(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020652

fig|553212.3.peg.2151   Staphylococcus capitis SK14          PKSGKPTASQVVDWAKWMAKNHKGVDID−−−GRYGFQCWDLPNYIFQRYWHFRTWGNANAMANRSQYPNRSWKIYRNTSSFVPKPGDIAVWTYG−−−−WAGHTAIVVGPSDKSHFKCVDQNWVGSNQWSGSRAAFVNHNYN−−−−−GNGGNIYFIRPPYKAEKNPP−−−−−−−−−KPSGGSDTSNTTTKDN−−−−−−NKTVTIKKKQTHIDFTIDDGEPTYPEFILHDIVQGKDRGHNPKKVTIRNANTMCSVLDLYFDREKYLTDKEYPHYFVDRNHIWQPRLEMYEVPSHPDNIVIEVCQDLSASKDDFIVNEIHTMLQTVFRMKYQGIPVKPSSIEVDTSNIWRSVYEHGDWDISINGLPPKKNIDKTINGLLYLYKNSKKLLSEIPKDKVKTKTIKVTVP−−−−−−−−−−−−−−−ASSVKKNTTTTTNKKGSKEPTVVISRSAYSFKRAVAIQMTKSPQINYGNGWYGASYSATLNAMNSLKIWNSKTQKYQMLNLGKYQGVSVSALNKILRGKGSLSGQGKAVAYACKKYNLNEIYLIAHAFLESGYGTSYFSSGRAGVYNYFGIGAYDWNPNYAITYARNRGWTTPAKGIIGGAKFVRQGFISKGQNTLYRMRWNPRHPGNHQYATDVRWAQVQATTIKNLYDKIGIKGVYFIRDRYK
fig|904725.3.peg.1667   Staphylococcus aureus subsp. aureus 21189     MGLPNPKNRKPTASEVVEWALYIAK−−NKIAIDVPGSGMGAQCWDLPNYLLDKYWGFRTWGNADAMAQKSNYRGRDFKIIRNTKDFVPQPGDWGVWTGG−−−−WAGHVNIVVGPCTKDYWYGVDQNWYTNNATGSPPYKIKHSYHDGPGGGVKY−−−FVRPPYHPDKT−−−−−−−−−−−TPA−−−−PKPEDDSDD−−NEKNNKKVPIWKDVTTIKYTISSQEVNYPEYIYHFIVEGNRRLEKPKGIMIRNAQTMSSVESLYNSRKKYKQDVEYPHFYVDRHNIWAPRRAVFEVPNEPDYIVIDVCEDYSASKNEFIFNEIHAMVVAVDMMAKYEIPLSIENLKVDDSIWRSMLEHVNWNMIDNGVPPKDKYEALEKALLNIFKNREKLLNSITKPTVTKSRIKVMVDNKNAD−−−−−−−−−IANVRDSSPTANNGSASKQPQIITETSPYTFKQALDKQMARGNPKKSNAWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSALNKILKGKGTLNNQGKAFAEACKKHNINEIYLIAHAFLESGYGTSNFANGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFTRDKYK
fig|418127.4.peg.834   Staphylococcus aureus subsp. aureus Mu3     MGLPNPKNRKPTASEVVEWALYIAK−−NKIAIDVPGSGMGAQCWDLPNYLLDKYWGFRTWGNADAMAQKSNYRGRDFKIIRNTKDFVPQPGDWGVWTGG−−−−WAGHVNIVVGPCTKDYWYGVDQNWYTNNATGSPPYKIKHSYHDGPGGGVKY−−−FVRPPYHPDKT−−−−−−−−−−−TPA−−−−PKPEDDSDD−−NEKNNKKVPIWKDVTTIKYTISSQEVNYPEYIYHFIVEGNRRLEKPKGIMIRNAQTMSSVESLYNSRKKYKQDVEYPHFYVDRHNIWAPRRAVFEVPNEPDYIVIDVCEDYSASKNEFIFNEIHAMVVAVDMMAKYEIPLSIENLKVDDSIWRSMLEHVNWNMIDNGVPPKDKYEALEKALLNIFKNREKLLNSITKPTVTKSRIKVMVDNKNAD−−−−−−−−−IANVRDSSPTANNGSASKQPQIITETSPYTFKQALDKQMARGNPKKSNAWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSALNKILKGKGTLNNQGKAFAEACKKHNINEIYLIAHAFLESGYGTSNFANGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQANTIAKLYKQIGLKGIYFTRDKYK
fig|387908.2.peg.62   Siphoviridae Staphylococcus aureus phage phiNM2     MGLPNPKNRKPTASEVVEWALYIAK−−NKIAIDVPGSGMGAQCWDLPNYLLDKYWGFRTWGNADAMAQKSNYRGRDFKIIRNTKDFVPQPGDWGVWTGG−−−−WAGHVNIVVGPCTKDYWYGVDQNWYTNNATGSPPYKIKHSYHDGPGGGVKY−−−FVRPPYHPDKT−−−−−−−−−−−TPA−−−−PKPEDDSDD−−NEKNNKKVPIWKDVTTIKYTISSQEVNYPEYIYHFIVEGNRRLEKPKGIMIRNAQTMSSVESLYNSRKKYKQDVEYPHFYVDRHNIWAPRRAVFEVPNEPDYIVIDVCEDYSASKNEFIFNEIHAMVVAVDMMAKYEIPLSIENLKVDDSIWRSMLEHVNWNMIDNGVPPKDKYEALEKALLNIFKNREKLLNSITKPTVTKSRIKVMVDNKNAD−−−−−−−−−IANVRDSSPTANNGSASKQPQIITETSPYTFKQALDKQMARGNPKKSNAWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSALNKILKGKGTLNNQGKAFAEACKKHSINEIYLIAHAFLESGYGTSNFANGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFTRDKYK
fig|1158487.3.peg.1092   Staphylococcus aureus M1321     MGLPNPKNRKPTASEVVEWALYIAK−−NKIAIDVPGSGMGAQCWDLPNYLLDKYWGFRTWGNADAMAQKSNYRGRDFKIIRNTKDFVPQPGDWGVWTGG−−−−WAGHVNIVVGPCTKDYWYGVDQNWYTNNATGSPPYKIKHSYHDGPGGGVKY−−−FVRPPYHPEKS−−−−−−−−−−−TPA−−−−PKPEDDSDD−−NEKNNKKVPIWKDVTTIKYTISSQEVNYPEYIYHFIVEGNRRLEKPKGIMIRNAQTMSSVESLYNSRKKYKQDVEYPHFYVDRHNIWAPRRAVFEVPNEPDYIVIDVCEDYSASKNEFIFNEIHAMVVAVDMMAKYEIPLSIENLKVDDSIWRSMLEHVNWNMIDNGVPPKDKYEALEKALLNIFKNREKLLNSITKPTVTKSRIKVMVDNKNAD−−−−−−−−−IANVRDSSPTANNGSASKQPQIITETSPYTFKQALDKQMARGNPKKSNAWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSALNKILKGKGTLNNQGKAFAEACKKHNINEIYLIAHAFLESGYGTSNFANGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFTRDKYK
fig|1158491.3.peg.1340   Staphylococcus aureus M1373     MGLPNPKNRKPTASEVVEWALYIAK−−NKIAIDVPGSGMGAQCWDLPNYLLDKYWGFRTWGNADAMAQKSNYRGRDFKIIRNTKDFVPQPGDWGVWTGG−−−−WAGHVNIVVGPCTKDYWYGVDQNWYTNNATGSPPYKIKHSYHDGPGGGVKY−−−FVRPPYHPEKS−−−−−−−−−−−TPA−−−−PKPEDDSDD−−NEKNNKKVPIWKDVTTIKYTISSQEVNYPEYIYHFIVEGNRRLEKPKGIMIRNAQTMSSVESLYNSRKKYKQDVEYPHFYVDRHNIWAPRRAVFEVPNEPDYIVIDVCEDYSASKNEFIFNEIHAMVVAVDMMAKYEIPLSIENLKVDDSIWRSMLEHVNWNMIDNGVPPKDKYEALEKALLNIFKNREKLLNSITKPTVTKSRIKVMVDNKNAD−−−−−−−−−IANVRDSSPTANNGSASKQPQIITETSPYTFKQALDKQMARGNPKKSNAWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSALNKILKGKGTLNNQGKAFAEACKKHNINEIYLIAHAFLESGYGTSNFANGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFTRDKYK
fig|553594.3.peg.32   Staphylococcus aureus A9765     MGLPNPKNRKPTASEVVEWALYIAK−−NKIAIDVPGSGMGAQCWDLPNYLLDKYWGFRTWGNADAMAQKSNYRGRDFKIIRNTKDFVPQPGDWGVWTGG−−−−WAGHVNIVVGPCTKDYWYGVDQNWYTNNATGSPPYKIKHSYHDGPGGGVKY−−−FVRPPYHPEKS−−−−−−−−−−−TPA−−−−PKPEDDSDD−−NEKNNKKVPIWKDVTTIKYTISSQEVNYPEYIYHFIVEGNRRLEKPKGIMIRNAQTMSSVESLYNSRKKYKQDVEYPHFYVDRHNIWAPRRAVFEVPNEPDYIVIDVCEDYSASKNEFIFNEIHAMVVAVDMMAKYEIPLSIENLKVDDSIWRSMLEHVNWNMIDNGVPPKDKYEALEKALLNIFKNREKLLNSITKPTVTKSRIKVMVDNKNAD−−−−−−−−−IANVRDSSPTANNGSASKQPQIITETSPYTFKQALDKQMARGNPKKSNAWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSALNKILKGKGTLNNQGKAFAEACKKHNINEIYLIAHAFLESGYGTSNFANGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFTRDKYK
fig|931450.3.peg.1453   Staphylococcus aureus subsp. aureus CIG2018     MGLPNPKNRKPTASEVVEWALYIAK−−NKIAIDVPGSGMGAQCWDLPNYLLDKYWGFRTWGNADAMAQKSNYRGRDFKIIRNTKDFVPQPGDWGVWTGG−−−−WAGHVNIVVGPCTKDYWYGVDQNWYTNNATGSPPYKIKHSYHDGPGGGVKY−−−FVRPPYHPEKS−−−−−−−−−−−TPA−−−−PKPEDDSDD−−NEKNNKKVPIWKDVTTIKYTISSQEVNYPEYIYHFIVEGNRRLEKPKGIMIRNAQTMSSVESLYNSRKKYKQDVEYPHFYVDRHNIWAPRRAVFEVPNEPDYIVIDVCEDYSASKNEFIFNEIHAMVVAVDMMAKYEIPLSIENLKVDDSIWRSMLEHVNWNMIDNGVPPKDKYEALEKALLNIFKNREKLLNSITKPTVTKSRIKVMVDNKNAD−−−−−−−−−IANVRDSSPTANNGSASKQPQIITETSPYTFKQALDKQMARGNPKKSNAWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSALNKILKGKGTLNNQGKAFAEACKKHNINEIYLIAHAFLESGYGTSNFANGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFTRDKYK
fig|1123523.3.peg.618   Staphylococcus aureus subsp. aureus 11819-97     MGLPNPKNRKPTASEVVEWALYIAK−−NKIAIDVPGSGMGAQCWDLPNYLLDKYWGFRTWGNADAMAQKSNYRGRDFKIIRNTKDFVPQPGDWGVWTGG−−−−WAGHVNIVVGPCTKDYWYGVDQNWYTNNATGSPPYKIKHSYHDGPGGGVKY−−−FVRPPYHPEKS−−−−−−−−−−−TPA−−−−PKPEDDSDD−−NEKNNKKVPIWKDVTTIKYTISSQEVNYPEYIYHFIVEGNRRLEKPKGIMIRNAQTMSSVESLYNSRKKYKQDVEYPHFYVDRHNIWAPRRAVFEVPNEPDYIVIDVCEDYSASKNEFIFNEIHAMVVAVDMMAKYEIPLSIENLKVDDSIWRSMLEHVNWNMIDNGVPPKDKYEALEKALLNIFKNREKLLNSITKPTVTKSRIKVMVDNKNAD−−−−−−−−−IANVRDSSPTANNGSASKQPQIITETSPYTFKQALDKQMARGNPKKSNAWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSSLNKILKGKGTLNNQGKAFAEACKKHNINEIYLIAHAFLESGYGTSNFANGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFIRDKYK
fig|1157039.3.peg.766   Staphylococcus aureus B147830     MGLPNPKNRKPTASEVVEWALYIAK−−NKIAIDVPGSGMGAQCWDLPNYLLDKYWGFRTWGNADAMAQKSNYRGRDFKIIRNTKDFVPQPGDWGVWTGG−−−−WAGHVNIVVGPCTKDYWYGVDQNWYTNNATGSPPYKIKHSYHDGPGGGVKY−−−FVRPPYHPEKS−−−−−−−−−−−TPA−−−−PKPEDDSDD−−NEKNNKKVPIWKDVTTIKYTISSQEVNYPEYIYHFIVEGNRRLEKPKGIMIRNAQTMSSVESLYNSRKKYKQDVEYPHFYVDRHNIWAPRRAVFEVPNEPDYIVIDVCEDYSASKNEFIFNEIHAMVVAVDMMAKYEIPLSIENLKVDDSIWRSMLEHVNWNMIDNGVPPKDKYEALEKALLNIFKNREKLLNSITKPTVTKSRIKVMVDNKNAD−−−−−−−−−IANVRDSSPTANNGSASKQPQIITETSPYTFKQALDKQMARGNPKKSNAWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSSLNKILKGKGTLNNQGKAFAEACKKHNINEIYLIAHAFLESGYGTSNFANGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFIRDKYK
fig|1157039.3.peg.786   Staphylococcus aureus B147830     MGLPNPKNRKPTASEVVEWALYIAK−−NKIAIDVPGSGMGAQCWDLPNYLLDKYWGFRTWGNADAMAQKSNYRGRDFKIIRNTKDFVPQPGDWGVWTGG−−−−WAGHVNIVVGPCTKDYWYGVDQNWYTNNATGSPPYKIKHSYHDGPGGGVKY−−−FVRPPYHPEKS−−−−−−−−−−−TPA−−−−PKPEDDSDD−−NEKNNKKVPIWKDVTTIKYTISSQEVNYPEYIYHFIVEGNRRLEKPKGIMIRNAQTMSSVESLYNSRKKYKQDVEYPHFYVDRHNIWAPRRAVFEVPNEPDYIVIDVCEDYSASKNEFIFNEIHAMVVAVDMMAKYEIPLSIENLKVDDSIWRSMLEHVNWNMIDNGVPPKDKYEALEKALLNIFKNREKLLNSITKPTVTKSRIKVMVDNKNAD−−−−−−−−−IANVRDSSPTANNGSASKQPQIITETSPYTFKQALDKQMARGNPKKSNAWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSSLNKILKGKGTLNNQGKAFAEACKKHNINEIYLIAHAFLESGYGTSNFANGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFIRDKYK
fig|1157039.3.peg.828   Staphylococcus aureus B147830     MGLPNPKNRKPTASEVVEWALYIAK−−NKIAIDVPGSGMGAQCWDLPNYLLDKYWGFRTWGNADAMAQKSNYRGRDFKIIRNTKDFVPQPGDWGVWTGG−−−−WAGHVNIVVGPCTKDYWYGVDQNWYTNNATGSPPYKIKHSYHDGPGGGVKY−−−FVRPPYHPEKS−−−−−−−−−−−TPA−−−−PKPEDDSDD−−NEKNNKKVPIWKDVTTIKYTISSQEVNYPEYIYHFIVEGNRRLEKPKGIMIRNAQTMSSVESLYNSRKKYKQDVEYPHFYVDRHNIWAPRRAVFEVPNEPDYIVIDVCEDYSASKNEFIFNEIHAMVVAVDMMAKYEIPLSIENLKVDDSIWRSMLEHVNWNMIDNGVPPKDKYEALEKALLNIFKNREKLLNSITKPTVTKSRIKVMVDNKNAD−−−−−−−−−IANVRDSSPTANNGSASKQPQIITETSPYTFKQALDKQMARGNPKKSNAWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSSLNKILKGKGTLNNQGKAFAEACKKHNINEIYLIAHAFLESGYGTSNFANGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFIRDKYK
fig|1158487.3.peg.824   Staphylococcus aureus M1321     MGLPNPKNRKPTASEVVEWALYIAK−−NKIAIDVPGSGMGAQCWDLPNYLLDKYWGFRTWGNADAMAQKSNYRGRDFKIIRNTKDFVPQPGDWGVWTGG−−−−WAGHVNIVVGPCTKDYWYGVDQNWYTNNATGSPPYKIKHSYHDGPGGGVKY−−−FVRPPYHPEKS−−−−−−−−−−−TPA−−−−PKPEDDSDD−−NEKNNKKVPIWKDVTTIKYTISSQEVNYPEYIYHFIVEGNRRLEKPKGIMIRNAQTMSSVESLYNSRKKYKQDVEYPHFYVDRHNIWAPRRAVFEVPNEPDYIVIDVCEDYSASKNEFIFNEIHAMVVAVDMMAKYEIPLSIENLKVDDSIWRSMLEHVNWNMIDNGVPPKDKYEALEKALLNIFKNREKLLNSITKPTVTKSRIKVMVDNKNAD−−−−−−−−−IANVRDSSPTANNGSASKQPQIITETSPYTFKQALDKQMARGNPKKSNAWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSSLNKILKGKGTLNNQGKAFAEACKKHNINEIYLIAHAFLESGYGTSNFANGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFIRDKYK
fig|1158507.3.peg.1883   Staphylococcus aureus M0006     MGLPNPKNRKPTASEVVEWALYIAK−−NKIAIDVPGSGMGAQCWDLPNYLLDKYWGFRTWGNADAMAQKSNYRGRDFKIIRNTKDFVPQPGDWGVWTGG−−−−WAGHVNIVVGPCTKDYWYGVDQNWYTNNATGSPPYKIKHSYHDGPGGGVKY−−−FVRPPYHPEKS−−−−−−−−−−−TPA−−−−PKPEDDSDD−−NEKNNKKVPIWKDVTTIKYTISSQEVNYPEYIYHFIVEGNRRLEKPKGIMIRNAQTMSSVESLYNSRKKYKQDVEYPHFYVDRHNIWAPRRAVFEVPNEPDYIVIDVCEDYSASKNEFIFNEIHAMVVAVDMMAKYEIPLSIENLKVDDSIWRSMLEHVNWNMIDNGVPPKDKYEALEKALLNIFKNREKLLNSITKPTVTKSRIKVMVDNKNAD−−−−−−−−−IANVRDSSPTANNGSASKQPQIITETSPYTFKQALDKQMARGNPKKSNAWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSSLNKILKGKGTLNNQGKAFAEACKKHNINEIYLIAHAFLESGYGTSNFANGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFIRDKYK
fig|1158533.3.peg.372   Staphylococcus aureus M0510     MGLPNPKNRKPTASEVVEWALYIAK−−NKIAIDVPGSGMGAQCWDLPNYLLDKYWGFRTWGNADAMAQKSNYRGRDFKIIRNTKDFVPQPGDWGVWTGG−−−−WAGHVNIVVGPCTKDYWYGVDQNWYTNNATGSPPYKIKHSYHDGPGGGVKY−−−FVRPPYHPEKS−−−−−−−−−−−TPA−−−−PKPEDDSDD−−NEKNNKKVPIWKDVTTIKYTISSQEVNYPEYIYHFIVEGNRRLEKPKGIMIRNAQTMSSVESLYNSRKKYKQDVEYPHFYVDRHNIWAPRRAVFEVPNEPDYIVIDVCEDYSASKNEFIFNEIHAMVVAVDMMAKYEIPLSIENLKVDDSIWRSMLEHVNWNMIDNGVPPKDKYEALEKALLNIFKNREKLLNSITKPTVTKSRIKVMVDNKNAD−−−−−−−−−IANVRDSSPTANNGSASKQPQIITETSPYTFKQALDKQMARGNPKKSNAWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSSLNKILKGKGTLNNQGKAFAEACKKHNINEIYLIAHAFLESGYGTSNFANGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFIRDKYK
fig|359786.3.peg.2136   Staphylococcus aureus subsp. aureus JH9     MGLPNPKNRKPTASEVVEWALYIAK−−NKIAIDVPGSGMGAQCWDLPNYLLDKYWGFRTWGNADAMAQKSNYRGRDFKIIRNTKDFVPQPGDWGVWTGG−−−−WAGHVNIVVGPCTKDYWYGVDQNWYTNNATGSPPYKIKHSYHDGPGGGVKY−−−FVRPPYHPEKS−−−−−−−−−−−TPA−−−−PKPEDDSDD−−NEKNNKKVPIWKDVTTIKYTISSQEVNYPEYIYHFIVEGNRRLEKPKGIMIRNAQTMSSVESLYNSRKKYKQDVEYPHFYVDRHNIWAPRRAVFEVPNEPDYIVIDVCEDYSASKNEFIFNEIHAMVVAVDMMAKYEIPLSIENLKVDDSIWRSMLEHVNWNMIDNGVPPKDKYEALEKALLNIFKNREKLLNSITKPTVTKSRIKVMVDNKNAD−−−−−−−−−IANVRDSSPTANNGSASKQPQIITETSPYTFKQALDKQMARGNPKKSNAWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSSLNKILKGKGTLNNQGKAFAEACKKHNINEIYLIAHAFLESGYGTSNFANGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFIRDKYK
fig|553580.3.peg.2871   Staphylococcus aureus A8819     MGLPNPKNRKPTASEVVEWALYIAK−−NKIAIDVPGSGMGAQCWDLPNYLLDKYWGFRTWGNADAMAQKSNYRGRDFKIIRNTKDFVPQPGDWGVWTGG−−−−WAGHVNIVVGPCTKDYWYGVDQNWYTNNATGSPPYKIKHSYHDGPGGGVKY−−−FVRPPYHPEKS−−−−−−−−−−−TPA−−−−PKPEDDSDD−−NEKNNKKVPIWKDVTTIKYTISSQEVNYPEYIYHFIVEGNRRLEKPKGIMIRNAQTMSSVESLYNSRKKYKQDVEYPHFYVDRHNIWAPRRAVFEVPNEPDYIVIDVCEDYSASKNEFIFNEIHAMVVAVDMMAKYEIPLSIENLKVDDSIWRSMLEHVNWNMIDNGVPPKDKYEALEKALLNIFKNREKLLNSITKPTVTKSRIKVMVDNKNAD−−−−−−−−−IANVRDSSPTANNGSASKQPQIITETSPYTFKQALDKQMARGNPKKSNAWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSSLNKILKGKGTLNNQGKAFAEACKKHNINEIYLIAHAFLESGYGTSNFANGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFIRDKYK
fig|931456.3.peg.1867   Staphylococcus aureus subsp. aureus CIGC341D     MGLPNPKNRKPTASEVVEWALYIAK−−NKIAIDVPGSGMGAQCWDLPNYLLDKYWGFRTWGNADAMAQKSNYRGRDFKIIRNTKDFVPQPGDWGVWTGG−−−−WAGHVNIVVGPCTKDYWYGVDQNWYTNNATGSPPYKIKHSYHDGPGGGVKY−−−FVRPPYHPEKS−−−−−−−−−−−TPA−−−−PKPEDDSDD−−NEKNNKKVPIWKDVTTIKYTISSQEVNYPEYIYHFIVEGNRRLEKPKGIMIRNAQTMSSVESLYNSRKKYKQDVEYPHFYVDRHNIWAPRRAVFEVPNEPDYIVIDVCEDYSASKNEFIFNEIHAMVVAVDMMAKYEIPLSIENLKVDDSIWRSMLEHVNWNMIDNGVPPKDKYEALEKALLNIFKNREKLLNSITKPTVTKSRIKVMVDNKNAD−−−−−−−−−IANVRDSSPTANNGSASKQPQIITETSPYTFKQALDKQMARGNPKKSNAWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSSLNKILKGKGTLNNQGKAFAEACKKHNINEIYLIAHAFLESGYGTSNFANGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFIRDKYK
fig|387910.2.peg.64   Siphoviridae Staphylococcus aureus phage phiNM4     MGLPNPKNRKPTASEVVEWALYIAK−−NKIAIDVPGSGMGAQCWDLPNYLLDKYWGFRTWGNADAMAQKSNYRGRDFKIIRNTKDFVPQPGDWGVWTGG−−−−WAGHVNIVVGPCTKDYWYGVDQNWYTNNATGSPPYKIKHSYHDGPGGGVKY−−−FVRPPYHPEKS−−−−−−−−−−−TPA−−−−PKPEDDSDD−−NEKNNKKVPIWKDVTTIKYTISSQEVNYPEYIYHFIVEGNRRLEKPKGIMIRNAQTMSSVESLYNSRKKYKQDVEYPHFYVDRHNIWAPRRAVFEVPNEPDYIVIDVCEDYSASKNEFIFNEIHAMVVAVDMMAKYEIPLSIENLKVDDSIWRSMLEHVNWNMIDNGVPPKDKYEALEKALLNIFKNREKLLNSITKPTVTKSRIKVMVDNKNAD−−−−−−−−−IANVRDSSPTANNGSASKQPQIITETSPYTFKQALDKQMARGNPKKSNAWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSSLNKILKGKGTLNNQGKAFAEACKKHNINEIYLIAHAFLESGYGTSNFANGKDGVYNYFGIGAYDNNPNYAMKFAKNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFIRDKYK
fig|553573.3.peg.64   Staphylococcus aureus A8115     MGLPNPKNRKPTASEVVEWALYIAK−−NKIAIDVPGSGMGAQCWDLPNYLLDKYWGFRTWGNADAMAQKSNYRGRDFKIIRNTKDFVPQPGDWGVWTGG−−−−WAGHVNIVVGPCTKDYWYGVDQNWYTNNATGSPPYKIKHSYHDGPGGGVKY−−−FVRPPYHPEKS−−−−−−−−−−−TPA−−−−PKPEDDSDD−−NEKNNKKVPIWKDVTTIKYTISSQEVNYPEYIYHFIVEGNRRLEKPKGIMIRNAQTMSSVESLYNSRKKYKQDVEYPHFYVDRHNIWAPRRAVFEVPNEPDYIVIDVCEDYSASKNEFIFNEIHAMVVAVDMMGKYEIPLSIENLKVDDSIWRSMLEHVNWNMIDNGVPPKDKYEALEKALLNIFKNREKLLNSITKPTVTKSRIKVMVDNKNAD−−−−−−−−−IANVRDSSPTANNGSASKQPQIITETSPYTFKQALDKQMARGNPKKSNAWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSSLNKILKGKGTLNNQGKAFAEACKKHNINEIYLIAHAFLESGYGTSNFANGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFIRDKYK
fig|904739.3.peg.2347   Staphylococcus aureus subsp. aureus 21236     MGLPNPKNRKPTASEVVEWALYIAK−−NKIAIDVPGSGMGAQCWDLPNYLLDKYWGFRTWGNADAMAQKSNYRGRDFKIIRNTKDFVPQPGDWGVWTGG−−−−WAGHVNIVVGPCTKDYWYGVDQNWYTNNATGSPPYKIKHSYHDGPGGGVKY−−−FVRPPYHPEKS−−−−−−−−−−−TPA−−−−PKPEDDSDD−−NEKNNKKVPIWKDVTTIKYTISSQEVNYPEYIYHFIVEGNRRLEKPKGIMIRNAQTMSSVESLYNSRKKYKQDVEYPHFYVDRHNIWAPRRAVFEVPNEPDYIVIDVCEDYSASKNEFIFNEIHAMVVAVDMMGKYEIPLSIENLKVDDSIWRSMLEHVNWNMIDNGVPPKDKYEALEKALLNIFKNREKLLNSITKPTVTKSRIKVMVDNKNAD−−−−−−−−−IANVRDSSPTANNGSASKQPQIITETSPYTFKQALDKQMARGNPKKSNAWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSSLNKILKGKGTLNNQGKAFAEACKKHNINEIYLIAHAFLESGYGTSNFANGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFIRDKYK
fig|585151.3.peg.1502   Staphylococcus aureus subsp. aureus C427     MGLPNPKTRKPTASEVVEWALYIAK−−NKIAIDVPGSGMGAQCWDLANYLLDKYWGFRTWGNADAMAQKSNYRGRDFKIIRNTKDFVPQPGDWGVWTGG−−−−WAGHVNIVVGPCTKDYWYGVDQNWYTNNATGSPPYKIKHSYHDGPGGGVKY−−−FVRPPYHPEKS−−−−−−−−−−−TPA−−−−PKPEDDSDD−−NEKNNKKVPIWKDVTTIKYTISSQEVNYPEYIYHFIVEGNRRLEKPKGIMIRNAQTMSSVENLYNSRKKYKQDVEYPHFYVDRHNIWAPRRAVFEVPNEPDYIVIDVCEDYSASKNEFIFNEIHAMVVAVDMMAKYEIPLSIENLKVDDSIWRSMLEHVNWNMIDNGVAPKDKYEALEKALLNIFKNREKLLNSITKPTVTKSRIKVMVDNKNAD−−−−−−−−−IANVRDSSPTANNGSASKQPQIITETSPYTFKQALDKQMARGNPKKSNAWGWANATRAQTGSAMNVKRIWESNTQCYQMLNLGKYQGVSVSSLNKILKGKGTLNNQGKAFAEACKKHNINEIYLIAHAFLESGYGTSNFANGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKKIGLKGIYFIRDKYK
fig|585152.3.peg.1779   Staphylococcus aureus subsp. aureus D139     MGLPNPKTRKPTASEVVEWALYIAK−−KKIAIDVPGSGMGAQCWDLPNYLLDKYWGFRTWGNADAMAQKSNYRGRDFKIIRNTKDFVPQPGDWGVWTGG−−−−WAGHVNIVVGPCTKDYWYGVDQNWYTNNATGSPPYKIKHSYHDGPGGGVKY−−−FVRPPYHPEKS−−−−−−−−−−−TPA−−−−PKPEDDSDN−−NEKNNKKVPIWKDVTTIKYTISSQEVNYPEYIYHFIVEGNRRLEKPKGIMIRNAQTMSSVENLYNSRKKYKQDVEYPHFYVDRHNIWAPRRAVFEVPNEPDYIVIDVCEDYSASKNEFIFNEIHAMVVAVDMMIKYEIPLSIENLKVDDSIWRSMLEHVNWNMIDNGVPPKDKYEALEKALLNIFKNREKLLNSITKPTVTKSRIKVMVDNKNAD−−−−−−−−−IANVRDSSPTANNGSASKQPQIITETSPYTFKQALDKQMARGNPKKSNAWGWANATRAQTGSAMNVKRIWESNTQCYQMLNLGKYQGVSVSSLNKILKGKGTLNNQGKAFAEACKKHSINEIYLIAHAFLESGYGTSNFANGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFTRDKYK
fig|273036.3.peg.1649   Staphylococcus aureus RF122     MGLPNPKTRKPTASEVVEWALYMAK−−NRRVIDVDRAYGGQCWDVPNYILERYWGFRTWGNANAMAQKSNYRGRDFKIYRNTASFTPKPGDWAVWANR−−−−NPGHVAIVVGPADKNAFVSVDQNWYTANWSGSPPYKIKHTYHDGPGGVTH−−−FVRPPYHPDKT−−−−−−−−−−−TPAPQPVPKPKDDSDD−−KEKNNKKVPIWKDVKTIKYTISSQEVNYPEYIYHFIVEGNRRLEKPKGIMIRNAQTMSSVENLYNSRKKYKQDVEYPHFYVDRHNIWAPRRAVFEVPNEPDYIVIDVCEDYSASKNEFIFNEIYAMGVAVDMMVEYEIPLSIENLKVDDSIWRSMLEHVNWNMIDNGVPPKDKYEALEKALLNIFKNREKLLNSITKPTVTKSRIKVMVDNKNAD−−−−−−−−−IANVRDSSPTANNGSASKQPQIITETSPYTFKQALDRQMSRGNPKKSHTWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSSLNKILKGKGTLNNQGKAFAEACKKHNINEIYLIAHAFLESGYGTSNFASGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFTRDKYK
fig|273036.6.peg.1807   Staphylococcus aureus RF122     MGLPNPKTRKPTASEVVEWALYMAK−−NRRVIDVDRAYGGQCWDVPNYILERYWGFRTWGNANAMAQKSNYRGRDFKIYRNTASFTPKPGDWAVWANR−−−−NPGHVAIVVGPADKNAFVSVDQNWYTANWSGSPPYKIKHTYHDGPGGVTH−−−FVRPPYHPDKT−−−−−−−−−−−TPAPQPVPKPKDDSDD−−KEKNNKKVPIWKDVKTIKYTISSQEVNYPEYIYHFIVEGNRRLEKPKGIMIRNAQTMSSVENLYNSRKKYKQDVEYPHFYVDRHNIWAPRRAVFEVPNEPDYIVIDVCEDYSASKNEFIFNEIYAMGVAVDMMVEYEIPLSIENLKVDDSIWRSMLEHVNWNMIDNGVPPKDKYEALEKALLNIFKNREKLLNSITKPTVTKSRIKVMVDNKNAD−−−−−−−−−IANVRDSSPTANNGSASKQPQIITETSPYTFKQALDRQMSRGNPKKSHTWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSSLNKILKGKGTLNNQGKAFAEACKKHNINEIYLIAHAFLESGYGTSNFASGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFTRDKYK
fig|525375.3.peg.1953   Staphylococcus epidermidis M23864:W2(grey)     MGLPSPKKRKPTASEVAAWARSMIG−−RRVDVD−−−GYYGAQCWDLPNYIFNRYWRFRTTGNAIAMAWYRYPKGFKFYRNTRNFVPKPGDMAVWGKGSFNNGVGHTAVVIGPSTKSYFTSVDQNWIGANSYTGSPGAKIKHSYN−−−−−GISG−−−FVRPPYHAETK−−−−−−−−−−−KPSKASSTPSKPSSDNTPKNTKEQTKPIIKEVTKVSYTSFAYDLDDKLEYIYHYMVEGQKSIGKVKGIYIKESTHMRSVEELYLQRNKYVNEDEYPHVYIDRERVWTPRPDSEEAPEHPGWLVMEVCGGQTESKRQFMLNQIRALIYGVWLLSWSKIKLSESSIKADPNIWRSMKDLINYDLIKNGIPDESKYKEVEKKIIGLYLNRDKLQTETITTTTTKMKIKVKGKTSVDNPTQNNTTSKDGKSVSK−−−−−−TPTKPRVVVEKSKYTFQQALNAQMAHGMPQKSYSWGWGNASRSQTSKYMNPTTIWNSSTQRYQMLDLGKYQGISVSKLNKILKGKGTLSGQGKAFADGCKKYNVNEIYLIAHAFLESGYGRSNYASGRYGIYNYFGISAYDNNPDASIAYARRQGWTSPRNGIIGGAKFVRKQYFNKGKNTLYRMRWNPKNPGYMQYATAIEWCNFQATTISSLYKKVGLKGMYYIRDKYR
fig|525374.3.peg.1020   Staphylococcus epidermidis BCM-HMP0060                                                WDLPNYIFNRYWHFKTTGNAIAMAWYRYPRGFKFYRNTRNFVPKPGDMAVWGKGSYNNGTGHTAVVVGPSNKSYFTSVDQNWRNSNGYTGSPGSLEKHTYY−−−−−GISG−−−FVRPPYHAETK−−−−−−−−−−−KPSKSSNTPSKPSNDNTPKNKKEQTKPITKEVTKVSYTSFAYDLDDDLEYIYHYMVEGQKLIGKVKGIYIKESTHMRSVEELYLQRNKYVNEDEYPHVYIDRERVWTPRPDSEEAPEHPGWLVMEVCGGQTESKRQFMLNQIRALIYGVWLLSWSKVKLSESSIKADPNIWRSMKDLINYDLIKNGIPDESKYKEVEKKIIGLYLKRDKLLTETITTTTTKTTIKIKPKTSVDNPEQNDKPTDKKSKTTNR−−−−−−TSNKPRVVVEKSKYTFQQALNAQMAHGMPQKSYSWGWGNASRSQTSKYMNPNTIWNSSVQRYQMLDLGKYQGIPVSKLNKILKGKGTLSGQGKAFADGCKKYNVNEIYLIAHAFLESGYGRSNFASGRYGIYNYFGIAAYDNNPNASIAYARRQGWTSPRNGIIGGAKFVRKQFFNQGKNTLYRMRWNPKNPGRMQYATAIEWCNFQATTINSLYKKVGLKGMYYIRDKYR
fig|279808.3.peg.1856   Staphylococcus haemolyticus JCSC1435     MGLPDPKKRKPTASEVAAWARSRIG−−KRLDID−−−GRGGAQCWDLPNYIFGRYWNFWCNGNAIHMAWYRYPRGFKFYRNTASFVPEPGDMAVWGTGSFNNGVGHTAVVVGPSNRNYFTSVDQNWRNANGYTGSPGSLEKHSYY−−−−−GISG−−−FVRPAYQAETKPKPKPKPKPDEKPTKPVVVPSTSPTPD−−KNTTEQTKPTTKKVKKVQYTDFLYSLDKDLEYNDHLIVDDGNLMTKPKGIYIKECPHLRDVEELYLQRNRFVRKDEYPHVYIDREQIWTPRPPDTEAPSHPGWLVLEVCGAQTESKRQFMLNQLQALIYGVWLMSWSKIKLSESTIKADPNIWRSMKDLIDYDMIKNGIPDESKYKEVESKIIEMYLKKDKLLKEKIVTTTSTKIIKIKSDKEAKTTKPTITTPSTSKSKKTTPP−−−−−−KQTKAKVTVEKSGFTFTQALNLQMSRGYPQKSNGYSWYFPSRSAVSAAMNPTSIWNSASQRYQMLNLGKYQGISVSKLNVILKGRGTLSGQGKAFADGCKKYNINEIYLIAHALLESGNGTSNFASGRYGVYNYFGIGAYDNNPNNAIPFARGRGWTTPAKAIIGGAKFVRQDYINKGQNTLYRMRWNPKNPATHQYATDIRWCEHQASTIYSYYKKIGLKGLYFIQDKYK
fig|585155.3.peg.2409   Staphylococcus aureus subsp. aureus H19     MGLPNPKTRKPTASEVVEWAKSNIG−−KRINID−−−NYRGSQCWDTPNFIFKRYWGFVTWGNAKDMANYRYPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWTGSPGRLVRHPYV−−−−−SVTG−−−FVRPPYSKDIS−−−−−−−−−−−KPSSTDTSSASKANDS−−TITGEAKKPQFKEVKTVKYTAYSNVLDKEEHFIDHIVVMGDERSDIQGLYIKESMHMRSVDELYTQRNKFISDYEIPHLYVDREATWLARPTNFDDPRHPNWLVIEVCGGQTDSKRQFLMNQIQALIRGVWLLSGIDKELSETTLKVDPNIWRSMKDLINYDLIKQGIPDNAKYEQVKKKMLEMYIKRDILTRENIKEVTTKTSIRISDKTSVD−−−−−−−−−SASTRGPTP−−−−−−SDKKPSIVTEKSPFTFQQALDRQMSRGNPKKSHTWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGISVSALNKILKGKGTLDGQGKAFAEACKKNNINEIYLIAHAFLESGYGTSNFASGRYGAYNYFGIGAFDNDPDYAMTFAKNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFTRDKYK
fig|931456.3.peg.1723   Staphylococcus aureus subsp. aureus CIGC341D     MGLPNPKTRKPTASEVVEWAKSNIG−−KRINID−−−NYRGSQCWDTPNFIFKRYWGFVTWGNAKDMANYRYPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWTGSPGRLVRHPYV−−−−−SVTG−−−FVRPPYSKDTS−−−−−−−−−−−KPSSTDTSSASKANDS−−TITGEAKKPQFKEVKTVKYTAYSNVLDKEEHFIDHIVVMGDERSDIQGLYIKESMHMRSVDELYTQRNKFISDYEIPHLYVDREATWLARPTNFDDPRHPNWLVIEVCGGQTDSKRQFLMNQIQALIRGVWLLSGIDKELSETTLKVDPNIWRSMKDLINYDLIKQGIPDNAKYEQVKKKMLEMYIKRDILTRENIKEVTTKTSIRISDKTSVD−−−−−−−−−SASTRGPTP−−−−−−SDKKPSIVTEKSPFTFQQALDRQMSRGNPKKSHTWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGISVSALNKILKGKGTLDGQGKAFAEACKKNNINEIYLIAHAFLESGYGTSNFASGRYGAYNYFGIGAFDNDPDYAMKFAKNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFIRDKYK
fig|1158507.3.peg.1882   Staphylococcus aureus M0006     MGLPNPKTRKPTASEVVEWAKSNIG−−KRINID−−−NYRGSQCWDTPNFIFKRYWGFVTWGNAKDMANYRYPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWTGSPGRLVRHPYV−−−−−SVTG−−−FVRPPYSKDTS−−−−−−−−−−−KPSSTDTSSASKANDS−−TITGEAKKPQFKEVKTVKYTAYSNVLDKEEHFIDHIVVMGDERSDIQGLYIKESMHMRSVDELYTQRNKFISDYEIPHLYVDREATWLARPTNFDDPRHPNWLVIEVCGGQTDSKRQFLLNQIQALIRGVWLLSGIDKNLSETTLKVDPNIWRSMKDLINYDLIKQGIPDNAKYEQVKKKMLETYIKRDILTRENIKEVTTKTTIRISDKTSVD−−−−−−−−−SASTRGPTP−−−−−−SDEKPSIVTETSPFTFQQALDRQMSRGNPKKSHTWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGISVSALNKILKGKGTLDGQGKAFAEACKKNNINEIYLIAHAFLESGYGTSNFANGRYGAYNYFGIGAFDNDPDYAMTFAKNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFTRDKYK
fig|553580.3.peg.2877   Staphylococcus aureus A8819     MGLPNPKTRKPTASEVVEWAKSNIG−−KRINID−−−NYRGSQCWDTPNFIFKRYWGFVTWGNAKDMANYRYPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWTGSPGRLVRHPYV−−−−−SVTG−−−FVRPPYSKDTS−−−−−−−−−−−KPSSTDTSSASKANDS−−TITGEAKKPQFKEVKTVKYTAYSNVLDKEEHFIDHIVVMGDERSDIQGLYIKESMHMRSVDELYTQRNKFISDYEIPHLYVDREATWLARPTNFDDPRHPNWLVIEVCGGQTDSKRQFLLNQIQALIRGVWLLSGIDKNLSETTLKVDPNIWRSMKDLINYDLIKQGIPDNAKYEQVKKKMLETYIKRDILTRENIKEVTTKTTIRISDKTSVD−−−−−−−−−SASTRGPTP−−−−−−SDEKPSIVTETSPFTFQQALDRQMSRGNPKKSHTWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGISVSALNKILKGKGTLDGQGKAFAEACKKNNINEIYLIAHAFLESGYGTSNFANGRYGAYNYFGIGAFDNDPDYAMTFAKNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFTRDKYK
fig|546342.3.peg.722   Staphylococcus aureus subsp. aureus str. JKD6008     MGLPNPKTRKPTASEVVEWAKSNIG−−KRINID−−−NYRGSQCWDTPNFIFKRYWGFVTWGNAKDMANYRYPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWTGSPGRLVRHPYV−−−−−SVTG−−−FVRPPYSKDTS−−−−−−−−−−−KPSSTDTSSASKANDS−−TITGEAKKPQFKEVKTIKYTAYSNVLDKEEHFIDHIVVMGDERSDIQGLYIKESMHMRSVDELYTQRNKFISDYEIPHLYVDREATWLARPTNFDDPRHPNWLVIEVCGGQTDSKRQFLLNQIQALIRGVWLLSGIDKNLSETTLKVDPNIWRSMKDLINYDLIKQGIPDNAKYEQVKKKMLETYIKRDILTRENIKEVTTKTTIRISDKTSVD−−−−−−−−−SASTRGPTP−−−−−−SDEKPSIVTETSPFTFQQALDRQMSRGNPKKSHTWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGISVSALNKILKGKGTLDGQGKAFAEACKKNNINEIYLIAHAFLESGYGTSNFASGRYGAYNYFGIGAFDNDPDYAMTFAKNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFTRDKYK
fig|1158533.3.peg.629   Staphylococcus aureus M0510     MGLPNPKTRKPTASEVVEWAKSNIG−−KRINID−−−NYRGSQCWDTPNFIFKRYWGFVTWGNAKDMANYRYPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWTGSPGSLVRHPYV−−−−−SVTG−−−FVRPPYSKDTS−−−−−−−−−−−KPSSTDTSSASKANDS−−TITGEAKKPQFKEVKTVKYTAYSNVLDKEEHFIDHIVVMGDERSDIQGLYIKESMHMRSVDELYTQRNKFISDYEIPHLYVDREATWLARPTNFDDPRHPNWLVIEVCGGQTDSKRQFLLNQIQALIRGVWLLSGIDKNLSETTLKVDPNIWRSMKDLINYDLIKQGIPDNAKYEQVKKKMLETYIKRDILTRENIKEVTTKTTIRISDKTSVD−−−−−−−−−SASTRGPTP−−−−−−SDEKPSIVTETSPFTFQQALDRQMSRGNPKKSHTWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGISVSALNKILKGKGTLDGQGKAFAEACKKNNINEIYLIAHAFLESGYGTSNFANGRYGAYNYFGIGAFDNDPDYAMTFAKNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFTRDKYK
fig|359786.3.peg.808   Staphylococcus aureus subsp. aureus JH9     MGLPNPKTRKPTASEVVEWAKSNIG−−KRINID−−−NYRGSQCWDTPNFIFKRYWGFVTWGNAKDMANYRYPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWTGSPGSLVRHPYV−−−−−SVTG−−−FVRPPYSKDTS−−−−−−−−−−−KPSSTDTSSASKANDS−−TITGEAKKPQFKEVKTVKYTAYSNVLDKEEHFIDHIVVMGDERSDIQGLYIKESMHMRSVDELYTQRNKFISDYEIPHLYVDREATWLARPTNFDDPRHPNWLVIEVCGGQTDSKRQFLLNQIQALIRGVWLLSGIDKNLSETTLKVDPNIWRSMKDLINYDLIKQGIPDNAKYEQVKKKMLETYIKRDILTRENIKEVTTKTTIRISDKTSVD−−−−−−−−−SASTRGPTP−−−−−−SDEKPSIVTETSPFTFQQALDRQMSRGNPKKSHTWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGISVSALNKILKGKGTLDGQGKAFAEACKKNNINEIYLIAHAFLESGYGTSNFASGRYGAYNYFGIGAFDNDPDYAMKFAKNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFIRDKYK
fig|1278075.4.peg.1678   Staphylococcus aureus LVP5     MGLPNPKTRKPTASEVVEWAKSNIG−−KRINID−−−NYRGSQCWDTPNFIFKRYWGFVTWGNAKDMANYRYPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWTGSPGSLVRHPYV−−−−−SVTG−−−FVRPPYSKDTS−−−−−−−−−−−KPSSTDTSSASKANDS−−TITGEAKKPQFKEVKTVKYTAYSNVLDKEEHFIDHIVVMGDERSDIQGLYIKESMHMRSVDELYTQRNKFISDYEIPHLYVDREATWLARPTNFDDPRHPNWLVIEVCGGQTDSKRQFLMNQIQALIRGVWLLSGTDKELSETTLKVDPNIWRSMKDLINYDLIKQGIPDNAKYEQVKKKMLEMYIKRDILTRENIKEVTTKTTIRISDKTSVD−−−−−−−−−SASTRGPTP−−−−−−SDEKPSIVTETSPFTFQQALDRQMSRGNPKKSHTWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSALNKILKRKGTLDGQGKAFAEACKKNNINEIYLIAHAFLESGYGTSNFASGRYGAYNYFGIGAFDNDPDYAMKFAKNKGWTTPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFTRDKYK
fig|553583.3.peg.1934   Staphylococcus aureus A9635     MGLPNPKTRKPTASEVVEWAKSNIG−−KRINID−−−NYRGSQCWDTPNFIFKRYWGFVTWGNAKDMANYRYPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWTGSPGSLVRHPYV−−−−−SVTG−−−FVRPPYSKDTS−−−−−−−−−−−KPSSTDTSSASKANDS−−TITGEAKKPQFKEVKTVKYTAYSNVLDKEEHFIDHIVVMGDERSDIQGLYIKESMHMRSVDELYTQRNKFISDYEIPHLYVDREATWLARPTNFDDPRHPNWLVIEVCGGQTDSKRQFLMNQIQALIRGVWLLSGTDKELSETTLKVDPNIWRSMKDLINYDLIKQGIPDDAKYEQVKKKMLETYIKRDILKRENIKEVTTKTTIRISDKTSVD−−−−−−−−−SASTRGPTA−−−−−−SDEKPSIVTEKSPFTFQQALDRQMSRGNPKKSHTWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSALNKILKGKGTLDGQGKAFAEACKKNNINEIYLIAHAFLESGYGTSNFASGRYGAYNYFGIGAFDNDPDYAMKFAKNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFIRDKYK
fig|505321.3.peg.2   Staphylococcus aureus subsp. aureus str. CF-Marseille     MGLPNPKTRKPTASEVVEWAKSNIG−−KRINID−−−NYRGSQCWDTPNFIFKRYWGFVTWGNAKDMANYRYPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWTGSPGSLVRHPYV−−−−−SVTG−−−FVRPPYSKDTS−−−−−−−−−−−KPSSTDTSSASKANDS−−TITGEAKKPQFKEVKTVKYTAYSNVLDKEEHFIDHIVVMGDERSDIQGLYIKESMHMRSVDELYTQRNKFISDYEIPHLYVDREATWLARPTNFDDPRHPNWLVIEVCGGQTDSKRQFLMNQIQALIRGVWLLSGTDKELSETTLKVDPNIWRSMKDLINYDLIKQGIPDDAKYEQVKKKMLETYIKRDILKRENIKEVTTQTTIRISDKTSVD−−−−−−−−−SASTRGPTA−−−−−−SDEKPSIVTEKSPFTFQQALDRQMSRGNPKKSHTWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGISVSALNKILKGKGTLDGQGKAFAEACKKNNINEIYLIAHAFLESGYGTSNFASGRYGAYNYFGIGAFDNDPDYAMKFAKNKGWTTPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFIRDKYK
fig|904750.3.peg.2540   Staphylococcus aureus subsp. aureus 21272     MGLPNPKTRKPTASEVVEWAKSNIG−−KRINID−−−NYRGSQCWDTPNFIFKRYWGFVTWGNAKDMANYRYPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGPSNKSYFYSVDQNWVNSNSWTGSPGSLVRHPYV−−−−−SVTG−−−FVRPPYSKDTS−−−−−−−−−−−KPSSTDTSSASKANDS−−TITGEAKKPQFKEVKTVKYTAYSNVLDKEEHFIDHIVVMGDERSDIQGLYIKESMHMRSVDELYTQRNKFISDYEIPHLYVDREATWLARPTNFDDPRHPNWLVIEVCGGQTDSKRQFLMNQIQALIRGVWLLSGTDKELSETTLKVDPNIWRSMKDLINYDLIKQGIPDDAKYEQVKKKMLETYIKRDILKRENIKEVTTQTTIRISDKTSVD−−−−−−−−−SASTRGPTA−−−−−−SDEKPSIVTEKSPFTFQQALDRQMSRGNPKKSHTWGWANATRAQTSSAMNVKRIWESNTQCYQMLNLGKYQGVSVSALNKILKGKGTLDGQGKAFAEACKKNNINEIYLIAHAFLESGYGTSNFASGRYGAYNYFGIGAFDNDPDYAMKFAKNKGWTTPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGIYFIRDKYK