVLNNIEGNNNYGKEFVSAVEKTF 
fig|904334.4.peg.1799   Staphylococcus capitis VCU116         RIYINEIKVKDDGIYCFSED−−−−−PTDGLEEVGQMLVDSDNYGFAYLLDD−−GESYSYLIFVQETWSLLHENRDKKIII−−−−−−−−−NNDLELKHFQEELDYILENIEGNNNYGKEFVSAVEKTF 
fig|525378.3.peg.79   Staphylococcus epidermidis M23864:W1         RIYINEIKVEEDGIYCFSED−−−−−PTDGLEEVGQMLVDSDNYGFAYILDD−−GESYSYLIFVQETWSMLHENRDKKVII−−−−−−−−−NNHLELEHFQEELDYILDNIEGNNNYGKEFVLAVEKTF 
fig|525377.3.peg.795   Staphylococcus lugdunensis M23590         RIYVNEIKVKDDGIYCYSDD−−−−−PTDGLEEVGQMLVDSDNYGFAYILDD−−GQSYSYLIFVEETWSMLHENRDKTIIV−−−−−−−−−NDDLKLEHFQEEFDFILDNIVGNNNYGKEFVAAVEKTF 
fig|435837.3.peg.1851   Staphylococcus hominis subsp. hominis C80         RIYVNEIKIKDDSIYCYSED−−−−−PTDGLDEVGQMLVDSDNFSFAYLLDD−−GSSYSYLIFVQETWSMLHNNRDKKVII−−−−−−−−−NDELELEHFQDELSYILENVEGNNNYGKEFVSAVEETF 
fig|279808.3.peg.2156   Staphylococcus haemolyticus JCSC1435         RIYVNEIKIKDDGIYCYSED−−−−−PTDGLVEVGQMLVDSDNYGFAYLLDD−−GQSYDYLIFVQETWSMLHENRGKKLIV−−−−−−−−−NDDLVLEHFQEELDYILENVEGNNNYGKEFVSAVEETF 
fig|342451.11.peg.1776   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305         RIYVNEIKVTEDSINCYTEQ−−−−−STEGLQEAGQMLVDSDNYSFAYILDD−−GQSYSYLIFVQETWSMLYENKGKKLII−−−−−−−−−NDELELKQFENEFNYILDNIQGNSNYGKEFVSVVENTF 
fig|396513.4.peg.611   Staphylococcus carnosus subsp. carnosus TM300         RIYVNEIKVKDDGIYCYTDK−−−−−STEGLKEAGQMLVDSDNYGFAYILDD−−GQSYSYLIFVKETWSMLHENKGKTIYI−−−−−−−−−NDDLKLEEFDQELDYILSNIKGNSNYGKDFVAEVEEAF 
fig|904338.3.peg.272   Staphylococcus warneri VCU121         RIYINEIKVKDDTIYCYSED−−−−−SIEGLEEVGQMLVDSDNYGFAYILDD−−GQSYSYLIFVEETWSMLHENKGKKLIV−−−−−−−−−NDELELKHFQEELDYILDNIEGNNNYGKEFVSAVEKTF 
fig|273036.3.peg.991   Staphylococcus aureus RF122         RLYINEIKIKDDTLYCYTED−−−−−TIKGLSEVGQMLVDSDNYAFAYTLDD−−GKAYAYLIFVQETWTMLHENMTKKIII−−−−−−−−−NDELELTEFHQELTYILDNIKGNNNYGKEFVATVEETF 
fig|585155.3.peg.2276   Staphylococcus aureus subsp. aureus H19         RLYINEIKIKDDTLYCYTED−−−−−SIKGLSEVGQMLVDSDNYAFAYTLDD−−GKAYAYLIFVQETWTMLHENMTKKIII−−−−−−−−−NDELELTEFHQELTYILDNIKGNNNYGKEFVATVEETF 
fig|1158695.3.peg.877   Staphylococcus aureus M0769         RLYINEIKIKDDILYCYTED−−−−−SIKGLSEVGQMLVDSDNYAFAYTLDD−−GKAYAYLIFVQETWTMLHENTTKKIII−−−−−−−−−NDELELTEFHQELTYILDNIKGNNNYGKEFVATVEETF 
fig|1157024.3.peg.1607   Staphylococcus aureus M0340         RLYINEIKIKDDILYCYTED−−−−−SIKGLSEVGQMLVDSDNYAFAYTLDD−−GKAYAYLIFVQETWTMLHENMTKKIII−−−−−−−−−NDELELTEFHQELTYILDNIKGNNNYGKEFVATVEETF 
