(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020420

fig|1000590.6.peg.481   Staphylococcus epidermidis 14.1.R1.SE      MRIYINEIKLKDDGVYCFSEE−−−−−STEGLEEVGQMLVDSDNYGFAYLLDD−−GQSYSYLIFVQETWSMLHENRDKKIII−−−−−−NNH−−−−LELKHFQEELDYVLNNIEGNNNYGKEFVSAVEKTFELE
fig|979220.3.peg.142   Staphylococcus epidermidis NIH05005      MRIYINEIKLKDDGVYCFSEE−−−−−STEGLEEVGQMLVDSDNYGFAYLLDD−−GQSYSYLIFVQETWSMLHENRDKRIII−−−−−−NNH−−−−LELKHFQEELDYVLNNIEGNNNYGKEFVSAVEKTFELE
fig|904334.4.peg.1799   Staphylococcus capitis VCU116      MRIYINEIKVKDDGIYCFSED−−−−−PTDGLEEVGQMLVDSDNYGFAYLLDD−−GESYSYLIFVQETWSLLHENRDKKIII−−−−−−NND−−−−LELKHFQEELDYILENIEGNNNYGKEFVSAVEKTFELE
fig|525378.3.peg.79   Staphylococcus epidermidis M23864:W1      MRIYINEIKVEEDGIYCFSED−−−−−PTDGLEEVGQMLVDSDNYGFAYILDD−−GESYSYLIFVQETWSMLHENRDKKVII−−−−−−NNH−−−−LELEHFQEELDYILDNIEGNNNYGKEFVLAVEKTFELE
fig|525377.3.peg.795   Staphylococcus lugdunensis M23590      MRIYVNEIKVKDDGIYCYSDD−−−−−PTDGLEEVGQMLVDSDNYGFAYILDD−−GQSYSYLIFVEETWSMLHENRDKTIIV−−−−−−NDD−−−−LKLEHFQEEFDFILDNIVGNNNYGKEFVAAVEKTFELE
fig|435837.3.peg.1851   Staphylococcus hominis subsp. hominis C80      MRIYVNEIKIKDDSIYCYSED−−−−−PTDGLDEVGQMLVDSDNFSFAYLLDD−−GSSYSYLIFVQETWSMLHNNRDKKVII−−−−−−NDE−−−−LELEHFQDELSYILENVEGNNNYGKEFVSAVEETFELK
fig|279808.3.peg.2156   Staphylococcus haemolyticus JCSC1435      MRIYVNEIKIKDDGIYCYSED−−−−−PTDGLVEVGQMLVDSDNYGFAYLLDD−−GQSYDYLIFVQETWSMLHENRGKKLIV−−−−−−NDD−−−−LVLEHFQEELDYILENVEGNNNYGKEFVSAVEETFDLK
fig|342451.11.peg.1776   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305      MRIYVNEIKVTEDSINCYTEQ−−−−−STEGLQEAGQMLVDSDNYSFAYILDD−−GQSYSYLIFVQETWSMLYENKGKKLII−−−−−−NDE−−−−LELKQFENEFNYILDNIQGNSNYGKEFVSVVENTFELD
fig|396513.4.peg.611   Staphylococcus carnosus subsp. carnosus TM300      MRIYVNEIKVKDDGIYCYTDK−−−−−STEGLKEAGQMLVDSDNYGFAYILDD−−GQSYSYLIFVKETWSMLHENKGKTIYI−−−−−−NDD−−−−LKLEEFDQELDYILSNIKGNSNYGKDFVAEVEEAFELE
fig|904338.3.peg.272   Staphylococcus warneri VCU121      MRIYINEIKVKDDTIYCYSED−−−−−SIEGLEEVGQMLVDSDNYGFAYILDD−−GQSYSYLIFVEETWSMLHENKGKKLIV−−−−−−NDE−−−−LELKHFQEELDYILDNIEGNNNYGKEFVSAVEKTFELE
fig|273036.3.peg.991   Staphylococcus aureus RF122      MRLYINEIKIKDDTLYCYTED−−−−−TIKGLSEVGQMLVDSDNYAFAYTLDD−−GKAYAYLIFVQETWTMLHENMTKKIII−−−−−−NDE−−−−LELTEFHQELTYILDNIKGNNNYGKEFVATVEETFDIE
fig|585155.3.peg.2276   Staphylococcus aureus subsp. aureus H19      MRLYINEIKIKDDTLYCYTED−−−−−SIKGLSEVGQMLVDSDNYAFAYTLDD−−GKAYAYLIFVQETWTMLHENMTKKIII−−−−−−NDE−−−−LELTEFHQELTYILDNIKGNNNYGKEFVATVEETFDIE
fig|1158695.3.peg.877   Staphylococcus aureus M0769      MRLYINEIKIKDDILYCYTED−−−−−SIKGLSEVGQMLVDSDNYAFAYTLDD−−GKAYAYLIFVQETWTMLHENTTKKIII−−−−−−NDE−−−−LELTEFHQELTYILDNIKGNNNYGKEFVATVEETFDIE
fig|1157024.3.peg.1607   Staphylococcus aureus M0340      MRLYINEIKIKDDILYCYTED−−−−−SIKGLSEVGQMLVDSDNYAFAYTLDD−−GKAYAYLIFVQETWTMLHENMTKKIII−−−−−−NDE−−−−LELTEFHQELTYILDNIKGNNNYGKEFVATVEETFDIE
fig|458233.11.peg.711   Macrococcus caseolyticus JCSC5402      MNLHVNEIKLEDNKVKIYTEE−−−−−PQMDVTATGTMVVDSDHMQFVYLLDD−−GDFHHLRFVQETWPMLKQYQDKDWYL−−−−−−YGT−−−−LQLDNFKEELQFLLENIEGNYNYGKEFTESVEHAFEL 
fig|444177.5.peg.1342   Lysinibacillus sphaericus C3-41      KIYTIETSNFEQDQLHFSLND−−−NEVNLQLKPAGQLIADSDDFAFIYLLDA−−GEDYHYLRFPPSSWENLVHILQKKKDPILRINDEA−−−−IELINFYDELEMLVYNIEGNYNYGAEFVQTVEQHFK  
fig|388400.4.peg.4181   Bacillus sp. B14905                                    QLKPAGQLIADSDDFAFIYLLDA−−GEDYHYLRFPPSSWENLVHILQKKKDPILRISEEA−−−−IELTNFYDELEMLVYNIEGNYNYGAEFVQTVEQHFK  
fig|649639.3.peg.4202   Bacillus cellulosilyticus DSM 2522                                  IKQLKAGEQILVDSDAKAFVYILED−−NEGYVHIRFPLAVWSELEVMKTNGLPMFVVFSHKEENIIIQLNNFLEELNTLLENIKDNSNYGKDFVLSVENAFHL 
fig|345219.8.peg.319   Bacillus coagulans 36D1        IELGKPEWKDGILQLHAER−−PDVSMQHLKPGGQMIVDSDACAFIYLAEDDGDEDYTYLYLPVPVWKEIRTAAFEHKKVVAVSKDGK−−−−LELTGLDEELQFLLDNIRGNSNYGKKMLDKVEAVFALE
fig|272558.8.peg.2962   Bacillus halodurans C-125                                EQAKQLQATERMLVDSDDHAFVYVLED−−EETFFYLRFPEATWTVLKEGMNSGKEVVAHLNQET−−−LITCHNFYNELRYLIDNIAGNGNYGEEMERAVQNAF   
fig|66692.6.peg.2689   Bacillus clausii KSM-K16     MKQYKVSAIEVDEEASTVELEEEIDAQLAARLKPGKRVLVDSDQYAFIYILED−−EEAFYAIRFEKNVWPALNEAHKLKTSYYVKLNEHT−−−RLALVDMEEELVFLLENIRGNGNYGEAFEQAVNDAF   
fig|398511.4.peg.360   Bacillus pseudofirmus OF4       KLNVLEITKNSEGYAAACEHTFTQDEIKGIKAGERMLVDSDGLALIYIIED−−DEQFYYVSFGQNTWPMLDEAYKTETPLILEFDSNHT−−−−LELVQLHAELDFLLENIEGNSNYGEELETAVCEVFK  
fig|224308.49.peg.1182   Bacillus subtilis subsp. subtilis str. 168 [WGS]       RIEILNATLSDDQLRLACQT−−−EGNEAERKPSGQMLVDSDHFAFVYILEL−−ADSFEYVIIKEHVWPELKQAHAQKIPVVLEAGDQT−−−−IELAGLHEELEYLLENIKDNANYGEEMEEKVKRVF   
fig|655816.3.peg.1197   Bacillus subtilis subsp. spizizenii str. W23       RIEILNATLSDDQLRLACET−−−EGDEAERKPSGQMLVDSDHYAFVYILEL−−ADSFEYVIIKEHVWPELKQAHAQRIPVVLEAGDKT−−−−IELAGLHEELEYLLENIKDNANYGEMEEKVKRVF   
