(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00022302

fig|289380.15.peg.2448   Clostridium perfringens SM101                        IVVLVTAHKNITINLDGENLDVATFKGNVQAVLSQQGIYLSDKDKIEPSLTSEIAD−−−NDVISIKK−−−−−−−−AVPVE−−−−−−−−−VMVD−−−−−−−−GKNI−−−−−−−−−−−−−−−EIDSAEDSVK−−−−−−−−−−−−−−−−NMLFKEGI−−−−−−−−−−NLNDLD−−−−−KVEPSLETELSK−−−DLKIKITRVEEKTI−−−−VEKEPID−−−−−−−−−−−−FET−−−−VVKEDNSLESGVKKTTQEGAS−−−−−−−−−−−−−−−−−−−−−−−−−−GEKEITMK−−−−−−−−−−−−−−−−−LVMENGKEVSRE−−−−−−VVESKVVKEPVD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EVVVKGTMEKL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−−−LSR−−−−−−−−−−−−−−−GKDNI−−NYKK−−SMVVEATAYSGD−−−−−−−−−−−−−GITATGTVPKRD−−−−−−−−−−−−−−−−−−−−−−−−−−−PNGLSTIAVDPRVIPLGTKVYVEG−−−−−−−YGYA−−VAEDTGGA−−IKNNI−−−−−I−−DLFLNSAPE−−−−CKQWGRRNVNLYII                                                       
fig|445334.5.peg.1240   Clostridium perfringens C str. JGS1495                                               TFKGNVQAVLSQQGIYLSDKDKIEPSLTSEIAD−−−NDVISIKK−−−−−−−−AVPVE−−−−−−−−−VMVD−−−−−−−−GKNI−−−−−−−−−−−−−−−EIDSAEDSVK−−−−−−−−−−−−−−−−NMLFKEGI−−−−−−−−−−NLNDLD−−−−−KVEPSLETELSK−−−DLKIKITRVEEKTI−−−−VEKEPID−−−−−−−−−−−−FET−−−−VVKEDNSLESGVKKTTQEGAS−−−−−−−−−−−−−−−−−−−−−−−−−−GEKKITMK−−−−−−−−−−−−−−−−−LVMENGKEVSRE−−−−−−VVESKIVKEPVD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EVVVKGTMEKL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−−−LSR−−−−−−−−−−−−−−−GNDNI−−NYKK−−AMVVEATAYSGD−−−−−−−−−−−−−GITATGTVPKRD−−−−−−−−−−−−−−−−−−−−−−−−−−−PNGLSTIAVDPRVIPLGTKVYVEG−−−−−−−YGYA−−VAEDTGGA−−IKNNI−−−−−I−−DLFLNSAPE−−−−CKQWGRRNVNLYII                                                       
fig|195102.6.peg.2588   Clostridium perfringens str. 13                                               TFKGNVQAVLSQQGIYLSDKDKIEPSLTSEIAD−−−NDVISIKK−−−−−−−−AVPVE−−−−−−−−−VMVD−−−−−−−−GKNI−−−−−−−−−−−−−−−EIDSAEDSVK−−−−−−−−−−−−−−−−NMLVKEGI−−−−−−−−−−NLNDLD−−−−−KVEPSLETELSK−−−DLKIKITRVEEKTI−−−−VEKEPID−−−−−−−−−−−−FET−−−−VVKEDNSLESGVKKTTQEGSA−−−−−−−−−−−−−−−−−−−−−−−−−−GEKEITMK−−−−−−−−−−−−−−−−−LVMEDGKEVSRE−−−−−−VVESKVVKEPID−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EVVVKGTMEKL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−−−LSR−−−−−−−−−−−−−−−GNDNI−−NYKK−−AMVVEATAYSGD−−−−−−−−−−−−−GITATGTVPKRD−−−−−−−−−−−−−−−−−−−−−−−−−−−PNGLSTIAVDPRVIPLGTKVYVEG−−−−−−−YGYA−−VAEDTGGA−−IKNNI−−−−−I−−DLFLNSAPE−−−−CKQWGRRNVNLYII                                                       
fig|451757.5.peg.2115   Clostridium perfringens NCTC 8239                                               TFKGNVQAVLSQQGIYLSDKDKIEPSLTSEIAD−−−NDVISIKK−−−−−−−−AVPVE−−−−−−−−−VMVD−−−−−−−−GKNI−−−−−−−−−−−−−−−DIDSAEDSVK−−−−−−−−−−−−−−−−NMLVKEGI−−−−−−−−−−NLNDLD−−−−−KVEPSLETELSK−−−DLKIKITRVEEKTI−−−−VEKEPID−−−−−−−−−−−−FET−−−−VVKEDDNLESGVKKTTQEGSA−−−−−−−−−−−−−−−−−−−−−−−−−−GEKEITMK−−−−−−−−−−−−−−−−−LVMEDGKEVSRE−−−−−−VVESKVVKEPVD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EVVVKGTMEKL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−−−LSR−−−−−−−−−−−−−−−GNDNI−−NYKK−−AMVVEATAYSGD−−−−−−−−−−−−−GITAMGTVPKRD−−−−−−−−−−−−−−−−−−−−−−−−−−−PNGLSTIAVDPRVIPLGTKVYVEG−−−−−−−YGYA−−VAEDTGGA−−IKNNI−−−−−I−−DLFLNSAPE−−−−CKQWGRRNVNLYII                                                       
fig|883064.3.peg.2862   Clostridium perfringens F262                                               TFKGNVQAVLSQQGIYLSDKDKIEPSLTSEIAD−−−NDVISIKK−−−−−−−−AVPVE−−−−−−−−−VMVD−−−−−−−−GKNI−−−−−−−−−−−−−−−EIDSAEDSVK−−−−−−−−−−−−−−−−NMLVKEGI−−−−−−−−−−NLNDLD−−−−−KVEPSLETELSK−−−DLKIKITRVEEKTI−−−−VEKEPID−−−−−−−−−−−−FET−−−−VVKEDDNLESGVKKTTQEGSA−−−−−−−−−−−−−−−−−−−−−−−−−−GEKEITMK−−−−−−−−−−−−−−−−−LVMEDGKEVSRE−−−−−−VVESKVVKEPVD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EVVVKGTMEKL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−−−LSR−−−−−−−−−−−−−−−GNDNI−−NYKK−−AMVVEATAYSGD−−−−−−−−−−−−−GITATGTVPKRD−−−−−−−−−−−−−−−−−−−−−−−−−−−PNGLSTIAVDPRVIPLGTKVYVEG−−−−−−−YGYA−−VAEDTGGA−−IKNNI−−−−−I−−DLFLNSAPE−−−−CKQWGRRNVNLYII                                                       
fig|488537.5.peg.439   Clostridium perfringens D str. JGS1721                                               TFKGNVQAVLSQQGIYLSDKDKIEPSLTSEIAD−−−NDVISIKK−−−−−−−−AVPVE−−−−−−−−−VMVD−−−−−−−−GKNI−−−−−−−−−−−−−−−EIDSAEDSVK−−−−−−−−−−−−−−−−NMLVKEGI−−−−−−−−−−NLNDLD−−−−−KVEPSLETELSK−−−DLKIKITRVEEKTI−−−−VEKEPID−−−−−−−−−−−−FET−−−−VVKEDDNLESGVKKTTQEGSA−−−−−−−−−−−−−−−−−−−−−−−−−−GEKEITMK−−−−−−−−−−−−−−−−−LVMEDGKEVARE−−−−−−VVESKVVKEPVD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EVVVKGTMEKL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−−−LSR−−−−−−−−−−−−−−−GNDNI−−NYKK−−AMVVEATAYSGD−−−−−−−−−−−−−GITATGTVPKRD−−−−−−−−−−−−−−−−−−−−−−−−−−−PNGLSTIAVDPRVIPLGTKVYVEG−−−−−−−YGYA−−VAEDTGGA−−IKNNI−−−−−I−−DLFLNSAPE−−−−CKQWGRRNVNLYII                                                       
fig|447214.4.peg.3652   Clostridium butyricum 5521                                                                                                                                                                                                           PSLDSQIED−−−NMRVQIVNVEKKEL−−−−VQNEPIN−−−−−−−−−−−−FET−−−−IVEKDENLDKSVSKVKSEGVN−−−−−−−−−−−−−−−−−−−−−−−−−−GEKEVTYE−−−−−−−−−−−−−−−−−VLYRDGVETSRN−−−−−−VTSTKTITEPKN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EIVIKGTGQVY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ASR−−−−−−−−−−−−−−−GGESI−−NYKE−−KLNCVATAYSGD−−−−−−−−−−−−−RTTATGRSPVRN−−−−−−−−−−−−−−−−−−−−−−−−−−−PGGMSTIAVDPSFIPLGSKVYVEG−−−−−−−YGYA−−IAADTGGA−−IKGNI−−−−−I−−DLFLNSSSE−−−−CWSWGRRPVTVLVV                                                       
fig|632245.3.peg.4039   Clostridium butyricum E4 str. BoNT E BL5262                                                                                                                                                                                                           PSLDSQIED−−−NMRVQIVNVEKKEL−−−−VQNEPIN−−−−−−−−−−−−FET−−−−IVEKDENLDKSVSKVKSEGVN−−−−−−−−−−−−−−−−−−−−−−−−−−GEKEVTYE−−−−−−−−−−−−−−−−−VLYRDGVETSRN−−−−−−VTSTKTITEPKN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EIVIKGTGQVY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ASR−−−−−−−−−−−−−−−GGESI−−NYKE−−KLNCVATAYSGD−−−−−−−−−−−−−RTTATGRSPVRN−−−−−−−−−−−−−−−−−−−−−−−−−−−PGGMSTIAVDPSFIPLGSKVYVEG−−−−−−−YGYA−−IAADTGGA−−IKGNI−−−−−I−−DLFLNSSSE−−−−CWSWGRRPVTVLVV                                                       