fig|458233.11.peg.711   Macrococcus caseolyticus JCSC5402     MNIMNLHVNEIKLEDNKVKIYTEE−−−−−PQMDVTATGTMVVDSDHMQFVYLLDD−−GDFHHLRFVQETWPMLKQYQDKDWYL−−−−−−−−−YGTLQLDNFKEELQFLLENIEGNYNYGKEFTESVEHAF 
fig|388400.4.peg.4181   Bacillus sp. B14905        KIYTIETSNFEQDQLHFSLND−−−NKVNLQLKPAGQLIADSDDFAFIYLLDA−−GEDYHYLRFPPSSWENLVHILQKKKDPILRIS−−−−EEAIELTNFYDELEMLVYNIEGNYNYGAEFVQTVEQHFK
fig|444177.5.peg.1342   Lysinibacillus sphaericus C3-41        KIYTIETSNFEQDQLHFSLND−−−NEVNLQLKPAGQLIADSDDFAFIYLLDA−−GEDYHYLRFPPSSWENLVHILQKKKDPILRIN−−−−DEAIELINFYDELEMLVYNIEGNYNYGAEFVQTVEQHFK
fig|649639.3.peg.4202   Bacillus cellulosilyticus DSM 2522       MKSWTVEEIFLNEDQGEALVKAEEPLSYIKQLKAGEQILVDSDAKAFVYILED−−NEGYVHIRFPLAVWSELEVMKTNGLPMFVVFSHKEENIIIQLNNFLEELNTLLENIKDNSNYGKDFVLSVENAFH
fig|272558.8.peg.2962   Bacillus halodurans C-125       MNKGTVAELRLEHNTVVATLEEEVKREQAKQLQATERMLVDSDDHAFVYVLED−−EETFFYLRFPEATWTVLKEGMNSGKEVVAHLN−−−QETLITCHNFYNELRYLIDNIAGNGNYGEEMERAVQNAF 
fig|398511.4.peg.360   Bacillus pseudofirmus OF4       MKKLNVLEITKNSEGYAAACEHTFTQDEIKGIKAGERMLVDSDGLALIYIIED−−DEQFYYVSFGQNTWPMLDEAYKTETPLILEFD−−−SNHTLELVQLHAELDFLLENIEGNSNYGEELETAVCEVFK
fig|66692.6.peg.2689   Bacillus clausii KSM-K16       MKQYKVSAIEVDEEASTVELEEEIDAQLAARLKPGKRVLVDSDQYAFIYILED−−EEAFYAIRFEKNVWPALNEAHKLKTSYYVKLN−−−EHTRLALVDMEEELVFLLENIRGNGNYGEAFEQAVNDAF 
fig|224308.49.peg.1182   Bacillus subtilis subsp. subtilis str. 168 [WGS]        NRIEILNATLSDDQLRLACQT−−−EGNEAERKPSGQMLVDSDHFAFVYILEL−−ADSFEYVIIKEHVWPELKQAHAQKIPVVLEAG−−−−DQTIELAGLHEELEYLLENIKDNANYGEEMEEKVKRVFL
fig|655816.3.peg.1197   Bacillus subtilis subsp. spizizenii str. W23        NRIEILNATLSDDQLRLACET−−−EGDEAERKPSGQMLVDSDHYAFVYILEL−−ADSFEYVIIKEHVWPELKQAHAQRIPVVLEAG−−−−DKTIELAGLHEELEYLLENIKDNANYGEMEEKVKRVFL
fig|326423.5.peg.1137   Bacillus amyloliquefaciens FZB42        KRIEIQNASLTEDALRLKCGE−−−DLSGAERKASGQMLVDSDHFAFVYILES−−ADSFEYVIIKEHIWPDLKEALDQRKPAVLEAG−−−−GKTVELSGLHEELDYLLENIKDNANYGDMEEKVKNVFL
fig|665958.3.peg.1967   Bacillus sp. BT1B_CT2        NRIEITEANLRNDRLVLTSEI−−−−NDGAERKPAGRMLTDSDHFAFVYILEQ−−DESFEYVILNEGIWSDLKAALDAGLPVFLHIG−−−−NTELELNGFHDELGYLIENIKDNANYGEEMEERVKRIFL
fig|315750.8.peg.1102   Bacillus pumilus SAFR-032        NRIEIAEATLKEDRLILTTKS−−−EEQIQKAKASGQMLVDSDHFAFVYILEN−−EESFSYLILGEDTWAPLKEAMTLDIPVYLAAE−−−−GHSLELIQLHQELHYLIDNIKDNANYGDMEEKVKSTFL