fig|326423.5.peg.1137   Bacillus amyloliquefaciens FZB42       RIEIQNASLTEDALRLKCGE−−−DLSGAERKASGQMLVDSDHFAFVYILES−−ADSFEYVIIKEHIWPDLKEALDQRKPAVLEAGGKT−−−−VELSGLHEELDYLLENIKDNANYGDMEEKVKNVF   
fig|665958.3.peg.1967   Bacillus sp. BT1B_CT2       RIEITEANLRNDRLVLTSEI−−−−NDGAERKPAGRMLTDSDHFAFVYILEQ−−DESFEYVILNEGIWSDLKAALDAGLPVFLHIGNTE−−−−LELNGFHDELGYLIENIKDNANYGEEMEERVKRIF   
fig|315750.8.peg.1102   Bacillus pumilus SAFR-032       RIEIAEATLKEDRLILTTKS−−−EEQIQKAKASGQMLVDSDHFAFVYILEN−−EESFSYLILGEDTWAPLKEAMTLDIPVYLAAEGHS−−−−LELIQLHQELHYLIDNIKDNANYGDMEEKVKSTF   
fig|536229.4.peg.742   Bacillus pumilus ATCC 7061       RIEIAEATLKEDRLILTTKS−−−EEQIQKAKASGQMLVDSDHFAFVYILEN−−EESFSYLILGKHTWTPLKEAMNLDIPVYLTAGGHS−−−−LELIQLHQELHYLIDNIKDNANYGDMEEKVKSTF   
fig|1138452.3.peg.635   Bacillus megaterium NCT-2       RIDITTCVMKSNELHLKADP−−IETEIEQLEDTKQMLVDSDNMSFVYVVDI−−NDQFMYVGLSDNIWANLKHVLHKDMKVFLEINKKV−−−−IELSAVKEELSYLISNIEGNVNYGDEMVARVEEVF   
fig|313627.6.peg.2198   Bacillus sp. NRRL B-14911       KIDITNAALTETNELLLETEQ−−−−−DINGLKANGQMLVDSDNLAFVYIAES−−NDEYTYIVLSEGIWAAMSQALAAGADAYLANGPGR−−−−LHLPQFREELGYLIENIKGNSNYGDEMVAKVEAAF   
fig|441769.6.peg.1156   Bacillus coahuilensis m4-4          LHKKEMTENTMIFTTNE−−−QEIVKGIVPTGQLIVDSDQLSFVYLGEV−−EEEYVYLYLSETCWEDVRAGIHNNVQFFLDVDGEV−−−−VELLELNEELTYLISNIEGNGNYGEQMVEKVESIF   
fig|161544.4.peg.2926   Bacillus sp. SG-1       KILLTKAELLDDKLVLHSSE−−−KAGESNLKPAGQVLVDSDNFSFVYFAES−−QEEYVLIHIQEECWSALKEAFEQKMPVFADLGESE−−−−FELEGLHEELDYLIENIEGNSNYGEDMVKKVEAVF   
fig|1111068.3.peg.949   Geobacillus thermoleovorans CCB_US3_UF5          VERVEREGGRLWLYVND−−APVPLARVTPKRHMLVDSDALAFAYILET−−DDRFLYVMIPKPWWPELKAALDAKEPVWLRCGERT−−−−LELEQFHDELSYLLENIRGNANYGEALEQAVQDVF   
fig|691437.3.peg.2955   Geobacillus sp. C56-T3          VERAEREGGRLWLYVND−−APVPLARVTPKRHMLVDSDALAFAYILET−−DDRFLYVMIPKLWWPELKAALDAKEPVWLRCGERT−−−−LELEQFHDELSYLLENIRGNANYGEALEQAVQDVF   
fig|550542.5.peg.805   Geobacillus sp. Y412MC52          VERAEREGGRLWLYVND−−APVPLARVTPKRHMLVDSDALAFAYILET−−DDRFLYVMVPKPWWLELKAALDAEEPVWLRCGERT−−−−LELEQFHDELSYLLENIRGNANYGEALEQAVQDVF   
fig|495036.3.peg.479   Geobacillus sp. G11MC16       KVTVERAERKDGRLWLYADN−−VPVPLVHVTPKRHMLVDSDALAFVYILET−−DDRFLYVIIPKQWWPELKAAFAEGEPIWLESEGMA−−−−LELEQFGEELAYLLENIRDNANYGETFEQAVQEVF   
fig|581103.5.peg.3323   Geobacillus sp. Y4.1MC1       KLMVEKIEKRNERLWLISND−−SPFSLEHAKPKNHMLVDSDNIAFIYILET−−EEDFIYVTIPYEHWTDMKQVLTESIPVFLQSGMAE−−−−LELTNFKEELAYLIENIDGNANYGEQMEQAVKEIF   
fig|471223.3.peg.837   Geobacillus sp. WCH70       KLVVEKVEKRDERLWLICDH−−PPFSLEQARPKNHMLVDSDNIAFIYILET−−DEDFIYVAIPSEFWMDIKQVLTDGTPIFLQSGTIE−−−−MELTHFKEELTYLIENIDGNANYGEQMEQAVKEIF   
fig|491915.6.peg.2173   Anoxybacillus flavithermus WK1      MKIYVHTAEKKENGWYFLCEA−−−−−SLQGLQAKRHMLVDSDACAFAYILEA−−ADAFVYVIMPKEVWGAIKEALRTNEPVFLVGNDAT−−−−IELEGIHEEVAYLIENIAGNANYGEEMEQAVTAFFE  
fig|526998.3.peg.5494   Bacillus mycoides Rock1-4       KIQVKSVEERENALIFCAEN−−IEIQVEELKARNHVLVDSDHLSFLYILEN−−ESAFIYVSIPHTCWEAMHSAMKNDKAMFVRVNNTE−−−−IELAQLKEEVEYLIENIEGNANYGEELVTAVEKVF   
fig|526986.3.peg.4340   Bacillus cereus Rock3-44       KIQVKSVEERENALIFCAEN−−TEIQVEELKARNHVLVDSDHLSFLYILEN−−ESAFIYVSIPHTCWEAMNSAMKSEKAMFVRVNNTE−−−−IELEQLKEEVEYLIENIEGNANYGEELVTAVEKVF   
fig|315749.8.peg.970   Bacillus cytotoxicus NVH 391-98       KIQVKSVKERENALIFCAEN−−TEIEVKELTARNHVLVDSDHLSFLYILEN−−ESSFVYVSIPHTCWEAMREAMQQDKKMFVHVNDME−−−−IELEQLKEELEYLIRNIEGNANYGEELVSAVEKVF   
fig|1053203.3.peg.1061   Bacillus cereus HuA2-4       KIQVKSVETRENALIFCAEN−−TEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAVHEAMNKDTAMFIRVNDVE−−−−IELEGLKEEVEYLVENIEGNANYGEELVTAVEKVF   
fig|526994.3.peg.5283   Bacillus cereus AH1273       KIQVKSVETRENALIFCAEN−−TEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAIHEAMNKDTAMFIHVNDVE−−−−IELEGLKEEVEYLVENIEGNANYGEELVTAVEKVF   
fig|526990.3.peg.3121   Bacillus cereus AH603       KIQVKSVETRENALIFCAEN−−TEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMHEAMNKDTAMFIRVNDVE−−−−IELEGLKEEVEYLVENIEGNANYGEELVTAVEKVF   
fig|1053212.3.peg.1014   Bacillus cereus HuB5-5       KIQVKSVEMRENALIFCAEN−−TEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMREAMNKDTAMFIQVNDVE−−−−MELEGLKEEVEYLVENIEGNANYGEELVTAVEKVF   
fig|526988.3.peg.1322   Bacillus cereus Rock4-18       KIQVKSVEMRENALIFCAEN−−TEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMREAMNKDTAMFIQVNDVE−−−−MKLEGLKEEVEYLVENIEGNANYGEELVTAVEKVF   
fig|526968.3.peg.1290   Bacillus cereus R309803       KIQVKSVEKRENALIFCAEN−−TEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEALHEAMNKDTAMFIQVNGVE−−−−MELEALKEEVEYLVENIEGNANYGEELVTAVEKVF   
fig|527019.3.peg.2277   Bacillus thuringiensis IBL 200       KIQVKSVETRENALIFCAEN−−SEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMHEAMNKDMVMFIRVNDIE−−−−MELEGLKEEVEYLVENIEGNANYGEELVTAVEKVF   
fig|269801.1.peg.3823   Bacillus cereus G9241       KIQVKSVEKRENALIFCAEN−−SEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMHEAMNNDMVMFVRVNDIE−−−−MELEGLKEEVEYLVENIEGNANYGEELVTAVEKVF   
fig|526992.3.peg.4586   Bacillus cereus AH1271       KIQVKSVEKRENALIFCAEN−−NEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMHEAMNNDIVMFVRVNDVE−−−−MELENLKEEVEYLVENIEGNANYGEELVTAVEKVF   
fig|527026.3.peg.5033   Bacillus thuringiensis serovar sotto str. T04001       KIQVKSVEKRENALIFCAEN−−NEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMYEAMNNDIVMFVRVNDVE−−−−MELENLKEEVEYLVENIEGNANYGEELVTAVEKVF   
fig|527023.3.peg.3386   Bacillus thuringiensis serovar kurstaki str. T03a001       KIQVKSVEKRENALIFCAEN−−SEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMHEAMNSDVVMFVRVNDIE−−−−MELEGLKEEVEYLVENIEGNANYGEELVTAVEKVF   
fig|527021.3.peg.3390   Bacillus thuringiensis Bt407       KIQVKSVEKRENALIFCAEN−−SEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMHEAMNNDVVMFVSVNDIE−−−−MELEGLKEEVEYLVENIEGNANYGEELVTAVEKVF   
fig|405533.4.peg.863   Bacillus cereus AH1134       KIQVKSVEKRENALIFCAEN−−SEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMHEAMNNDVVMFVRVNEIE−−−−MELEGLKEEVEYLVENIEGNANYGEELVTAVEKVF   
fig|526991.3.peg.4388   Bacillus cereus AH676       KIQVKSVEKRENALIFCAEN−−SEIEVKELSARNHVLVDSDNLSFLYILEN−−ELSFIYVSIPHTCWEAMHEAMNNDVVMFVRVNDIE−−−−MELEGLKEEVEYLVENIEGNANYGEELVTAVEKVF   
fig|714359.3.peg.1141   Bacillus thuringiensis BMB171       KIQVKSVEKRENALIFCAEN−−SEIEVKELSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMHEAMNNDVVMFVRVNDIE−−−−MELEGLKEEVEYLVENIEGNANYGEELVTAVEKVF   
fig|527032.3.peg.2312   Bacillus thuringiensis serovar andalousiensis BGSC 4AW1       KIQVKSVEKRENALIFCAEN−−SEIEVKGLSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMHEAMNNDVVMFVRVNDIE−−−−MELEGLKEEIEYLVENIEGNANYGEELVTAVEKVF   
fig|347495.3.peg.1097   Bacillus cereus F837/76       KIQVKSVEKRENALIFCAEN−−SEIEVKGLSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCWEAMHEAMNNDVVMFVRVNDIE−−−−MELEGLKEEVEYLVENIEGNANYGEELVTAVEKVF   
fig|486620.3.peg.2479   Bacillus anthracis str. A0465       KIQVKSVEKRENALIFCAEN−−SEIEVKGLSARNHVLVDSDNLSFLYILEN−−ESSFIYVSIPHTCW−−−−EAMNNDVVMFVRVNDIE−−−−MELEGLKEEVEYLVENIEGNANYGEELVTAVEKVF   
fig|288681.12.peg.1152   Bacillus cereus E33L       KIQVKSVEKRENALIFCAEN−−SEIEVKGLSARNHVLVDSDNLSFIYILEN−−ESSFIYVSIPHTCWEAMHEAMNNDVVMFVRVNDIE−−−−MELEGLKEEVEYLVENIEGNANYGEELVTAVEKVF