fig|386415.6.peg.2190   Clostridium novyi NT                                                                                                                 LTVG−−−−−−−−NDVK−−−−−−−−−−−−−−−TILTAANTVG−−−−−−−−−−−−−−−−DMLSQEKI−−−−−−−−−−TLGKED−−−−−KISVPQQTEIKD−−−GDKISITRVSTKVE−−−−KKLQPID−−−−−−−−−−−−FVT−−−−EVKKDNSLKNGTRKVVQEGKA−−−−−−−−−−−−−−−−−−−−−−−−−−GQREINEK−−−−−−−−−−−−−−−−−VIYENGKIVSRE−−−−−−VVNQAIIQQPTK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVIAMGTLQEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AAQPQRLSR−−−−−−−−−−−−−−−GG−−SI−−NHSK−−VYRMRATAYTESYNDTGKRPGDSDFGITASGTRVRRN−−−−−−−−−−−−−−−−−−−−−−−−−−−ANGYSTVAVDPRIIPLGTKLYVEG−−−−−−−YGYA−−IAEDTGGA−−IKGNK−−−−−I−−DLYFNSDSQ−−−−VSNWGVRYVNVYIV                                                       
fig|212717.1.peg.1042   Clostridium tetani E88                                               TYQNNVQNFLAKEDIKLNPKDKIDKDMDSKLSN−−−KDVINIKR−−−−−−−−AVNVQ−−−−−−−−−INVD−−−−−−−−NKEL−−−−−−−−−−−−−−−AIKSAEKDIA−−−−−−−−−−−−−−−−SMLEAEKI−−−−−−−−−−VLGSED−−−−−KILPGKDTTLSD−−−GMKVDITRVEKKTI−−−−TQSAPVN−−−−−−−−−−−−FNT−−−−VFKNDSSMLKSKKKVLQEGQK−−−−−−−−−−−−−−−−−−−−−−−−−−GEKQITTN−−−−−−−−−−−−−−−−−VVYENGKEISRK−−−−−−VIKETITKKPKD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KIIAQGTLSPI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PVSR−−−−−−−−−−−−−−−GTTTSF−−ANSG−−VLRVKATAYWAVHGVNN−−−−−−−−TYTYSGRKAVRN−−−−−−−−−−−−−−−−−−−−−−−−−−−PNGYSTIAVDPRVIPLGTKLYVEG−−−−−−−YGYA−−IAADTGTS−−VKGNF−−−−−I−−DVYFDTHKE−−−−ACNWGLKYVNVYI                                                        
fig|431943.4.peg.3762   Clostridium kluyveri DSM 555                                                                               D−−−KGKLLITR−−−−−−−−AVLIE−−−−−−−−−VKVD−−−−−−−−GKKL−−−−−−−−−−−−−−−DIKSAEHNVE−−−−−−−−−−−−−−−−NMLQAEKI−−−−−−−−−−QLSNLD−−−−−KVYPSRNYAIKK−−−GLKVVVTRVKTKDI−−−−KEITNIN−−−−−−−−−−−−YDI−−−−VIKNDGEVESGAKKVLQEGQN−−−−−−−−−−−−−−−−−−−−−−−−−−GEKQTITR−−−−−−−−−−−−−−−−−IVYEDGKEVSRK−−−−−−VISEIVKKEPVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KIIAVGTLNSD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YT−−−−FSR−−−−−−−−−−−−−−−GG−−NL−−SYAK−−FLQMKATAYTADYESTGKGPGHPDFGITASGTVARRN−−−−−−−−−−−−−−−−−−−−−−−−−−−SGSYSSVAVDPRVIPLGTKLYIEG−−−−−−−YGYA−−IAEDTGGA−−IKGNR−−−−−V−−DLFFNSASE−−−−ANNWGVRWINVYVM                                                       
fig|588581.3.peg.2249   Clostridium papyrosolvens DSM 2782                                              KTMKVTVKEVLEQTGIKVDKADYVSMPFDAKLTKVHENVINIKR−−−−−−−−AVPVT−−−−−−−−−IKVD−−−−−−−−GKEL−−−−−−−−−−−−−−−GVKTYKDTVS−−−−−−−−−−−−−−−−DVLKDNNI−−−−−−−−−−SVNSSD−−−−−RFVGSQIGDKIVS−−−NMNISIVRVEEKTI−−−−TETSPIP−−−−−−−−−−−−FKT−−−−ITKDSNRLDKGVRNTVRQGKE−−−−−−−−−−−−−−−−−−−−−−−−−−GVREKLYK−−−−−−−−−−−−−−−−−VVFEDGKQTAKQ−−−−−−LVKDIVSKNPLN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CIVEVGTVLNY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−TSR−−−−−−−−−−−−−−−GE−−TF−−RFSK−−VMDMRATSYTASFADTGKRPGEPGFGMTATGARVRK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIIAVDPRVIPLGTRVYIEVPGKAADYGYA−−VAADTGGA−−IKGNK−−−−−I−−DVYLESDGQ−−−−VDSWGVRKVKVYILK                                                      
fig|394503.7.peg.177   Clostridium cellulolyticum H10                                                                                   QNVINIKR−−−−−−−−AVPVS−−−−−−−−−IKVD−−−−−−−−GKEL−−−−−−−−−−−−−−−DVKTCKDTVS−−−−−−−−−−−−−−−−EVLKDNNI−−−−−−−−−−SVDSDD−−−−−KFVGSQLGDKIVS−−−NMKISIVRVEEKTI−−−−TETLPIP−−−−−−−−−−−−FKT−−−−ITKENKRLDKGVRNTVRQGKE−−−−−−−−−−−−−−−−−−−−−−−−−−GVREKLYK−−−−−−−−−−−−−−−−−VVFEDGKQTTKQ−−−−−−LIKDFVATNPLN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CIVEVGTVLNY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−N−−−−−TAR−−−−−−−−−−−−−−−GE−−TI−−RFSK−−VLDMRATSYTASFKDTGKRPGEPGFGITATGAKVRR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIIAVDPRVIPLGTRVYVEVPGKAADYGYA−−VASDTGGA−−IKGNK−−−−−I−−DVYLESGSQ−−−−VDAWGVKKVKVYILK                                                      
fig|350688.5.peg.2777   Alkaliphilus oremlandii OhILAs                                                                            KIKD−−−GTKIEIHR−−−−−−−−AFTIK−−−−−−−−−LVDG−−−−−−−−TTEQ−−−−−−−−−−−−−−−EILTAENNVK−−−−−−−−−−−−−−−−DLMESLNI−−−−−−−−−−QLQEED−−−−−KIEPMLEAPIGA−−−GDTVTITRITRQVV−−−−VETQELP−−−−−−−−−−−−FQT−−−−IFKNNENLERGKTQKVQEGKK−−−−−−−−−−−−−−−−−−−−−−−−−−GLKEIQLE−−−−−−−−−−−−−−−−−LVYENGVEVSKE−−−−−−VLDEKIIENSTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EIIEKGTLALV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−−TSR−−−−−−−−−−−−−−−GD−−IS−−RYSK−−MITMTATAYTADYASTGKKPGDKYYGVTASGTRVRP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GVVAVDPKVIPLGTKLYIQSTTNGRADYGYA−−VAEDTGGA−−IKGNK−−−−−I−−DLYFETSKE−−−−VKSFGRRTVNVYVLE                                                      
fig|521460.8.peg.569   Anaerocellum thermophilum DSM 6725     MKKLILAFVIVFVLSVLLGAMTAQALVKEVSITIDGKTFYYKTIKSTVREVLEENQIYLTKDDYVSPSLDSKINE−−−NTQIIIKR−−−−−−−−AFEVK−−−−−−−−−ILVG−−−−−−−−DEEK−−−−−−−−−−−−−−−VVYIPSGTVE−−−−−−−−−−−−−−−−DAIKKAGV−−−−−−−−−−VLGKLD−−−−−KINLPLSQLLDK−−−STVIKITKVTEKVV−−−−VEKQKIP−−−−−−−−−−−−FST−−−−VTKINYNMDYGKQKVIQQGQD−−−−−−−−−−−−−−−−−−−−−−−−−−GIKERRYK−−−−−−−−−−−−−−−−−VVLEDGKEVERK−−−−−−LIEERVVKNSKP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RIVEVGAIRWF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−K−−−−−TSR−−−−−−−−−−−−−−−GE−−VV−−RYRK−−VYTMIATAYSLTPSDTGKSPSHPDYGRTATGHKVKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GVVAVDPRVIPLGTRLYIEG−−−−−−−YGFA−−RALDTGSA−−IKGNR−−−−−I−−DVFVE−−KD−−−−AYKFGVRRVKVYVL                                                       
fig|580331.4.peg.102   Thermoanaerobacter italicus Ab9                                         KKIIVTTFKSTVKDLLEEKGIKLKKEDVVTPSLETALKN−−−GMKVTIKR−−−−−−−−AVPIT−−−−−−−−−ICVG−−−−−−−−GKAK−−−−−−−−−−−−−−−DIYTAASNVK−−−−−−−−−−−−−−−−EVLQQNSI−−−−−−−−−−TLGPQD−−−−−KVNMSLDTPVFR−−−YMYIDVTKVTEKIV−−−−TQEVDIP−−−−−−−−−−−−YQT−−−−ETVKNDNMERGQVRVVQQGEV−−−−−−−−−−−−−−−−−−−−−−−−−−GKKQIVVK−−−−−−−−−−−−−−−−−VIYKNGKEVAKD−−−−−−IIKEKIIKNPVN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QIVHIGTLGIF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−TSR−−−−−−−−−−−−−−−GE−−TF−−RYRE−−VRTMVATAYDSSEDSTGKKPGDPNYGITATGIKATR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GVIAVDPRVIPLGTKLYVEG−−−−−−−YGFG−−IAADTGGA−−IKGNK−−−−−I−−DVYFPTREE−−−−VMRWGRRYVKVYILK                                                      
fig|583358.3.peg.1280   Thermoanaerobacter mathranii subsp. mathranii str. A3                                         KKIVVTTFKSTVKDLLEEKGIKLKKEDVVTPSLDTALKN−−−GMKVTIKR−−−−−−−−AVPIT−−−−−−−−−ICVG−−−−−−−−GKAK−−−−−−−−−−−−−−−NIYTAASNVK−−−−−−−−−−−−−−−−EVLQQNSI−−−−−−−−−−TLGPQD−−−−−KVNMSLDTPVFR−−−YMYIDVTKVTEKIV−−−−TQEVDIP−−−−−−−−−−−−YQT−−−−ETVKNDNMERGQVRVVQQGEV−−−−−−−−−−−−−−−−−−−−−−−−−−GKKQIVMK−−−−−−−−−−−−−−−−−VIYKNGKEVAKN−−−−−−IIKEKIIKNPVN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QIVHIGTLGIF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−TSR−−−−−−−−−−−−−−−GE−−TF−−RYRE−−VRTMVATAYDSSEDSTGKKPGDPNYGITATGIKATR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GVIAVDPRVIPLGTKLYVEG−−−−−−−YGFG−−IAADTGGA−−IKGNK−−−−−I−−DVYFPTREE−−−−VMRWGRRYVKVYILK                                                      
fig|589861.3.peg.813   Thermoanaerobacter ethanolicus CCSD1              LAAVFLLIVGVGTYASLKKEITLQDEDKKIVVTTFKSTVKDLLEEKGIKLKKEDVVTPSLDTSLKN−−−GMKVTIKR−−−−−−−−AVPIT−−−−−−−−−ICVG−−−−−−−−GKAK−−−−−−−−−−−−−−−DIYTAASNVK−−−−−−−−−−−−−−−−EVLQQNSI−−−−−−−−−−TLGPQD−−−−−KVNMSLDTPVFK−−−YMYIDVTKVTEKIV−−−−TQEVDIP−−−−−−−−−−−−YQT−−−−ETVKNDNMERGQVRVVQQGEV−−−−−−−−−−−−−−−−−−−−−−−−−−GKKQIVMK−−−−−−−−−−−−−−−−−VTYENGKEVAKN−−−−−−IIEEKIIKNPIN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QIVHVGTLGIF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−TSR−−−−−−−−−−−−−−−GE−−TF−−RYRE−−VRTMVATAYDSSEGSTGKKPGDPDYGITATGIKATR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GVIAVDPRVIPLGTKLYVEG−−−−−−−YGFG−−IAADTGGA−−IKGNK−−−−−I−−DVYFPTREE−−−−VMRWGRRYVKVYILK                                                      
fig|588857.3.peg.1642   Thermoanaerobacter sp. X561              LAAVFLLIVGVGTYASLKKEITLQDEDKKIVVTTFKSTVKDLLEEKGIKLKKEDVVTPSLDTSLKN−−−GMKVTIKR−−−−−−−−AVPIT−−−−−−−−−ICVG−−−−−−−−GKAK−−−−−−−−−−−−−−−DIYTAASNVK−−−−−−−−−−−−−−−−EVLQQNSI−−−−−−−−−−TLGPQD−−−−−KVNMSLDTPVFK−−−YMYIDVTKVTEKIV−−−−TQEVDIP−−−−−−−−−−−−YQT−−−−ETVKNDNMERGQVRVVQQGEV−−−−−−−−−−−−−−−−−−−−−−−−−−GKKQIVMK−−−−−−−−−−−−−−−−−VTYENGKEVAKN−−−−−−IIEEKIIKNPIN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QIVHVGTLGIF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−TSR−−−−−−−−−−−−−−−GE−−TF−−RYRE−−VRTMVATAYDSSEGSTGKKPGDPDYGITATGIKATR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GVIAVDPRVIPLGTKLYVEG−−−−−−−YGFG−−IAADTGGA−−IKGNK−−−−−I−−DVYFPTREE−−−−VMRWGRRYVKVYILK                                                      
fig|431943.4.peg.1140   Clostridium kluyveri DSM 555                                                                                                                 INGN−−−−−−−−DAYL−−−−−−−−−−−−−−−EVLLSSESLS−−−−−−−−−−−−−−−−DFIS−−−−−−−−−−−−−−RMDTIT−−−−−RVIQFDNKIIAK−−−−−−−−LKQSEQAIE−−−−DEKQALY−−−−−−−−−−−−YEN−−−−SKLQALKANNEVTLSKLNDDI−−−−−−−−−−−−−−−−−−−−−−−−−−KEQKELLA−−−−−−−−−−−−−−−−−KTAEKEQQLKEQ−−−−−−QLEESKNLYIQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SLAYSGSDLDRQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−LSR−−−−−−−−−−−−−−−GGMPS−−SFSQ−−VLNVVATAYSGD−−−−−−−−−−−−−GITASGAPTKRN−−−−−−−−−−−−−−−−−−−−−−−−−−−PNGYSTIAVDPRVIPLGSKVYVEG−−−−−−−YGYA−−IAEDIGGA−−IKGNR−−−−−I−−DIFVTSEAE−−−−AQSWGRRSVNVYIL                                                       
fig|138119.3.peg.209   Desulfitobacterium sp. Y51                                                                                                       K−−−−−−−−−VKVD−−−−−−−−GKEI−−−−−−−−−−−−−−−DTYLAPRTVE−−−−−−−−−−−−−−−−EALEKLDI−−−−−−−−−−VLNEKD−−−−−KVSLPMKHMIEA−−−EDEIQVVRVEEKIE−−−−TMTNEIP−−−−−−−−−−−−YQT−−−−VAQPADFPIGLPDKVVTKGVN−−−−−−−−−−−−−−−−−−−−−−−−−−GQHEQTVK−−−−−−−−−−−−−−−−−ITMEDGIEVARE−−−−−−VLQQEVLRAPVN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QVVSRGSQTT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ISR−−−−−−−−−−−−−−−GGKTI−−EFKR−−AYLMRASAYSGG−−−−−−−−−−−−−GRTATGHNVRY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GVIAVDPRVIPLGTEVYVDG−−−−−−−YGEA−−VALDTGGA−−IKGNR−−−−−V−−DLYMNTEES−−−−CWSWGVRSVVVYV                                                        
fig|138119.41.peg.154   Desulfitobacterium hafniense Y51                                                                                                       K−−−−−−−−−VKVD−−−−−−−−GKEI−−−−−−−−−−−−−−−DTYLAPRTVE−−−−−−−−−−−−−−−−EALEKLDI−−−−−−−−−−VLNEKD−−−−−KVSLPMKHMIEA−−−EDEIQVVRVEEKIE−−−−TMTNEIP−−−−−−−−−−−−YQT−−−−VAQPADFPIGLPDKVVTKGVN−−−−−−−−−−−−−−−−−−−−−−−−−−GQHEQTVK−−−−−−−−−−−−−−−−−ITMEDGIEVARE−−−−−−VLQQEVLRAPVN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QVVSRGSQTT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ISR−−−−−−−−−−−−−−−GGKTI−−EFKR−−AYLMRASAYSGG−−−−−−−−−−−−−GRTATGHNVRY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GVIAVDPRVIPLGTEVYVDG−−−−−−−YGEA−−VALDTGGA−−IKGNR−−−−−V−−DLYMNTEES−−−−CWSWGVRSVVVYV                                                        
fig|573061.4.peg.1963   Clostridium cellulovorans 743B                                                                            KIKD−−−GQIVDIKK−−−−−−−−AVNIT−−−−−−−−−INVD−−−−−−−−GKQV−−−−−−−−−−−−−−−KIKSAQDDID−−−−−−−−−−−−−−−−TLLKSEECLDTFKNANISSIRSND−−−−−RIIPDIKEPLEE−−−GSIVNITRMDTRVE−−−−TKSQQLD−−−−−−−−−−−−YQV−−−−VTENDPNVYVGERRVVQDGQV−−−−−−−−−−−−−−−−−−−−−−−−−−GHKDVEEL−−−−−−−−−−−−−−−−−VSLEDGVEVSRK−−−−−−VVAEKITLQPVN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QVISEGSKPKQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQVVSSR−−−−−−−−−−−−−−−GETIPY−−AFSR−−VLTMRATAYSKQQEGLT−−−−−−−−DRTATGEYVVHD−−−−−−−−−−−−−−−−−−−−−−−−−−−ESGYSTIAVDPRVIPLGTKLYISG−−−−−−−YGLA−−IASDTGGA−−IVDDR−−−−−I−−DVYFDTIAE−−−−CTSWGIRSVEVYVLE                                                      
fig|309798.4.peg.1187   Coprothermobacter proteolyticus DSM 5265                                                                                                                 VKMQ−−−−−−−−GKTL−−−−−−−−−−−−−−−KLTTPYSDK−−−−−−−−−−−−−−−−NILK−−−−−−−−−−−−−−−−−−−−−−−−−−−VISATGSNFEVKKQGNVLLVQSVEVTTN−−−−VNYVYIP−−−−−−−−−−−−PKV−−−−IVQPSNTVARGRSAVLSSGAP−−−−−−−−−−−−−−−−−−−−−−−−−−TIKQQTWQ−−−−−−−−−−−−−−−−−IKKVDGKVVERK−−−−−−LIKEQIVQQGRD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVVALGQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GTYR−−−−−−−−−−−−−−−GE−−−−−−−−−AQ−−EILMVATAYSAEEPGIG−−−−−−−−TRTAMGTRVRY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GVVAVDPKVIPLGTKLYIEG−−−−−−−YGYA−−VAEDVGGK−−IKGNR−−−−−I−−DVYFNTVKE−−−−CYQWGRRVVKVYVL                                                       
fig|485916.5.peg.110   Desulfotomaculum acetoxidans DSM 771             VAGVALCAAIGLSVFNWAQKNITLSVDGKKIITKTFASNVQELIEQKKIKLNEKDRLIPQPDTKLTD−−−GLEVAVIR−−−−−−−−ALPVS−−−−−−−−−IDVA−−−−−−−−GEKL−−−−−−−−−−−−−−−EITSSAQNVK−−−−−−−−−−−−−−−−QLIDEQKI−−−−−−−−−−GLNERD−−−−−EVIPALNEKLSP−−−GMKIQVTRVEQKTI−−−−EKEVQLA−−−−−−−−−−−−YRT−−−−ETRYTPSLSRGITRISRAGKA−−−−−−−−−−−−−−−−−−−−−−−−−−GTEKQIWQ−−−−−−−−−−−−−−−−−VTYRNGEEVSSQ−−−−−−MVGSQIVSTPVS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KIVDYGTKQQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDR−−−−−−−−−−−−−−−SGQTY−−QYSQ−−EMYVIATAYTY−−−−TG−−−−−−−−RNTASGIPPSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GSVAVDPRVIPIGTRLYIEG−−−−−−−YGYG−−RAVDTGGS−−IKGNK−−−−−V−−DVFLESEQQ−−−−CRKWGVRKVKVYVL                                                       
fig|485916.4.peg.476   Desulfotomaculum acetoxidans DSM 771                                                                                                      VS−−−−−−−−−IDVA−−−−−−−−GEKL−−−−−−−−−−−−−−−EITSSAQNVK−−−−−−−−−−−−−−−−QLIDEQKI−−−−−−−−−−GLNERD−−−−−EVIPALNEKLSP−−−GMKIQVTRVEQKTI−−−−EKEVQLA−−−−−−−−−−−−YRT−−−−ETRYTPSLSRGITRISRAGKA−−−−−−−−−−−−−−−−−−−−−−−−−−GTEKQIWQ−−−−−−−−−−−−−−−−−VTYRNGEEVSSQ−−−−−−MVGSQIVSTPVS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KIVDYGTKQQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDR−−−−−−−−−−−−−−−SGQTY−−QYSQ−−EMYVIATAYTY−−−−TG−−−−−−−−RNTASGIPPSV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GSVAVDPRVIPIGTRLYIEG−−−−−−−YGYG−−RAVDTGGS−−IKGNK−−−−−V−−DVFLESEQQ−−−−CRKWGVRKVKVYVL                                                       
fig|429009.3.peg.2108   Ammonifex degensii KC4                AAVLTGLAVGGYAWARKTVTLVVDGKPVKVVTLHRKVEGVLRQEGIALGPHDRVLPGLTATLKN−−−GMRVEIRH−−−−−−−−AVPAT−−−−−−−−−LEVD−−−−−−−−GKRL−−−−−−−−−−−−−−−KIYTCATSVE−−−−−−−−−−−−−−−−ELLQEAGV−−−−−−−−−−KLGKDD−−−−−LVEPGKDTPVRP−−−NLSVKVIRVTKEIV−−−−EKKVPVP−−−−−−−−−−−−YGV−−−−KRQYTAELYRGETKVLSEGRE−−−−−−−−−−−−−−−−−−−−−−−−−−GEALERWE−−−−−−−−−−−−−−−−−IVRYDGEVKEEK−−−−−−LVDRQVLRPPVD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RVVAVGTLQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ISR−−−−−−−−−−−−−−−GGENL−−RFSR−−VLVMRATAYSYD−−−TG−−−−−−−−YYTATGIPVRR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIAAVDPRVIPLGTRLYVEG−−−−−−−YGYA−−LAADTGGA−−IKGNA−−−−−I−−DLFFPTHSE−−−−VYNWGVRTVRVYVLE                                                      
fig|349161.6.peg.73   Desulfotomaculum reducens MI-1                                                       ASVVLGYALWSQSITVSEIINETEG−−−FIHEVVTG−−−−−−−−KLPVT−−−−−−−−−LQVD−−−−−−−−GKTT−−−−−−−−−−−−−−−VLQTTSKTVQ−−−−−−−−−−−−−−−−GLLEEQRI−−−−−−−−−−GLKPED−−−−−KVFPALSAPIKK−−−NIKVQVIRVEVKKE−−−−YHNLPVP−−−−−−−−−−−−FTT−−−−ERMASQEMPRGFARKVRNGKE−−−−−−−−−−−−−−−−−−−−−−−−−−GLQKEVWS−−−−−−−−−−−−−−−−−VRYEDGVEVSRI−−−−−−CEAREIIQQPVN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ALVQYGTLSN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VNR−−−−−−−−−−−−−−−GGENL−−RINR−−AMEMLATGYSY−−−−TG−−−−−−−−YNTATGVVPRP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIAAVDPRVIPLGTRLYVEG−−−−−−−YGKA−−TALDTGGA−−IQGGR−−−−−I−−DLFYETEAE−−−−ALQWGKRNTRVYVLE                                                      
fig|246194.3.peg.2088   Carboxydothermus hydrogenoformans Z-2901                                               TKAATVEELLTETKRTLGLKDTINMPLTAKLKE−−−GTKIVINR−−−−−−−−AKPVK−−−−−−−−−IKVD−−−−−−−−GREI−−−−−−−−−−−−−−−EILTVAKTIA−−−−−−−−−−−−−−−−DAIKEAGI−−−−−−−−−−TVNPQD−−−−−IVEPSPAELVGL−−−NTEVKIIRVKVEEK−−−−TEEVVLA−−−−−−−−−−−−YRT−−−−IKRPSNSLFKGRTKVLTKGKT−−−−−−−−−−−−−−−−−−−−−−−−−−GLARTYYK−−−−−−−−−−−−−−−−−ITYYDGKVVKRE−−−−−−VIKQEVVKKPVD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EVILVGTKNT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSR−−−−−−−−−−−−−−−GGRII−−RFSR−−VIDVVATAYTH−−−−TG−−−−−−−−YRTATGVYPHR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GVVAVDPDVIPYGTRLYIDG−−−−−−−YGYG−−TALDTGSA−−IRGAR−−−−−I−−DLFFDTYGE−−−−AISWGRRYTRVYVLE                                                      
fig|643648.3.peg.64   Syntrophothermus lipocalidus DSM 12680                                      VDGKLVRTLTFKQTVQDVLEQEGIKLGPKDVVKPGLDTRLEK−−−GSRIQVIR−−−−−−−−AFNVK−−−−−−−−−VLAD−−−−−−−−GRVR−−−−−−−−−−−−−−−QILTTPVTVA−−−−−−−−−−−−−−−−QALKVAGI−−−−−−−−−−GLGDED−−−−−IVTPKPDVVIKK−−−GQDIRVVRVSHQVI−−−−TANAVIP−−−−−−−−−−−−YPV−−−−QRTADNTLEKGLTKTVRRGQN−−−−−−−−−−−−−−−−−−−−−−−−−−GLAVDEIK−−−−−−−−−−−−−−−−−ITYHDGKETGRE−−−−−−VIGRTIVKDPVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QVIAMGTITS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSR−−−−−−−−−−−−−−−GNLRL−−DFDR−−AMIAEATAYTY−−−−TG−−−−−−−−SRTSSGAYPEV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GLVAVDPSVIPMGTRLYVEG−−−−−−−YGFA−−RAADCGSD−−IKGNR−−−−−I−−DVFMETESQ−−−−CRSWGRRTVKVYVLE                                                      
fig|264732.9.peg.52   Moorella thermoacetica ATCC 39073                                                                                                       K−−−−−−−−−INAD−−−−−−−−GREK−−−−−−−−−−−−−−−EILTPPDTVA−−−−−−−−−−−−−−−−NVLNKAGV−−−−−−−−−−TLNPAD−−−−−RVIPDLNATIAA−−−GDTIKVIRVTVKTE−−−−TVSKEIN−−−−−−−−−−−−YRV−−−−ERRPEPQLEKGITRLLQEGVK−−−−−−−−−−−−−−−−−−−−−−−−−−GLQEETYR−−−−−−−−−−−−−−−−−VILEDGQEVKRE−−−−−−LVSTKTLKEPVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EIVAVGAMDT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ASR−−−−−−−−−−−−−−−GGQSF−−RFER−−VFWATATAYTH−−−−SG−−−−−−−−APTATGAYPRV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GTIAVDPAVVPLGTRLYVEG−−−−−−−YGYG−−IAQDIGSA−−IKGDR−−−−−I−−DVFLDTEAD−−−−TRRWGVRRVKVYVLR                                                      
fig|264732.11.peg.54   Moorella thermoacetica ATCC 39073                                                                                                       K−−−−−−−−−INAD−−−−−−−−GREK−−−−−−−−−−−−−−−EILTPPDTVA−−−−−−−−−−−−−−−−NVLNKAGV−−−−−−−−−−TLNPAD−−−−−RVIPDLNATIAA−−−GDTIKVIRVTVKTE−−−−TVSKEIN−−−−−−−−−−−−YRV−−−−ERRPEPQLEKGITRLLQEGVK−−−−−−−−−−−−−−−−−−−−−−−−−−GLQEETYR−−−−−−−−−−−−−−−−−VILEDGQEVKRE−−−−−−LVSTKTLKEPVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EIVAVGAMDT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ASR−−−−−−−−−−−−−−−GGQSF−−RFER−−VFWATATAYTH−−−−SG−−−−−−−−APTATGAYPRV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GTIAVDPAVVPLGTRLYVEG−−−−−−−YGYG−−IAQDIGSA−−IKGDR−−−−−I−−DVFLDTEAD−−−−TRRWGVRRVKVYVLR                                                      
fig|428128.7.peg.798   Eubacterium siraeum DSM 15702                                                                                  EGQKIAVTR−−−−−−−−AYDVK−−−−−−−−−ITAD−−−−−−−−GKTT−−−−−−−−−−−−−−−TVKCLDNTVS−−−−−−−−−−−−−−−−ELLKRAKI−−−−−−−−−−TLGKND−−−−−MVSEELESKITG−−−PAEIKVSRVEIKTE−−−−KQDKIIP−−−−−−−−−−−−YQT−−−−STVTSNILAIGQSEVRTKGVN−−−−−−−−−−−−−−−−−−−−−−−−−−GKIRTTTT−−−−−−−−−−−−−−−−−TTYIDGVKTDVK−−−−−−−KTTKVVTKKVD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EVIAEGA−−−−−−−−−−−−−−−−−−−−−−−−−−AIVTPYCKIDDTSIVLR−−−−−−−−−−−−−−−NGRPV−−DYEY−−VVSGKATAYTAPEG−−−−−−−−−−−AYTASGRMAEI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GTVAVNPNVIPYGSKLYIVGQYDNICYGYA−−IAADTGDG−−MMAGT−−−−−IPVDVYMGSTEEHYDDACAWGLQYVDIYVVE                                                      
fig|546271.5.peg.537   Selenomonas sputigena ATCC 35185                                    IVVDGKTLEVSTRYSSPELILHQAGVEIRHKDEFQLKKSDK−−−−−−EEKIIVQR−−−−−−−−AVPVV−−−−−−−−−IEFE−−−−−−−−GDRQ−−−−−−−−−−−−−−−KVYTTRSNVG−−−−−−−−−−−−−−−−EVLKDYGY−−−−−−−−−−−VGDRF−−−−−SAELDGATRLEK−−−NLNIKIHD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LVAEKEREEAAR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RAQSVET−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SR−−−−−−−−−−−−−−−−−−GAM−−RYVR−−EYDMEATAYLPTDGGGN−−−−−−−−GITASGMLAER−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GVVAVDTDVIPLGTRLYIPG−−−−−−−YGVA−−IAGDTGGA−−INGER−−−−−I−−DLCMESYGE−−−−AMEFGRRWVKVYVLE                                                      
fig|543302.3.peg.2488   Alicyclobacillus acidocaldarius LAA1                                                                                                     EVT−−−−−−−−−LDVE−−−−−−−−GKTE−−−−−−−−−−−−−−−TVFTFAKTVG−−−−−−−−−−−−−−−−ELLKGEHI−−−−−−−−−−ELTPHD−−−−−RMNVKATDAIRQ−−−GETIEIHSYVTETT−−−−TETQDIP−−−−−−−−−−−−FQT−−−−IRRTTSELLRGHVQYVTHGVK−−−−−−−−−−−−−−−−−−−−−−−−−−GLLQVQTT−−−−−−−−−−−−−−−−−RVYRDGKCIATR−−−−−−VVKRIVREPID−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AVVEVGTAEPK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PVQATLATR−−−−−−−−−−−−−−SANPDPG−−LIRE−−ALTVVATAYVAG−−−−−−−−−−−−−GTTATGVPAEP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GVIAVDPRVIPLGSRVYIPG−−−−−−−IGVC−−IAADTGSA−−IVGDR−−−−−I−−DICMASLSQ−−−−ADAWGARTITIYVL                                                       
fig|521098.4.peg.777   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446                                                                                                     EVT−−−−−−−−−LDVE−−−−−−−−GKTE−−−−−−−−−−−−−−−TVFTFAKTVG−−−−−−−−−−−−−−−−ELLKGEHI−−−−−−−−−−ELTPHD−−−−−RMNVKATDAIRQ−−−GETIEIHSYVTETT−−−−TETQDIP−−−−−−−−−−−−FQT−−−−IRRTTIELLRGHVQYVTHGVK−−−−−−−−−−−−−−−−−−−−−−−−−−GLLQVQTT−−−−−−−−−−−−−−−−−RVYRDGKCIATR−−−−−−VVKRIVREPID−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AVVEVGTAEPK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PVQATLATR−−−−−−−−−−−−−−SANPDPG−−LIRE−−ALTVVATAYVAG−−−−−−−−−−−−−GTTATGVPAEP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GVIAVDPRVIPLGSRVYIPG−−−−−−−IGVC−−IAADTGSA−−IVGDR−−−−−I−−DICMASLSQ−−−−ADAWGARTITIYVL                                                       
fig|521098.5.peg.1777   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446                                                                                                     EVT−−−−−−−−−LDVE−−−−−−−−GKTE−−−−−−−−−−−−−−−TVFTFAKTVG−−−−−−−−−−−−−−−−ELLKGEHI−−−−−−−−−−ELTPHD−−−−−RMNVKATDAIRQ−−−GETIEIHSYVTETT−−−−TETQDIP−−−−−−−−−−−−FQT−−−−IRRTTIELLRGHVQYVTHGVK−−−−−−−−−−−−−−−−−−−−−−−−−−GLLQVQTT−−−−−−−−−−−−−−−−−RVYRDGKCIATR−−−−−−VVKRIVREPID−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AVVEVGTAEPK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PVQATLATR−−−−−−−−−−−−−−SANPDPG−−LIRE−−ALTVVATAYVAG−−−−−−−−−−−−−GTTATGVPAEP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GVIAVDPRVIPLGSRVYIPG−−−−−−−IGVC−−IAADTGSA−−IVGDR−−−−−I−−DICMASLSQ−−−−ADAWGARTITIYVL                                                       
fig|481743.5.peg.27   Geobacillus sp. Y412MC10                                                                                                       N−−−−−−−−−VTVG−−−−−−−−SKTK−−−−−−−−−−−−−−−TIFTSQDTVD−−−−−−−−−−−−−−−−HVLKEAGV−−−−−−−−−−TIQGED−−−−−IVQPSQDTKLTS−−−NMNINVVRVTKQKV−−−−KETEDRE−−−−−−−−−−−−FRV−−−−IKTADPSLEKGDNRVIQRGES−−−−−−−−−−−−−−−−−−−−−−−−−−GLMVNHYE−−−−−−−−−−−−−−−−−KVYHNGKLVSKT−−−−−−KVSQQIERRTKD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KIIAVGTKKVEKPVIVQAAATDVKATPAKLSGTKKVTTAKAVENNVVSR−−−−−−−−−−−−−−−AGVDF−−KYKK−−VLNNVSMTAYSAEQQGIG−−−−−−−−TRTASGTRVTEG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RTIAVDPNIIPIGWWVYIEG−−−−−−−IGFR−−RAEDTGGA−−IKGNK−−−−−I−−DVYYDSLKS−−−−AMNFGRKSGRTVYVI                                                       
fig|575609.3.peg.1247   Peptoniphilus sp. oral taxon 386 str. F0131                                                                          NTEIKD−−−DMDIIIQA−−−−−−−−PKSYQ−−−−−−−−−INNG−−−−−−−−NEIY−−−−−−−−−−−−−−−IAKAVGETVS−−−−−−−−−−−−−−−−EVLENLNI−−−−−−−−−−KVDSDD−−−−−VVTPKLNAKASI−−−EKPIVIERVFKESS−−−−EVKTEIP−−−−−−−−−−−−FET−−−−IKNENASLVVGETKIIKKGKV−−−−−−−−−−−−−−−−−−−−−−−−−−GVKSEIIQ−−−−−−−−−−−−−−−−−NTFVNDKLVSID−−−−−−VLKSEILEEPET−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EIVEIGTKKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AAS−−−−−−−−−−−−−−−ATLEGK−−KIKK−−VITMQATAYDPTAG−−−−−−−−−−−SLTALGTKARV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GAVAVDPKVIPLGSKLYIETMDGWPSYGYA−−VAEDTGGA−−IKGNR−−−−−I−−DLFFNSNAT−−−−ANDFGRRNVKVYVIE                                                      
fig|596330.3.peg.1564   Peptoniphilus lacrimalis 315-B                                             VFTYANDVETLLNQEKIELKDDEEVYPSPSEEITE−−−GMEINIRK−−−−−−−−IKTYK−−−−−−−−−IKIN−−−−−−−−NRTI−−−−−−−−−−−−−−−VVKAKGASVQ−−−−−−−−−−−−−−−−EVLNNLGI−−−−−−−−−−KVNKLD−−−−−IVKPSLDTATDTIEDEFQITIYRVKEEVT−−−−KNQTEIG−−−−−−−−−−−−FQI−−−−ISKENKDLAQGEKNIITPGQN−−−−−−−−−−−−−−−−−−−−−−−−−−GLQEDTVK−−−−−−−−−−−−−−−−−SLYINDQLRSQE−−−−−−LVSRKVIKEPVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QVEEIGVKNT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VTK−−−−−−−−−−−−−−−SPTGD−−NVIA−−VYTMKATAYDPSAG−−−−−−−−−−−SRTASGTRARV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GAVAVDPSVIALGSKLYIESTDSWPSYGYA−−VAEDTGGA−−IKGNR−−−−−I−−DLFFNSNAT−−−−ANKFGRRTVKVYVL                                                       
fig|439292.4.peg.3417   Bacillus selenitireducens MLS10               SVDTKIEANMTIAYTEAQEVRVSIGEDTETVWTTADTVGDLLDDMNQEVGEHDQVEPDLNERLES−−−GMDIAYQE−−−−−−−−AFPVT−−−−−−−−−VTSD−−−−−−−−GETE−−−−−−−−−−−−−−−EVWTVSTTVG−−−−−−−−−−−−−−−−DLLDAQAI−−−−−−−−−−ELGELD−−−−−RVEPEADEELNI−−−EEDVRVVRVEKVTD−−−−VVEETIS−−−−−−−−−−−−YGT−−−−VTENDSSMARGTEEVLEPGEE−−−−−−−−−−−−−−−−−−−−−−−−−−GKKEKRYE−−−−−−−−−−−−−−−−−VVLEDGEEVSRE−−−−−−LIDEEVVSESQD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RVVAVGTRSTQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QNVSR−−−−−−−−−−SGNASSSSSSS−−SAGE−−WMNFTATAYTAYCTGCS−−−−−−−−GVTRTGIDLRAN−−−−−−−−−−−−−−−−−−−−−−−−−−−PNSRVIAVDPSVIPLGSRVEVEG−−−−−−−RGTF−−LAADTGGA−−INGRK−−−−−I−−DIFMPDRSA−−−−ALAFGRQSVRVRIVE                                                      