fig|536229.4.peg.742   Bacillus pumilus ATCC 7061        NRIEIAEATLKEDRLILTTKS−−−EEQIQKAKASGQMLVDSDHFAFVYILEN−−EESFSYLILGKHTWTPLKEAMNLDIPVYLTAG−−−−GHSLELIQLHQELHYLIDNIKDNANYGDMEEKVKSTFL
fig|313627.6.peg.2198   Bacillus sp. NRRL B-14911        KKIDITNAALTETNELLLETEQ−−−−−DINGLKANGQMLVDSDNLAFVYIAES−−NDEYTYIVLSEGIWAAMSQALAAGADAYLANG−−−−PGRLHLPQFREELGYLIENIKGNSNYGDEMVAKVEAAF 
fig|1138452.3.peg.635   Bacillus megaterium NCT-2        NRIDITTCVMKSNELHLKADP−−IETEIEQLEDTKQMLVDSDNMSFVYVVDI−−NDQFMYVGLSDNIWANLKHVLHKDMKVFLEIN−−−−KKVIELSAVKEELSYLISNIEGNVNYGDEMVARVEEVFL
fig|161544.4.peg.2926   Bacillus sp. SG-1        KKILLTKAELLDDKLVLHSSE−−−KAGESNLKPAGQVLVDSDNFSFVYFAES−−QEEYVLIHIQEECWSALKEAFEQKMPVFADLG−−−−ESEFELEGLHEELDYLIENIEGNSNYGEDMVKKVEAVFL
fig|441769.6.peg.1156   Bacillus coahuilensis m4-4        KIANLHKKEMTENTMIFTTNE−−−QEIVKGIVPTGQLIVDSDQLSFVYLGEV−−EEEYVYLYLSETCWEDVRAGIHNNVQFFLDVD−−−−GEVVELLELNEELTYLISNIEGNGNYGEQMVEKVESIFI
fig|345219.8.peg.319   Bacillus coagulans 36D1        NIIELGKPEWKDGILQLHAER−−PDVSMQHLKPGGQMIVDSDACAFIYLAEDDGDEDYTYLYLPVPVWKEIRTAAFEHKKVVAVSK−−−−DGKLELTGLDEELQFLLDNIRGNSNYGKKMLDKVEAVF 
fig|1111068.3.peg.949   Geobacillus thermoleovorans CCB_US3_UF5     MNEKWIVERVEREGGRLWLYVND−−APVPLARVTPKRHMLVDSDALAFAYILET−−DDRFLYVMIPKPWWPELKAALDAKEPVWLRCG−−−−ERTLELEQFHDELSYLLENIRGNANYGEALEQAVQDVF 
fig|691437.3.peg.2955   Geobacillus sp. C56-T3     MNEKWIVERAEREGGRLWLYVND−−APVPLARVTPKRHMLVDSDALAFAYILET−−DDRFLYVMIPKLWWPELKAALDAKEPVWLRCG−−−−ERTLELEQFHDELSYLLENIRGNANYGEALEQAVQDVF 
fig|550542.5.peg.805   Geobacillus sp. Y412MC52     MNEKWIVERAEREGGRLWLYVND−−APVPLARVTPKRHMLVDSDALAFAYILET−−DDRFLYVMVPKPWWLELKAALDAEEPVWLRCG−−−−ERTLELEQFHDELSYLLENIRGNANYGEALEQAVQDVF 
fig|495036.3.peg.479   Geobacillus sp. G11MC16        NKVTVERAERKDGRLWLYADN−−VPVPLVHVTPKRHMLVDSDALAFVYILET−−DDRFLYVIIPKQWWPELKAAFAEGEPIWLESE−−−−GMALELEQFGEELAYLLENIRDNANYGETFEQAVQEVF 
fig|581103.5.peg.3323   Geobacillus sp. Y4.1MC1        KKLMVEKIEKRNERLWLISND−−SPFSLEHAKPKNHMLVDSDNIAFIYILET−−EEDFIYVTIPYEHWTDMKQVLTESIPVFLQSG−−−−MAELELTNFKEELAYLIENIDGNANYGEQMEQAVKEIFL
fig|471223.3.peg.837   Geobacillus sp. WCH70        KKLVVEKVEKRDERLWLICDH−−PPFSLEQARPKNHMLVDSDNIAFIYILET−−DEDFIYVAIPSEFWMDIKQVLTDGTPIFLQSG−−−−TIEMELTHFKEELTYLIENIDGNANYGEQMEQAVKEIFL
fig|491915.6.peg.2173   Anoxybacillus flavithermus WK1         KIYVHTAEKKENGWYFLCEA−−−−−SLQGLQAKRHMLVDSDACAFAYILEA−−ADAFVYVIMPKEVWGAIKEALRTNEPVFLVGN−−−−DATIELEGIHEEVAYLIENIAGNANYGEEMEQAVTAFF 