fig|1147161.3.peg.41   Bacillus subtilis subsp. subtilis 6051-HGW                                                  KTVGALLDEQDVDVKEQDQIDPAIDTDISK−−−DMKINIEP−−−−−−−−AFQVT−−−−−−−−−VNDA−−−−−−−−GKQK−−−−−−−−−−−−−−−KIWTTSTTVA−−−−−−−−−−−−−−−−DFLKQQKM−−−−−−−−−−NIKDED−−−−−KIKPALDAKLTK−−GKADITITRIEKVTD−−−−VVEEKIA−−−−−−−−−−−−FDV−−−−KKQEDASLEKGKEKVVQKGKE−−−−−−−−−−−−−−−−−−−−−−−−−−GKLKKHFE−−−−−−−−−−−−−−−−−VVKENGKEVSRE−−−−−−LVKEETAEQSKD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVIAVGTKQSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PKFETVSAS−−−−−−−−GDSKTVVSRSNE−−STGK−−VMTVSSTAYTASCSGCS−−−−−−−−GHTATGVNLKNN−−−−−−−−−−−−−−−−−−−−−−−−−−−PNAKVIAVDPNVIPLGSKVHVEG−−−−−−−YGYA−−IAADTGSA−−IKGNK−−−−−I−−DVFFPEKSS−−−−AYRWGNKTVKIKIL                                                       
fig|444177.5.peg.4810   Lysinibacillus sphaericus C3-41                                               TSVENIKTLNHITTNLIQPGDVLTIAQQYTVKQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GDTLWD−−−−−−−−−−−−−IALNHQVTVS−−−−−−−−−−−−−−−−QIKEWNQL−−−−−−−−−−−−−HTD−−−−−LIHPGLHLSI−−−−−−−−−−−−−IDGTKTN−−−−TAITDKP−−−−−−−−−−−−IKP−−−−AKETTTSVTNHKTAMESKPEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TVSSTSKTASKD−−−−−−RVPEVTAPSTNN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAPKENTPEAI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TPPSNT−−IASK−−ELIVEASAYTASCEGCS−−−−−−−−GITATGINLKTN−−−−−−−−−−−−−−−−−−−−−−−−−−−PHAKVISVDPTVIPLGSKVYVEG−−−−−−−YGEA−−IAGDTGGA−−INGNR−−−−−I−−DVFFPSQQD−−−−AINFGVKQLKVTIL                                                       
fig|386043.6.peg.149   Listeria welshimeri serovar 6b str. SLCC5334                                                                                                                             AKKD−−−−−−−−−−−−−−−TVWTTKTQVG−−−−−−−−−−−−−−−−DLLSEKNI−−−−−−−−−−KLDKDD−−−−−RVSPAKDSNLKE−−−KMTVQVTYVDSKAD−−−−KKKEQIK−−−−−−−−−−−−FNT−−−−VYKEDDSLNQGTEKVVREGKT−−−−−−−−−−−−−−−−−−−−−−−−−−GEKVIEYK−−−−−−−−−−−−−−−−−VTFENGKEKKRD−−−−−−IIKENITSAKTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVVVRGTKEKA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VVSKIANAKPAKKVTTTNTSSHKSSSKAP−−SNGK−−TFTMESTAYSG−−−−−G−−−−−−−−GVTATGINLSAN−−−−−−−−−−−−−−−−−−−−−−−−−−−PGMKVVAVDPSIIPLGSRVWVEG−−−−−−−YGEA−−IAGDTGGA−−IKGNI−−−−−V−−DVYFSNESS−−−−CYSWGRRTVTVKVL                                                       
fig|386043.9.peg.158   Listeria welshimeri serovar 6b str. SLCC5334                                                                                                                             AKKD−−−−−−−−−−−−−−−TVWTTKTQVG−−−−−−−−−−−−−−−−DLLSEKNI−−−−−−−−−−KLDKDD−−−−−RVSPAKDSNLKE−−−KMTVQVTYVDSKAD−−−−KKKEQIK−−−−−−−−−−−−FNT−−−−VYKEDDSLNQGTEKVVREGKT−−−−−−−−−−−−−−−−−−−−−−−−−−GEKVIEYK−−−−−−−−−−−−−−−−−VTFENGKEKKRD−−−−−−IIKENITSAKTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVVVRGTKEKA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VVSKIANAKPAKKVTTTNTSSHKSSSKAP−−SNGK−−TFTMESTAYSG−−−−−G−−−−−−−−GVTATGINLSAN−−−−−−−−−−−−−−−−−−−−−−−−−−−PGMKVVAVDPSIIPLGSRVWVEG−−−−−−−YGEA−−IAGDTGGA−−IKGNI−−−−−V−−DVYFSNESS−−−−CYSWGRRTVTVKVL                                                       
fig|683837.3.peg.162   Listeria seeligeri serovar 1/2b str. SLCC3954                                                                                                                                                                                 I−−−−−−−−−−KLDKED−−−−−RVSPAKDSNLKE−−−KMTVQVTYVDSKAD−−−−KKKEQIK−−−−−−−−−−−−FNT−−−−VYKEDDSLNQGVEKVVQEGKT−−−−−−−−−−−−−−−−−−−−−−−−−−GEKIVEYK−−−−−−−−−−−−−−−−−VTFENGKEKKRD−−−−−−VVKENVTSEKSD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVVVRGTKEKA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VVSQIANAKPAKKATSSNTSSSTSSS−−AP−−SGGK−−TFTMESTAYSG−−−−−G−−−−−−−−GTTATGINLSAN−−−−−−−−−−−−−−−−−−−−−−−−−−−PGMKVVAVDPSVIPLGSHVWVEG−−−−−−−YGEA−−IAGDTGGA−−IKGNI−−−−−V−−DVYFPNESS−−−−CYSWGRRTVTVKVL                                                       
fig|272626.1.peg.223   Listeria innocua Clip11262                                                                                                                                                                                 I−−−−−−−−−−KLDKDD−−−−−RVSPAKDSNLKE−−−KMTVQVTYVNSKAE−−−−KKNEQIK−−−−−−−−−−−−FET−−−−VYKEDDSLNKGVEKVVQEGKN−−−−−−−−−−−−−−−−−−−−−−−−−−GEKVVEYN−−−−−−−−−−−−−−−−−VTFENDKETKRD−−−−−−VIKENVTSEKTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVVVRGTKEKA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVSQIANAS−−−−SSKAT−−−TSNASSAP−−SGGK−−TYRMESTAYSG−−−−−G−−−−−−−−GMTAYGINLSAN−−−−−−−−−−−−−−−−−−−−−−−−−−−PGMKVIAVDPNVIPLGSKVWVEG−−−−−−−YGEA−−IAGDTGGV−−IKGNI−−−−−V−−DVYFPNESQ−−−−CYSWGRRMVTVKVL                                                       
fig|563174.3.peg.207   Listeria monocytogenes L99                                                                                                                                                                                 I−−−−−−−−−−KLDQDD−−−−−RVSPAKDSNLKE−−−KMTVEVTYVNSKAE−−−−KKNEQVK−−−−−−−−−−−−FET−−−−VYKEDDSLNKGVEKVVQEGKN−−−−−−−−−−−−−−−−−−−−−−−−−−GEKVVEYK−−−−−−−−−−−−−−−−−VTFENGKEKKRD−−−−−−VIKENVTSNKTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVVVRGTKEKV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VATQVSTSS−−−−−−−−SSASSSSSSAPS−−SGGK−−TYRMESTAYSG−−−−−G−−−−−−−−GITAYGINLSAN−−−−−−−−−−−−−−−−−−−−−−−−−−−PGLKVIAVDPRVIPLGSKVWVEG−−−−−−−YGEA−−IAGDTGGV−−IKGNI−−−−−V−−DVYFPNESQ−−−−CYSWGRRMVTVKVL                                                       
fig|393123.7.peg.520   Listeria monocytogenes FSL N1-017                                                                                                                                                                                 I−−−−−−−−−−KLDQDD−−−−−RVSPAKDSNLKE−−−KMTVEVTYVNSKAE−−−−KKNEQVK−−−−−−−−−−−−FET−−−−VYKEDDSLNKGVEKVVQEGKN−−−−−−−−−−−−−−−−−−−−−−−−−−GEKVVEYK−−−−−−−−−−−−−−−−−VTFENGKEKKRD−−−−−−VIKENVTSNKTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVVVRGTKEKV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VATQVSTSS−−−−−−−−SSASSSSSSAPS−−SGGK−−TYRMESTAYSG−−−−−G−−−−−−−−GITAYGINLSAN−−−−−−−−−−−−−−−−−−−−−−−−−−−PGLKVIAVDPRVIPLGSKVWVEG−−−−−−−YGEA−−IAGDTGGV−−IKGNI−−−−−V−−DVYFPNESQ−−−−CYSWGRRMVTVKVL                                                       
fig|393128.3.peg.1647   Listeria monocytogenes F6900                                                                                                                                                                                 I−−−−−−−−−−KLDQDD−−−−−RVSPAKDSNLKE−−−KMTVEVTYVNSKAE−−−−KKNEQVK−−−−−−−−−−−−FET−−−−VYKEDDSLNKGVEKVVQEGKN−−−−−−−−−−−−−−−−−−−−−−−−−−GKKVVEYK−−−−−−−−−−−−−−−−−VTFENGKENKRD−−−−−−VIKENVTSNKTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVVVRGTKEKV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VATPVSNVS−−−−TSSATSSSSSSASSTP−−SGGK−−TYKMESTAYSG−−−−−G−−−−−−−−GTTAYGINLSAN−−−−−−−−−−−−−−−−−−−−−−−−−−−PGLKVIAVDPRIIPLGSKVWVEG−−−−−−−YGEA−−IAGDTGGA−−IKGNI−−−−−V−−DVYFPNESQ−−−−CYSWGRRMVTVKVL                                                       
fig|169963.1.peg.184   Listeria monocytogenes EGD-e                                                                                                                                                                                 I−−−−−−−−−−KLDQDD−−−−−RVSPAKDSNLKE−−−KMTVEVTYVNSKAE−−−−KKNEQVK−−−−−−−−−−−−FET−−−−VYKEDDSLNKGVEKVVQEGKN−−−−−−−−−−−−−−−−−−−−−−−−−−GKKVVEYK−−−−−−−−−−−−−−−−−VTFENGKEKKRD−−−−−−VIKENVTSNKTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVVVRGTKEKV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VATPVSNVS−−−−TSSATSSSSSSASSTP−−SGGK−−TYKMESTAYSG−−−−−G−−−−−−−−GTTAYGINLSAN−−−−−−−−−−−−−−−−−−−−−−−−−−−PGLKVIAVDPRIIPLGSKVWVEG−−−−−−−YGEA−−IAGDTGGA−−IKGNI−−−−−V−−DVYFPNESQ−−−−CYSWGRRMVTVKVL                                                       
fig|393127.4.peg.2415   Listeria monocytogenes Finland 1988                                                                                                                                                                                 I−−−−−−−−−−KLDQDD−−−−−RVSPAKDSNLKE−−−KMTVEVTYVNSKAE−−−−KKNEQVK−−−−−−−−−−−−FET−−−−VYKEDDSLNKGVEKVVQEGKN−−−−−−−−−−−−−−−−−−−−−−−−−−GKKVVEYK−−−−−−−−−−−−−−−−−VTFENGKEKKRD−−−−−−VIKENVTSNKTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVVVRGTKEKV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VATPVSNVS−−−−TSSATSSSSSSASSTP−−SGGK−−TYKMESTAYSG−−−−−G−−−−−−−−GTTAYGINLSAN−−−−−−−−−−−−−−−−−−−−−−−−−−−PGLKVIAVDPRIIPLGSKVWVEG−−−−−−−YGEA−−IAGDTGGA−−IKGNI−−−−−V−−DVYFPNESQ−−−−CYSWGRRMVTVKVL                                                       
fig|393133.3.peg.934   Listeria monocytogenes 10403S                                                                                                                                                                                 I−−−−−−−−−−KLDQDD−−−−−RVSPAKDSNLKE−−−KMTVEVTYVNSKAE−−−−KKNEQVK−−−−−−−−−−−−FET−−−−VYKEDDSLNKGVEKVVQEGKN−−−−−−−−−−−−−−−−−−−−−−−−−−GKKVVEYK−−−−−−−−−−−−−−−−−VTFENGKEKKRD−−−−−−VIKENVTSNKTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVVVRGTKEKV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VATPVSNVS−−−−TSSATSSSSSSASSTP−−SGGK−−TYKMESTAYSG−−−−−G−−−−−−−−GTTAYGINLSAN−−−−−−−−−−−−−−−−−−−−−−−−−−−PGLKVIAVDPRIIPLGSKVWVEG−−−−−−−YGEA−−IAGDTGGA−−IKGNI−−−−−V−−DVYFPNESQ−−−−CYSWGRRMVTVKVL                                                       
fig|265669.1.peg.194   Listeria monocytogenes str. 4b F2365                                                                                                                                                                                 I−−−−−−−−−−KLDQDD−−−−−RVSPAKDSNLKE−−−KMTVEVTYVNSKAE−−−−KKNEQVK−−−−−−−−−−−−FET−−−−VYKEDDSLNKGVEKVVQEGKN−−−−−−−−−−−−−−−−−−−−−−−−−−GEKVVEYK−−−−−−−−−−−−−−−−−VTFENGKEKKRD−−−−−−VIKENVTSKKTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVVVRGTKEKV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VATPVSNVS−−−−TPSTTSSSSSSSSSTP−−SGGK−−TYRMESTAYSG−−−−−G−−−−−−−−GTTAYGINLSAN−−−−−−−−−−−−−−−−−−−−−−−−−−−PGLKVIAVDPRIIPLGSKVWVEG−−−−−−−YGEA−−IAGDTGGA−−IKGNI−−−−−V−−DVYFPNESQ−−−−CYSWGRRMVTVKVL                                                       
fig|401650.12.peg.2232   Listeria monocytogenes HPB2262                                                                                                                                                                                 I−−−−−−−−−−KLDQDD−−−−−RVSPAKDSNLKE−−−KMTVEVTYVNSKAE−−−−KKNEQVK−−−−−−−−−−−−FET−−−−VYKEDDSLNKGVEKVVQEGKN−−−−−−−−−−−−−−−−−−−−−−−−−−GEKVVEYK−−−−−−−−−−−−−−−−−VTFENGKEKKRD−−−−−−VIKENVTSKKTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVVVRGTKEKV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VATPVSNVS−−−−TPSTT−−SSSSSSSTP−−SGGK−−TYRMESTAYSG−−−−−G−−−−−−−−GTTAYGINLSAN−−−−−−−−−−−−−−−−−−−−−−−−−−−PGLKVIAVDPRIIPLGSKVWVEG−−−−−−−YGEA−−IAGDTGGA−−IKGNI−−−−−V−−DVYFPNESQ−−−−CYSWGRRMVTVKVL                                                       
fig|393125.10.peg.2102   Listeria monocytogenes FSL R2-503                                                                                                                                                                                 I−−−−−−−−−−KLDQDD−−−−−RVSPAKDSNLKE−−−KMTVEVTYVNSKAE−−−−KKNEQVK−−−−−−−−−−−−FET−−−−VYKEDDSLNKGVEKVVQEGKN−−−−−−−−−−−−−−−−−−−−−−−−−−GEKVVEYK−−−−−−−−−−−−−−−−−VTFENGKEKKRD−−−−−−VIKENVTSKKTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVVVRGTKEKV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VATPVSNVS−−−−TPSTT−−−SSSSSSTP−−SGGK−−TYRMESTAYSG−−−−−G−−−−−−−−GTTAYGINLSAN−−−−−−−−−−−−−−−−−−−−−−−−−−−PGLKVIAVDPRIIPLGSKVWVEG−−−−−−−YGEA−−IAGDTGGA−−IKGNI−−−−−V−−DVYFPNESQ−−−−CYSWGRRMVTVKVL                                                       
fig|393117.3.peg.3370   Listeria monocytogenes FSL J1-194                                                                                                                                                                                 I−−−−−−−−−−KLDQDD−−−−−RVSPAKDSNLKE−−−KMTVEVTYVNSKAE−−−−KKNEQVK−−−−−−−−−−−−FET−−−−VYKEDDSLNKGVEKVVQEGKN−−−−−−−−−−−−−−−−−−−−−−−−−−GEKVVEYK−−−−−−−−−−−−−−−−−VTFENGKEKKRD−−−−−−VIKENVTSKKTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVVVRGTKEKV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VATPVSNVS−−−−TPSTT−−−−SSSSSTP−−SGGK−−TYRMESTAYSG−−−−−G−−−−−−−−GTTAYGINLSAN−−−−−−−−−−−−−−−−−−−−−−−−−−−PGLKVIAVDPRIIPLGSKVWVEG−−−−−−−YGEA−−IAGDTGGA−−IKGNI−−−−−V−−DVYFPNESQ−−−−CYSWGRRMVTVKVL                                                       
fig|638301.3.peg.556   Granulicatella adiacens ATCC 49175                                                                                                                    D−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−EVLKNLAD−−−−−−−−−−QVNELN−−−−−RLKSEASQAQSD−−−−LETKKEKLTSESQ−−−−SYQSSIEGLKQLIADNKATFEK−−−−MEKEKKEAKVAFSPTIAALTS−−−−−−−−−−−−−−−−−−−−−−−−−−DSKQTNQV−−−−−−−−−−−−−−−−−APSTSGQET−−−−−−−−−TAAKPVAAEPST−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−STTQAAP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TTTETPTTTSN−−−−−−−−−−−−−−−SSSSSQ−−SSGR−−TLQVVATGYSYNEPGLG−−−−−−−−YYTATGIDLRSNP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TVIAVDPSVIPLGSLIEVPG−−−−−−−YGVA−−IAGDTGSA−−IKGNI−−−−−I−−DLHFVSVDQ−−−−ANQWGRRTVTIKILK                                                      
fig|525282.5.peg.1592   Finegoldia magna ATCC 53516                                                                       SKIIEGLEQGDNVKVEKIG−−−−−−−−EVFAK−−−−−−−−−VNFTK−−−−−−−DGKKFEGFIY−−−−−−−−−KSYLSEKEVKPDP−−NKFEGWVNEETKVFDSKEK−−−−EAKELGVIDKDS−−−−−EIKGHIDEDN−−−−−−−−−−−LRITYFGR−−−−TAYIVAK−−−−−−−−−−−−NTT−−−−KESPADRDKRLAKERKIQAQKL−−−−−−−−−−−−−−−−−−−−−−−−−−AEKRKKEQ−−−−−−−−−−−−−−−−−−−−−−−EERAKE−−−−−−−EKQQAQSAPQN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSGR−−TITMRSTAYTSDPAENGGY−−−−−−STTAMGTAIRY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GVAAVDPRVIPLGTRLYIEG−−−−−−−YGYA−−RAEDTGGA−−IKGNR−−−−−I−−DLVFGSRSQ−−−−SNNWGRRTVRVTIL                                                       
fig|334413.6.peg.1437   Finegoldia magna ATCC 29328                                                                       SKIIEVLDQGDTVKVEKIG−−−−−−−−EIFAK−−−−−−−−−VSVTV−−−−−−−DSKNFVGFIY−−−−−−−−−KSYLSEKEVKPDP−−NKFEGWVNVETKVFDSKEK−−−−EAKELGLIDKDS−−−−−EIKGHIDEDN−−−−−−−−−−−LRITYFGR−−−−TAYIKAK−−−−−−−−−−−−NTT−−−−KESPKDRDARLAKERKIQAQKL−−−−−−−−−−−−−−−−−−−−−−−−−−AEKRKKEQ−−−−−−−−−−−−−−−−−−−−−−−EEKEK−−−−−−−−−−−QAQSAPKN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSGR−−TITMRSTAYTSDPSENGGY−−−−−−STTAMGTAIRY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GVAAVDPNVIPLGTRLYIEG−−−−−−−YGYA−−RAEDTGGA−−IKGNK−−−−−I−−DLVFGSKAQ−−−−SNRWGRRTVRVTIL                                                       
fig|563174.3.peg.1624   Listeria monocytogenes L99                             FITVVSILLIAAGIFTTIAMANANSVVVKAEVLNVRSGPGLAYDVTSQARKNEVLRVVGEE−−−−−−−−NQWYK−−−−−−−−−VQLDN−−−−−−−GNSGWVASWLVENTDVSAASNSVA−−−−−−−−−−−−−IVSSDGGLNVREKPST−−−−SSKSLGLLNNGD−−−−−QVTVTSQQNG−−−−−−−−−−WAQIQYNGT−−−−SAWVSSD−−−−−−−−−−−−YLT−−−−IRESVTKV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DESELQTVTIRDDSTNIRN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KPSRDGAVIEK−−−−−−−−−−−−−ANSGQGFA−−IQGVQGDWYKI−−−−−−−−−−−−−−−RTTSGEEGYVANWVVDVSDKGQTSSPRSKTTKLSEATIVIDPGHGGNDPGAKGANGTIEKEM         
fig|169963.1.peg.1513   Listeria monocytogenes EGD-e                             FITVVSILLIAAGIFTTIAMANANSVVVKAEVLNVRSGPGLAYDVTSQARKNEVLRVVGEE−−−−−−−−NQWYK−−−−−−−−−VQLDN−−−−−−−GNSGWVASWLVENTDVSAASNSVA−−−−−−−−−−−−−IVSSDGGLNVREKPST−−−−SSKSLGLLNNGD−−−−−QVTVTSQQNG−−−−−−−−−−WAQIQYNGT−−−−SAWVSSD−−−−−−−−−−−−YLT−−−−IRESVTKV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DESELQTVTIRDDSTNIRN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KPSRDGAVIEK−−−−−−−−−−−−−ANSGQGFA−−IQGVQGDWYKI−−−−−−−−−−−−−−−RTTSGEEGYVANWVVDVSDKGQTSSPRSKTTKLSEATIVIDPGHGGNDPGAKGANGTIEKEM         
fig|393127.4.peg.1816   Listeria monocytogenes Finland 1988                             FITVVSILLIAAGIFTTIAMANANSVVVKAEVLNVRSGPGLAYDVTSQARKNEVLRVVGEE−−−−−−−−NQWYK−−−−−−−−−VQLDN−−−−−−−GNSGWVASWLVENTDVSAASNSVA−−−−−−−−−−−−−IVSSDGGLNVREKPST−−−−SSKSLGLLNNGD−−−−−QVTVTSQQNG−−−−−−−−−−WAQIQYNGT−−−−SAWVSSD−−−−−−−−−−−−YLT−−−−IRESVTKV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DESELQTVTIRDDSTNIRN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KPSRDGAVIEK−−−−−−−−−−−−−ANSGQGFA−−IQGVQGDWYKI−−−−−−−−−−−−−−−RTTSGEEGYVANWVVDVSDKGQTSSPRSKTTKLSEATIVIDPGHGGNDPGAKGANGTIEKEM         
fig|393128.3.peg.1333   Listeria monocytogenes F6900                             FITVVSILLIAAGIFTTIAMANANSVVVKAEVLNVRSGPGLAYDVTSQARKNEVLRVVGEE−−−−−−−−NQWYK−−−−−−−−−VQLDN−−−−−−−GNSGWVASWLVENTDVSAASNSVA−−−−−−−−−−−−−IVSSDGGLNVREKPST−−−−SSKSLGLLNNGD−−−−−QVTVTSQQNG−−−−−−−−−−WAQIQYNGT−−−−SAWVSSD−−−−−−−−−−−−YLT−−−−IRESVTKV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DESELQTVTIRDDSTNIRN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KPSRDGAVIEK−−−−−−−−−−−−−ANSGQGFA−−IQGVQGDWYKI−−−−−−−−−−−−−−−RTTSGEEGYVANWVVDVSDKGQTSSPRSKTTKLSEATIVIDPGHGGNDPGAKGANGTIEKEM         
fig|393123.7.peg.2211   Listeria monocytogenes FSL N1-017                             FITVVSILLIAAGIFTTIAMANANSVVVKAEVLNVRSGPGLAYDVTSQARKNEVLRVVGEE−−−−−−−−NQWYK−−−−−−−−−VQLDN−−−−−−−GNSGWVASWLVENTDVSAASNSVA−−−−−−−−−−−−−IVSSDGGLNVREKPST−−−−SSKSLGLLNNGD−−−−−QVTVTSQQNG−−−−−−−−−−WAQIQYNGT−−−−SAWVSSD−−−−−−−−−−−−YLT−−−−IRESVTKV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DESELQTVTIRDDSTNIRN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KPSRDGAVIEK−−−−−−−−−−−−−ANSGQGFA−−IQGVQGDWYKI−−−−−−−−−−−−−−−RTTSGEEGYVANWVVDVSDKGQTSSSRSKTTKLSEATIVIDPGHGGNDPGAKGANGTIEKEM         
fig|393133.3.peg.1999   Listeria monocytogenes 10403S                             FITVVSILLIAAGIFTTIAMANANSVVVKAEVLNVRSGPGLAYDVTSQARKNEVLRVVGEE−−−−−−−−NQWYK−−−−−−−−−VQLDN−−−−−−−GNSGWVASWLVENTDVSAASNSVA−−−−−−−−−−−−−IVSSDGGLNVREKPST−−−−SSKSLGLLNNGD−−−−−QLTVTSQQNG−−−−−−−−−−WAQIQYNGT−−−−SAWVSSD−−−−−−−−−−−−YLT−−−−IRESVTKV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DESELQTVTIRDDSTNIRN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KPSRDGAVIEK−−−−−−−−−−−−−ANSGQGFA−−IQGVQGDWYKI−−−−−−−−−−−−−−−RTTSGEEGYVANWVVDVSDKGQTSSPRSKTTKLSEATIVIDPGHGGNDPGAKGANGTIEKEM         
fig|265669.1.peg.1525   Listeria monocytogenes str. 4b F2365                             FITVVSILLIAAGIFTTIAMANANSVVVKAEVLNVRSGPGLAYDVTSQARKNEVLRVVGEE−−−−−−−−NQWYK−−−−−−−−−VQLDN−−−−−−−GNSGWVASWLVENTDVSAASNSVA−−−−−−−−−−−−−IVSSDGGLNVREKPST−−−−SSKALGLLNNGD−−−−−QVTVTSQQNG−−−−−−−−−−WAQIQYNGT−−−−SAWVSSD−−−−−−−−−−−−YLT−−−−IRESVTKV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DESELQTVTIRDDSTNIRN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KPSRDGAVIEK−−−−−−−−−−−−−ANSGQGFA−−IQGVQGDWYKI−−−−−−−−−−−−−−−RTTSGEEGYVANWVVDVSDKGQTSSPRSKTTKLSEATIVIDPGHGGNDPGAKGSNGTIEKEM         
fig|401650.12.peg.678   Listeria monocytogenes HPB2262                             FITVVSILLIAAGIFTTIAMANANSVVVKAEVLNVRSGPGLAYDVTSQARKNEVLRVVGEE−−−−−−−−NQWYK−−−−−−−−−VQLDN−−−−−−−GNSGWVASWLVENTDVSAASNSVA−−−−−−−−−−−−−IVSSDGGLNVREKPST−−−−SSKALGLLNNGD−−−−−QVTVTSQQNG−−−−−−−−−−WAQIQYNGT−−−−SAWVSSD−−−−−−−−−−−−YLT−−−−IRESVTKV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DESELQTVTIRDDSTNIRN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KPSRDGAVIEK−−−−−−−−−−−−−ANSGQGFA−−IQGVQGDWYKI−−−−−−−−−−−−−−−RTTSGEEGYVANWVVDVSDKGQTSSPRSKTTKLSEATIVIDPGHGGNDPGAKGSNGTIEKEM         
fig|393125.3.peg.1912   Listeria monocytogenes FSL R2-503                             FITVVSILLIAAGIFTTIAMANANSVVVKA