fig|486620.3.peg.2479   Bacillus anthracis str. A0465        NKIQVKSVEKRENALIFCAEN−−SEIEVKGLSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCW−−−−EAMNNDVVMFVRVN−−−−DIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
fig|347495.3.peg.1097   Bacillus cereus F837/76        NKIQVKSVEKRENALIFCAEN−−SEIEVKGLSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMHEAMNNDVVMFVRVN−−−−DIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
fig|288681.12.peg.1152   Bacillus cereus E33L        NKIQVKSVEKRENALIFCAEN−−SEIEVKGLSARNHVLVDSDNLSFIYILEN−−ESSFIYVSIPHTCWEAMHEAMNNDVVMFVRVN−−−−DIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
fig|527032.3.peg.2312   Bacillus thuringiensis serovar andalousiensis BGSC 4AW1        NKIQVKSVEKRENALIFCAEN−−SEIEVKGLSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMHEAMNNDVVMFVRVN−−−−DIEMELEGLKEEIEYLVENIEGNANYGEELVTAVEKVFL
fig|527023.3.peg.3386   Bacillus thuringiensis serovar kurstaki str. T03a001        NKIQVKSVEKRENALIFCAEN−−SEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMHEAMNSDVVMFVRVN−−−−DIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
fig|527021.3.peg.3390   Bacillus thuringiensis Bt407        NKIQVKSVEKRENALIFCAEN−−SEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMHEAMNNDVVMFVSVN−−−−DIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
fig|714359.3.peg.1141   Bacillus thuringiensis BMB171        NKIQVKSVEKRENALIFCAEN−−SEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMHEAMNNDVVMFVRVN−−−−DIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
fig|526991.3.peg.4388   Bacillus cereus AH676        NKIQVKSVEKRENALIFCAEN−−SEIEVKELSARNHVLVDSDNLSFLYILEN−−ELSFIYVSIPHTCWEAMHEAMNNDVVMFVRVN−−−−DIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
fig|405533.4.peg.863   Bacillus cereus AH1134        NKIQVKSVEKRENALIFCAEN−−SEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMHEAMNNDVVMFVRVN−−−−EIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
fig|527026.3.peg.5033   Bacillus thuringiensis serovar sotto str. T04001        NKIQVKSVEKRENALIFCAEN−−NEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMYEAMNNDIVMFVRVN−−−−DVEMELENLKEEVEYLVENIEGNANYGEELVTAVEKVFL
fig|526992.3.peg.4586   Bacillus cereus AH1271        NKIQVKSVEKRENALIFCAEN−−NEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMHEAMNNDIVMFVRVN−−−−DVEMELENLKEEVEYLVENIEGNANYGEELVTAVEKVFL
fig|269801.1.peg.3823   Bacillus cereus G9241        NKIQVKSVEKRENALIFCAEN−−SEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMHEAMNNDMVMFVRVN−−−−DIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
fig|527019.3.peg.2277   Bacillus thuringiensis IBL 200        NKIQVKSVETRENALIFCAEN−−SEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMHEAMNKDMVMFIRVN−−−−DIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
fig|1053212.3.peg.1014   Bacillus cereus HuB5-5        NKIQVKSVEMRENALIFCAEN−−TEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMREAMNKDTAMFIQVN−−−−DVEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
fig|526988.3.peg.1322   Bacillus cereus Rock4-18        NKIQVKSVEMRENALIFCAEN−−TEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMREAMNKDTAMFIQVN−−−−DVEMKLEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
fig|526968.3.peg.1290   Bacillus cereus R309803        NKIQVKSVEKRENALIFCAEN−−TEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEALHEAMNKDTAMFIQVN−−−−GVEMELEALKEEVEYLVENIEGNANYGEELVTAVEKVFL
fig|526998.3.peg.5494   Bacillus mycoides Rock1-4        NKIQVKSVEERENALIFCAEN−−IEIQVEELKARNHVLVDSDHLSFLYILEN−−ESAFIYVSIPHTCWEAMHSAMKNDKAMFVRVN−−−−NTEIELAQLKEEVEYLIENIEGNANYGEELVTAVEKVFL
fig|526986.3.peg.4340   Bacillus cereus Rock3-44        NKIQVKSVEERENALIFCAEN−−TEIQVEELKARNHVLVDSDHLSFLYILEN−−ESAFIYVSIPHTCWEAMNSAMKSEKAMFVRVN−−−−NTEIELEQLKEEVEYLIENIEGNANYGEELVTAVEKVFL
fig|315749.8.peg.970   Bacillus cytotoxicus NVH 391-98        NKIQVKSVKERENALIFCAEN−−TEIEVKELTARNHVLVDSDHLSFLYILEN−−ESSFVYVSIPHTCWEAMREAMQQDKKMFVHVN−−−−DMEIELEQLKEELEYLIRNIEGNANYGEELVSAVEKVFL
fig|526990.3.peg.3121   Bacillus cereus AH603        NKIQVKSVETRENALIFCAEN−−TEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMHEAMNKDTAMFIRVN−−−−DVEIELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
fig|526994.3.peg.5283   Bacillus cereus AH1273        NKIQVKSVETRENALIFCAEN−−TEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAIHEAMNKDTAMFIHVN−−−−DVEIELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
fig|1053203.3.peg.1061   Bacillus cereus HuA2-4        NKIQVKSVETRENALIFCAEN−−TEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAVHEAMNKDTAMFIRVN−−−−DVEIELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL