(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020411

fig|909945.3.peg.2241   Salmonella enterica subsp. enterica serovar Dublin str. 3246                                 TARKRLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ALGVLEEARRGVPA−−−−−−−−−−−−−−−−TMHYRINTERLEALLLETAKLVKKGAQEKTRLRDFQNVETPQSGLVQPRKPDCGNAANKNVETPQTSTGQPNEQACGDPTIFP−−TGDYTETTQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ITQESKTPFCPVAEQPDPEVTL−−−−−−−−−−−−−−TDQAIEVLTHLNQVSGS−−−−−−−−−−−RYQ−−−KSKTSLENIRARLREGY−−−−−−−−SVADLQLVIDLKHEHWH−−EN−−−−−DEQYQYMRPETLFGPKKFESYLQSA          
fig|696867.3.peg.861   Salmonella enterica subsp. enterica serovar Enteritidis str. 18569                                                                                                                      INTARLEALLLETAKPVKKGAQEKTRLRDFQNVETPQSGLVQPRKPDCGDAANKNVETPQTSTGQPNEQACGDPTIFP−−TGDYTETTQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ITQESKTPFCPVAEQPDPEVTL−−−−−−−−−−−−−−TDQAIEVLTHLNQVSGS−−−−−−−−−−−RYQ−−−KSKTSLENIRARLREGY−−−−−−−−SVADLQLVIDLKHEHWH−−EN−−−−−DEQYQYMRPETLFGPKKFESYLQSA          
fig|399742.10.peg.2766   Enterobacter sp. 638                        SESTLKRTFTRLKNLG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLKIEQLNKSQRDM−−−−−−−−−−−−−−−−TNYYTIN−−−YESELLDEVKVTKSKGSNC−−−−−−−TLPSGQNDLMEKVKV−−−NRSNGSKRTAVIRSKW−−−−−−−−−−−−−−−PDVLTENTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−STTENKTPICPVASQPDPEVLI−−−−−−−−−−−−−−TDNAILVLTHLNQVSGS−−−−−−−−−−−RYQ−−−KSKTSLENIRGRLRDGY−−−−−−−−SVDDLKLVIDLKHEHWS−−GN−−−−−DDQYQYMRPETLFGPKKFESYLQSAS         
fig|584.1.peg.1445   Proteus mirabilis HI4320                        SVSTLKRAFAQLRISG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LIEVKQLNKHLHDR−−−−−−−−−−−−−−−−TNFYSIN−−−YQHKILQIEEDEKRSLTEGNYANKTTIKPFDEPKSKQWTGVT−−−NLSQSSSNRALL−−−−−−−−−−−−−−−−−−−TESTTKITTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SNNKRSRSVCSFSSP−−−−−−−−−−−−−−−−−−−−−ERPEIEIIRYFNKVTHS−−−−−−−−−−−HYR−−−ECQTTLGYIRARLADGF−−−−−−−−HFEELILIIDYLTAKWL−−ND−−−−−NKMQDYLRPKTLFHKNNCTEYLDKAKK        
fig|520999.6.peg.682   Providencia alcalifaciens DSM 30120                        SESTIKRAFTNLKKLG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLSIDQINKHNHDR−−−−−−−−−−−−−−−−TNYYSIN−−−YEHTLLSDEVKLTSSSRSPKA−−−−−−−IRTGQNDLIDKRKM−−−KRSERVKMTSSNGSNWSDL−−−−−−−−−−−−TESTTENTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ITTESNSSCQAHAEP−−−−−−−−−−−−−−−−−−−−−DDAKMVLDHFNKVTNS−−−−−−−−−−−SYQ−−−GKKTTMGYIKARLAEGY−−−−−−−−TVDELNQVSDYLTAKWL−−ND−−−−−PEYAHNLRPLTVFGEEKFESY              
fig|693216.3.peg.1642   Cronobacter turicensis z3032                        GRSTVITAVGELERDG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WLTRKERRQGQRSG−−−−−−−−−−−−−−−−TNIYTLNVPRLRQAAAGAYSQGPVSE−−−−−−−HSESGRSESEGSEAGRPES−−−ERPE−−−−−−−−−−−−−−−NRKTGASQGPESGHDPSVNSKQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EPSDKKPSCQVARQPDAEQLI−−−−−−−−−−−−−−TDKAIAVLKHLNLVTGA−−−−−−−−−−−RYQ−−−NSKSSLENIRARLREGH−−−−−−−−SVDDLQLVVDYKHEHW−−−HD−−−−−TEMYDYMRPQTLFVPGKLEGYL             
fig|615.1.peg.3242   Serratia marcescens Db11                        SESTVSASLAKLEKDG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WITRQQRRKGNRNT−−−−−−−−−−−−−−−−SSMTQLN−−−VEMLRAAANSHPPESE−−−−−−−−−−−−ASKSDTSKFDTSKS−−−DPSK−−−−−−−−−−−−−−−SSNTGRFDPPESGYDPSVNSKH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DPSDKNTFGQPPAAADQGDVVSEEIHI−−−−−−−−TDQAILVLKHLNQLTGA−−−−−−−−−−−KYT−−−TAKSTLQNIRARLVDGH−−−−−−−−TLEELKLVVEYLVDRWL−−G−−−−−−TEWAKYLNPETMFRPGKFPGNL             
fig|637910.3.peg.2533   Citrobacter rodentium ICC168                          STVRTAIAKLEAEG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WLTRTARRQGNRNA−−−−−−−−−−−−−−−−SNVYRLN−−−VRKLQAAAFSHLPDSD−−−−−−−−−−−−PSKSDASKSDPSKI−−−EASK−−−−−−−−−−−−−−−SDKNGGFHPSESGGDPSVKSTT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DPSDKKTSCPVASQPAPAVEI−−−−−−−−−−−−−−TDQAKQVLTFLNQKTGS−−−−−−−−−−−RYQ−−−VGKTSLENIRARLGEGF−−−−−−−−TIYELTLVVEYMTEKWG−−QD−−−−−FKMSEYLRPTTLFHPTKFPGYLQAANK        
fig|592316.3.peg.2357   Pantoea sp. At-9b                          STVRTSLRKLESEG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WLTTTPRRKGNRNN−−−−−−−−−−−−−−−−SNMYQLN−−−VKKLREAAALHLSESD−−−−−−−−−−−−ASESDTSKSDASKS−−−GASV−−−−−SDASKSGAPESDKNTGFHPPESGDDPSVNSTT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DPSDKNTSCQVASQPDRDVVI−−−−−−−−−−−−−−TDLAKQVLTHLNQITGS−−−−−−−−−−−KFQ−−−VSRSSLENIRARLAEGY−−−−−−−−EPDELKLVVDYKNEHWR−−N−−−−−−TEQEQYLRPATLFIPKNFAGYLQSATK        
fig|675817.3.peg.3624   Photobacterium damselae subsp. damselae CIP 102761                        SRDQVKRSVKYLTTNFG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NAIHTKLKKANGVP−−−−−−−−−−−−−−−−TTHYFIDIKELLSLASKEIKEDPKPSGEVVKLSGQDSPMPGMGEPTQSITDP−−−NHIR−−−−−−−−−−−−−−−−−−−−−−−−−−−STDLKDSLSS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KHDKASTKSTN−−−−−−−−LEIAKTVIAFLNEATGS−−−−−−−−−−−KFQ−−−CCKSNLNYINGRISDGY−−−−−−−−TLEDLCQVIAHKKIEWG−−SD−−−−−AKMSQYLRPCTLFQPGKFAGYLQSAKVAN      
fig|1216965.3.peg.451   Edwardsiella tarda NBRC 105688                          KTVQSSLKHLVALG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LIVDTGERRGATRQ−−VIVYRLVGVSESYEDSKHTQKRESLKAPKNGAVKKAKAPKNGNVTENGCVPDGKEPENGSVSEGKT−−−PNFG−−−−−−−−−−−−−−−−−−−−−−−−−−−GKDTQKRDTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SIRNLNGKRATPPTPQGDVIAEQVSILIDHLNRNIATLAEKLGKPKPLGFR−−−KGTIASKQIAARLREGF−−−−−−−−TVDDCRLVMDYLSEMWG−−AD−−−−−PEMREHLCPTTIFRASRFD                
fig|416269.5.peg.480   Actinobacillus pleuropneumoniae L20                                                                                                                                                     TNRTGSETEQVQKVNI−−−TGSE−−−−−−−−−−−−−−−−−−−−−−−−−−−TEQVTGSETE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HTKNNIKNTIQNNTPLNPPVGETQGDSVAVLDYLNDRLAELGKAIEQPLPKFK−−−PVPNTLKIIKARLAES−−−−−−−−−SRAECETVVDYLVAKWG−−RD−−−−−GKMREYLSPKTIFRASNFADYL             
fig|637911.3.peg.813   Actinobacillus minor NM305                         EDTVYRQYKVLKEKG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IIEHFKMDGKDYVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTEKGCEWNKFEPIRGSEKNPSIGNQSEQTRKKI−−−RESS−−−−−−−−−−−−−−−−−−−−−−−−−−−EKNPTDNNNN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKYNQDNNTPLNPPVGETHTDSVAVLDHLNQRLADLSQVLGMALPKFR−−−AKGNALKLVTARLKDS−−−−−−−−−SLAECLQVIDYLVAKWG−−RD−−−−−DAFREYLAPKTIFRASNFEDYL             
fig|272629.3.peg.6   Mannheimia haemolytica PHL213                         EDTVYRQYKVLKEKG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IIDHFKMDGKDYVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTEKGCEWNKFEPIRESEKNPSIGNNSEQTRKNF−−−RESS−−−−−−−−−−−−−−−−−−−−−−−−−−−EKNPTDNNTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YKNNNDHTTPLNPPAGEPAPAEVVLNYLNSALVTLAVQLGERKPVGY−−−SLKPWAKNITARIRES−−−−−−−−−SVADCCQVVDYLVAKWG−−RD−−−−−EKMREYLCPKTIFRQSNFADY              
fig|669261.3.peg.2452   Mannheimia haemolytica serotype A2 str. OVINE                         EDTVYRQYKVLKEKG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IIDHFKMDGKDYVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTEKGCEWNKFEPIRESEKNPSVGNQSDQARKNF−−−RESS−−−−−−−−−−−−−−−−−−−−−−−−−−−EKNPTDNNTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YKNNNDHTTPLNPPTGEPAPAEVVLNYLNSALATLAAQLGERKPVGY−−−SLKPWVKNIAARIRES−−−−−−−−−SVADCCQVVDYLVAKWG−−RD−−−−−EKMREYLCPKTIFRQSNFADYL             
fig|452948.4.peg.1103   Staphylococcus aureus 930918-3                            IAQITKELESRG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IIETKVMKVNGNPI−−−−−−−−−−−−−−−−KHYRLLYDNYLKEVEEVLENKQMNIDILKTEKRKTENRKTISENQNKEVVKT−−−KKGN−−−−−−−−−−−−−−−−−−−−−−−−−−−SKIGISSITE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DTLTEITNTEKTTELSSNRFIDTIGLVAISYINKLTNR−−−−−−−−−−−SFR−−VNDQSYIKLISDLINEDY−−−−−−−−NIIDLIEVVEKKYYEWR−−ND−−−−−RKFNKLIRPETLF                        
fig|458233.11.peg.306   Macrococcus caseolyticus JCSC5402                            IAQITKELESRG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IIETKVMKVNGNPI−−−−−−−−−−−−−−−−KHYRLLYDNYLKEVEEVLENKQMNIDILKTEKRKTENRKTISENQNKEVVKT−−−KKGN−−−−−−−−−−−−−−−−−−−−−−−−−−−SKIGISSITE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DTLTEITNTEKTTELSSNRFIDTIGLVAISYINKLTNR−−−−−−−−−−−SFR−−VNDQSYIKLISDLINEDY−−−−−−−−NIIDLIEVVEKKYYEWR−−ND−−−−−RKFNKLIRPETLF                        
fig|526218.6.peg.850   Sebaldella termitidis ATCC 33386     KYYWISYSKILQDLPFIFRSESTVKRSLNRLIEKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IIKKYLGSKNGARA−−−−−−−−−−−−−−−−−TYFAIGENYIALLKADTRIKDEIPAA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KEEKKRPAKF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKEHIEIIDHLNTVTKS−−−−−−−−−−−AFK−−SDTVASKQLMNKLLESGF−−−−−−−−TVEDIKLVIEFKAKEWE−−G−−−−−−TDREQYLRPKTLFKMDYFPGYL             
fig|451756.6.peg.1810   Clostridium perfringens CPE str. F4969                            VLSILKELEKQG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YIKLISKGKPPKTP−−−−−−−−−−−−−−−−SKYRMIY−−−AESLKNTEPLKEPI−−−−−KEPLKEPLKEPFEGIENKGIKQC−−−CEPL−−−−−−−−−−−−−−−−−−−−−−−−−−−REPLKEPLKE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PPSKDISKDK−−−−−−−−SNIYVEIIDYLNKKANT−−−−−−−−−−−RYR−−ANTKDTRLLIKKRLDDGF−−−−−−−−LLEDFMMVIDNKVLDWK−−D−−−−−−TEYEKYIRPKTLFSEKFERYLNEKVITK      
fig|445334.5.peg.1329   Clostridium perfringens C str. JGS1495                            VLSILKELEKQG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YIKLISKGKPPKTP−−−−−−−−−−−−−−−−SKYRMIY−−−AESLKNTEPLKEPI−−−−−−−−−KEPLKEPFEGIENKGIKQC−−−CEPL−−−−−−−−−−−−−−−−−−−−−−−−−−−REPLKEPLKE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PPSKDISKDK−−−−−−−−SNIYVEIIDYLNKKANT−−−−−−−−−−−RYR−−ANTKDTRLLIKKRLDDGF−−−−−−−−LLEDFMMVIDNKVLDWK−−D−−−−−−TEYEKYIRPKTLFSEKFERYLNEKVITK      
fig|525364.3.peg.925   Lactobacillus salivarius ATCC 11741                        SERTIRRELKKLAELK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IVRVAKYNISKFNH−−−−−−−−−−−−−−−−TKWYSLDGEKLQEYLDNKTPECRNGQIGQVECPKEDNGNGKSDQFRNGQVDH−−−FKDN−−−−−−−−−−−−−−−−−−−−−−−−−−−KVPKNTSLNN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QQKIKEILECFKEVTGQ−−−−−−−−−−−VFD−−−KDKWGIKLIKERLAAGN−−−−−−−−DVEQCKSMIVLKAKQWK−−G−−−−−−THVEKFVRPRTLFGDNFSKY              
fig|362948.14.peg.1042   Lactobacillus salivarius UCC118                        SERTIRRELKKLAELK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IVRVAKYNISKFNH−−−−−−−−−−−−−−−−TKWYSLDEEKLQEYLDNKTPECRNGQIGQVECPREDNGNGKSGQFRTGQVDH−−−FKDN−−−−−−−−−−−−−−−−−−−−−−−−−−−KVPKNTSLNN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QQKIKEILECFKEVTGQ−−−−−−−−−−−VFD−−−KDKWGIKLIKERLAAGN−−−−−−−−DVEQCKSMIVLKAKQWK−−G−−−−−−THVEKFIRPRTLFGDNFSKY              
fig|638301.3.peg.1751   Granulicatella adiacens ATCC 49175                        STMTIRRILGNLEKNK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LVKVGNFNKKKFDK−−−−−−−−−−−−−−−−TKWYTIN−−−YERVNRR−−−−−−−−−−−−−−−−CVQNEQTYCSDCTDGTVQN−−−EQTY−−−−−−−−−−−−−−−−−−−−−−−−−−−TRDYQESTTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNVSEEKPPKVVWTDETNHIIDYLNKRTGK−−−−−−−−−−−KYS−−VKTKKTAQLVHKLLDNGF−−−−−−−−TVEDFERVIDIKCKQWL−−NN−−−−−EKMNQYLRPRTLFSEKFEDYLNEAP         
fig|525364.3.peg.361   Lactobacillus salivarius ATCC 11741                        STSTITRKLKSLEDQG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LLITGNYNKRKFDK−−−−−−−−−−−−−−−−TKWYRID−−−YDEFKKIEKA−−−−−−−−−−−−−FSQNDQTIMSFWVNGVSQN−−−DKTN−−−−−−−−−−−−−−−−−−−−−−−−−−−TRDYTENNTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TYNSN−−−−−−−−EFDYNEFIEWFNKLADK−−−−−−−−−−−DLK−−−NTEINRQYIKDLLNDGY−−−−−−−−TKDDIVNVIEYKVNEWK−−NS−−−−−EKMNMYLRFSTLLSPNNFERYLQDAKE        
fig|279808.8.peg.2336   Staphylococcus haemolyticus JCSC1435                        SERTIKRTFSSLEKQD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LLHVGNYNKAGFDR−−−−−−−−−−−−−−−−TKWYSVK−−−YETLNQLVAR−−−−−−−−−−−−PSGQNGPTIMTKWPDAIGQN−−−DPTN−−−−−−−−−−−−−−−−−−−−−−−−−−−TRDYTEITTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TTNNNILSGNPTSP−−−−−−−−SIPYKEIIDYLNEKAGK−−−−−−−−−−−QFK−−HNTGKSKRCIEARWNEDF−−−−−−−−RLDDFKKVIDIKTSEWL−−G−−−−−−TSQEKYLRPETLFGTKFEGYLNQQPQPSG     
fig|396513.4.peg.480   Staphylococcus carnosus subsp. carnosus TM300                        SERTIKRAFGSLEKQD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LLYVGNYNRAGFDR−−−−−−−−−−−−−−−−TKWYSIN−−−YENLNNLVAR−−−−−−−−−−−−PSGQNGTTSMTNCHDARGQN−−−VTTN−−−−−−−−−−−−−−−−−−−−−−−−−−−TRDYTEITTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TTNNNILSPSST−−−−−−−−AYPYRDVINYLNQQTDK−−−−−−−−−−−HYK−−STTKKNQTVIRARTDEGF−−−−−−−−TLDDFIKVIDNKVSEWK−−D−−−−−−TDMEKYLRPETLFGTKFEGYLNQQ          
fig|653938.3.peg.685   Listeria monocytogenes 08-5578                        SLNTVKRTFTSLREKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LLLTANYNKKKFDK−−−−−−−−−−−−−−−−TVWYSID−−−YDALEAMSQR−−−−−−−−−−−−−LAQNEPTISLKRANALAQN−−−EPDN−−−−−−−−−−−−−−−−−−−−−−−−−−−TLDLPETPKE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKKNTVEELDD−−−−−−−−TSIFKNVIDFLNENAET−−−−−−−−−−−NYR−−HTTQVTQTLIRARLKDGF−−−−−−−−TFEDFKKVIIIKCKDWK−−ND−−−−−SAMSRYLRPGTLFGIKFEGYLNQK          
fig|527019.3.peg.1079   Bacillus thuringiensis IBL 200                        SEKTIRRILKNLEETK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ILLTGNYNKMKFDK−−−−−−−−−−−−−−−−TKWYTID−−−YDKLRSLETVN−−−−−−−−DVDNLTRRSGKSDHVLPDKLTRP−−−IPEN−−−−−−−−−−−−−−−−−−−−−−−−−−−TQRLSTEI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEYIVEIVNYLNTTCNK−−−−−−−−−−−SYR−−TSTKKTQTLIKARLAEGY−−−−−−−−TVEQFKKVIDIKKSHWF−−GD−−−−−AKWDEYLRPETLFGTKFESYLNSKPKTKQ     
fig|527025.3.peg.1896   Bacillus thuringiensis serovar thuringiensis str. T01001                        SEKTIRRILKNLEETK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ILLTGNYNKMKFDK−−−−−−−−−−−−−−−−TKWYTID−−−YDKLRSLETVN−−−−−−−−DVDNLTRRSGKSDHVLPDNLTRP−−−IPEN−−−−−−−−−−−−−−−−−−−−−−−−−−−TQRLSTEI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEYIVEIVNYLNTTCNK−−−−−−−−−−−SYR−−TSTKKTQTLIKARLAEGY−−−−−−−−KVEQFKKVIDIKKSHWF−−GD−−−−−AKWDEYLRPETLFGTKFESYLNSKPKTKQ     
fig|526987.3.peg.5077   Bacillus cereus Rock4-2                        NERTLKRIVKNLEEFN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LLISGNYNKLKFDK−−−−−−−−−−−−−−−−TKWYSIN−−−YDRLVELEIDN−−−−−−−−DCDKLSQRKEHIVMMENDNMSQP−−−IPET−−−−−−−−−−−−−−−−−−−−−−−−−−−TQKINSENTT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKDIVEIINYLNSVCNT−−−−−−−−−−−SYR−−ISTKKTQMLIKSRLQEGF−−−−−−−−NINEFKEVIETKAKEWL−−Y−−−−−−TEQAKYLRPETLFGTKFEGYLQQRK         
fig|526988.3.peg.2848   Bacillus cereus Rock4-18                        NERTLKRIVKNLEEFN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LLISGNYNKLKFDK−−−−−−−−−−−−−−−−TKWYSIN−−−YNRLVELEIDN−−−−−−−−DCDKLSQRKEHIVMMENDNMSQP−−−IPET−−−−−−−−−−−−−−−−−−−−−−−−−−−TQKINTENTT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKDIVEIINYLNSVCNT−−−−−−−−−−−SYR−−ISTKKTQMLIKSRLQEGF−−−−−−−−NINEFKEVIETKAKEWL−−Y−−−−−−TEQAKYLRPETLFGTKFEGYLQQRK         
fig|288681.12.peg.3648   Bacillus cereus E33L                        GESTIKRTIKNLENIN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLVIGNYNKKKFDK−−−−−−−−−−−−−−−−TKWYSID−−−YTFLRQLESTD−−−−−−−−DEVNLTPRTGQVDPMEEVNLNRP−−−IPEN−−−−−−−−−−−−−−−−−−−−−−−−−−−TQRVTTETTA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KEYIVEIVNYLNDVCGS−−−−−−−−−−−SYR−−STSKKTQSLIKSRLIEGF−−−−−−−−TVDNFKTVIDTKAREWL−−R−−−−−−TEQAKYLRPETLFGTKFEGYLQQGKVEGK     
fig|526998.3.peg.4567   Bacillus mycoides Rock1-4                        GESTIKRTIKNLENIN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLVIGNYNKKKFDK−−−−−−−−−−−−−−−−TKWYSIE−−−YTFLRQLESTD−−−−−−−−DEFNLTPRAGQVDLMEEVNLNRP−−−IPEN−−−−−−−−−−−−−−−−−−−−−−−−−−−TQRVTTETTA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KEYIVEIVNYLNDVCGS−−−−−−−−−−−SYR−−STSKKTQTLIKTRLVEGF−−−−−−−−TVDNFKAVIDIKAREWL−−R−−−−−−TEQAKYLRPETLFGTKFESYLQQGKVEGK     
fig|526982.3.peg.4862   Bacillus cereus Rock1-15                        GESTIKRTIKNLENIN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLVIGNYNKKKFDK−−−−−−−−−−−−−−−−TKWYSID−−−YTFLRQLESTD−−−−−−−−DEVNLTPRTGQVDPMEEVNLNRP−−−IPEN−−−−−−−−−−−−−−−−−−−−−−−−−−−TQRVTTETTA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KEYIVEIVNYLNDVCGS−−−−−−−−−−−SYR−−STSKKTQSLIKTRLIEGF−−−−−−−−TVDDFKTVIDTKAKEWL−−R−−−−−−TEQAKYLRPETLFGTKFEGYLQQGKVEGK     
fig|315730.5.peg.4011   Bacillus weihenstephanensis KBAB4                        SENTIRRIVKNLEDEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LLVIGNYNRAKFDK−−−−−−−−−−−−−−−−TKWYSIN−−−YEKLRLLEPTN−−−−−−−−DVPNLGRRSTQNGQMDVPNLGKP−−−IPET−−−−−−−−−−−−−−−−−−−−−−−−−−−NTETTSEI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KEYIVEIVNYLNDVCGS−−−−−−−−−−−SYR−−LTSKKTQTLIKTRLVEGF−−−−−−−−TVDNFKTVIDTKAKEWL−−R−−−−−−TEQAKYLRPETLFGTKFEGYLQQGKVEGK     
fig|280354.3.peg.1386   Bacillus anthracis str. CNEVA-9066                        SENTIRRIVKNLEDEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LLVIGNYNRAKFDK−−−−−−−−−−−−−−−−TKWYSIN−−−YEKLRLLESTN−−−−−−−−DVPNLGRRSTQNGQMDVPNLGKP−−−IPET−−−−−−−−−−−−−−−−−−−−−−−−−−−NTETTSEI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KEYIVEIVNYLNDVCGS−−−−−−−−−−−SYR−−LTSKKTQTLIKTRLVEGF−−−−−−−−TVDNFKTVIDTKAKEWL−−R−−−−−−TEQAKYLRPETLFGTKFEGYLQQGKVEGK     
fig|1081943.3.peg.654   Bacillus anthracis str. Heroin Ba4599                        SENTIRRIVKNLEDEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LLVIGNYNRAKFDK−−−−−−−−−−−−−−−−TKWYSIN−−−YEKLRLLESTN−−−−−−−−DVPNLGRRSTQNGQMDVPNLGKP−−−IPET−−−−−−−−−−−−−−−−−−−−−−−−−−−NTETTSEI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KEYIVEIVNYLNDVCGS−−−−−−−−−−−SYR−−LTSKKTQTLIKTRLVEGF−−−−−−−−TVDNFKTVIDTKAKEWL−−R−−−−−−TEQAKYLRPETLFGTKFEGYLQQGKVEGK     
fig|525259.3.peg.1594   Clostridium difficile NAP08                        STSTISRLVNEFIDLGILRLISRGVKGNCCSVYSYVCSENSNTEILTGNSGIFKNIEKYLDVTINNNQKTMK−−−−−−−−−−−−−−−−−−−YKHRDELFKNSNTNTYSRINEEHIDKGYDSIIHTGYETENETKKKELLK−−−NNLN−−−−−−−−−−−−−−−−−−−−−−−−−−−KKNLNKNTFE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NSDEDL−−−−NYESP−−−−−−−−ESIHEIIIRKLNSESGK−−−−−−−−−−−NFK−−ADLSITKALIDKRLKEGY−−−−−−−−SLEDFYKVIEAKVRRWR−−Y−−−−−−TDMEIYIEPTILFG                      
fig|499175.4.peg.2820   Clostridium difficile ATCC 43255                        SISTISRLVNEFIDLGILRLISRGVKGNSCSVYSYVCSENSNAEIVAKNGDIFKNIEKYIDVTINNNQKTMK−−−−−−−−−−−−−−−−−−−YKHRDELFKNSNTNIYSRISEESIDKDYDLIIHTGYETENETKKKELLK−−−NNLN−−−−−−−−−−−−−−−−−−−−−−−−−−−KKNLNKNTFE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NSDEDLIEDSTYKNP−−−−−−−−ESVHEIIIRKLNSESGK−−−−−−−−−−−NFK−−ADLSITKALIDKRLKEGY−−−−−−−−SLEDFYKVIEAKVRRWR−−Y−−−−−−TDMEIYIEPTILFG                      
fig|1121308.3.peg.212   Clostridium difficile ATCC 9689                                                                             FKNIEKYIDATINNNQKTMK−−−−−−−−−−−−−−−−−−−YKHRDELFKNSNTNIYSRINQESIDKDYDLIIHTGYETENETKKKELLK−−−NNLN−−−−−−−−−−−−−−−−−−−−−−−−−−−KKNLNKNTFE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NSDEDLTEDSTYKNP−−−−−−−−ESIHEIIIRKLNSESGK−−−−−−−−−−−NFK−−ADLSITKALIDKRLKEGY−−−−−−−−SLEDFYKVIEAKVRRWR−−Y−−−−−−TDMEIYIEPTILFGYEFESYLNEES         
fig|479832.7.peg.2818   Clostridium difficile QCD-76w55                                                                             FKNIEKYIDATINNNQKTMK−−−−−−−−−−−−−−−−−−−YKHRDELFKNSNTNTYSRINQESIDKDYDLIIHTGYETENETKKKELLK−−−NNLN−−−−−−−−−−−−−−−−−−−−−−−−−−−KKNLNKNTFE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NLDEDLTEDSTYKNP−−−−−−−−ESIHEIIIRKLNSESGK−−−−−−−−−−−NFK−−ADLSITKALIDKRLKEGY−−−−−−−−SLEDFYKVIEAKVRRWR−−Y−−−−−−TDMEIYIEPTILFGYEFESYLNEES         
fig|272563.8.peg.3344   Clostridium difficile 630                                                                             FKNIEKYIDATINNNQKTMK−−−−−−−−−−−−−−−−−−−YKHRDELFKNSNTNTYSRINQESIDKDYDLIIHTGYETENETKKKELLK−−−NNLN−−−−−−−−−−−−−−−−−−−−−−−−−−−KKNLNKNTFE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NSDEDLTEDSTYKNP−−−−−−−−ESIHEIIIRKLNSESGK−−−−−−−−−−−NFK−−ADLSITKALIDKRLKEGY−−−−−−−−SLEDFYKVIEAKVRRWR−−Y−−−−−−TDMEIYIEPTILFGYEFESYLNEES         
fig|479832.7.peg.167   Clostridium difficile QCD-76w55                                                                                            RTNNS−−−−−−−−−−−−−−−−−−−−−−−−−−IENNQNKRPMRLSDISVLSDKGMTNKKNYFNHNHGIQKRNKS−−−ATKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KESLNKFNK−−−−−−−−KNIQQSIINMLNKKSGK−−−−−−−−−−−NFK−−IDSPISIKLINERLKEGY−−−−−−−−VLEDFYKVIEVKVAKWK−−N−−−−−−TIMEMYIRPETLFSYKFESYVNENI         
fig|525259.3.peg.2274   Clostridium difficile NAP08                                                                                   NDTCNAIDKRTNNS−−−−−−−−−−−−−−−−−−−−−−−−−−IKSNQNKKAMKLSDINVLSDKDITNKKNYFNHTHGIQKGTKS−−−VTKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KESLNKFNK−−−−−−−−KNIQQSIINMLNKKSGK−−−−−−−−−−−NFK−−IDSPISIKLINERLKEGY−−−−−−−−VLEDFYKVIEVKVAKWK−−N−−−−−−TIMEMYIRPETLFSYKFESYVNENI         
fig|499175.4.peg.257   Clostridium difficile ATCC 43255                                                                                            RTNNS−−−−−−−−−−−−−−−−−−−−−−−−−−MENNQNKRPMRLSDISVLSDKGMTNKKNYFNHNHGIQKGTKS−−−VTKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KESLNKFNK−−−−−−−−KNIQQSIINMLNKKSGK−−−−−−−−−−−NFK−−IDSPISIKLINERLKEGY−−−−−−−−VLEDFYKVIEVKVAKWK−−N−−−−−−TIMEMYIRPETLFSYKFESYVNENI         
fig|1496.1.peg.2035   Clostridium difficile 630                                                                                            RTNNS−−−−−−−−−−−−−−−−−−−−−−−−−−IENNQNKRPMRLSDISVLSDKGMTNKKNYFNHNHGIQKGTKS−−−VTKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KESLNKFNK−−−−−−−−KNIQQSIINMLNKKSGK−−−−−−−−−−−NFK−−IDSPISIKLINERLKEGY−−−−−−−−VLEDFYKVIEVKVAKWK−−N−−−−−−TIMEMYIRPETLFSYKFESYVNENI         
fig|272563.8.peg.654   Clostridium difficile 630                                                                                            RTNNS−−−−−−−−−−−−−−−−−−−−−−−−−−IENNQNKRPMRLSDISVLSDKGMTNKKNYFNHNHGIQKGTKS−−−VTKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KESLNKFNK−−−−−−−−KNIQQSIINMLNKKSGK−−−−−−−−−−−NFK−−IDSPISIKLINERLKEGY−−−−−−−−VLEDFYKVIEVKVAKWK−−N−−−−−−TIMEMYIRPETLFSYKFESYVNENI         
fig|525366.3.peg.998   Lactobacillus vaginalis ATCC 49540                  ISYEKNGKQVVSRLIRVVNKLNG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIKKTKSPIKKTKG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYLENCEGNNTYRV−−−IQDN−−−−−−−−−−−−−−−−−−−−−−−−−−−NTDKSNKGSA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QPPHL−−−−−−−−SAQRKEVIDYLNKKTGK−−−−−−−−−−−RFK−−PNADGNKRVIDPRLKDGY−−−−−−−−TVDDLKHIIDVKYAQWH−−GNTFSNGQLGDNYLRPETLFRVSKIEGYLNE           
fig|186103.3.peg.290   Streptococcus pyogenes MGAS8232                                         LLEEVRQGNNLPNRI−−−−−−−−−−−−−−−−−−−−−−−−−−−YISAVDGTVNSTVS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ELEILQHGTVKNTVSELEILQT−−−NKTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−INKTENNNNK−−−−−−−−LLICKEVISYLNLNANK−−−−−−−−−−−NFK−−VDTASHHKFIKARLKEGY−−−−−−−−TLEDFKKVVDVMSARWI−−G−−−−−−TEYEQYLQPQTLFGNKMDNYLNTT          
fig|198466.1.peg.691   Streptococcus pyogenes MGAS315                            IIKFKKELKDVGLLEEVRQGNNLPNRI−−−−−−−−−−−−−−−−−−−−−−−−−−−YISAVDGTVKNTVS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ELEILQHGTVKNTVSELEILQT−−−NKTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−INKTENNNNK−−−−−−−−LLICKEVISYLNLNANK−−−−−−−−−−−NFK−−VDTASHHKFIKARLKEGY−−−−−−−−TLEDFKKVVDVMSARWI−−G−−−−−−TEYEQYLQPQTLFGNKMDNYLNTT          
fig|702450.3.peg.198   Turicibacter sp. PC909                        NIDTVSTAMKLFRELGMVEILDDK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TIYMNEVSKMLGTE−−−−−−−−−−−−−−−−TYWAQKK−−−REEREKKKLPKPATPQIGQCPIDVQGKSNVSKQEIEIELDIE−−−KEKE−−−−−−−−−−−−−−−−−−−−−−−−−−−IELETEIKNN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VVQSTPSFG−−−−−−−−EQLIDDVIQYLNLKTNK−−−−−−−−−−−NFR−−STTKEYRKHIGARIKQGA−−−−−−−−TPEQFKYVIDIKCAEWL−−YN−−−−−EQMKQHLNPTTLFREGNFDKYLNQQIPQNK     
fig|186103.3.peg.1616   Streptococcus pyogenes MGAS8232                         IGTVEKAIQIFRDLQLIEILDNG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AIYMTNIQNFVGKS−−−−−−−−−−−−−−−STDADRKR−−−IEYAKTKQLEQISMKCAEKSPPEIEIELDKERELDKERELDK−−−EKEL−−−−−−−−−−−−−−−−−−−−−−−−−−−DKEKEYNVEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−STTEYNFPSWLESEYVEQVKKGNPK−−−−−−−−NFDYRIPIAYLNQKTNS−−−−−−−−−−−NYK−−−FVDSNTNLVKSRLKDKY−−−−−−−−TLDDFKIVIDKKTAEWG−−KD−−−−−ADWSKYLRPSTLFNASKFESYLNQ           
fig|453362.3.peg.2330   Streptococcus pneumoniae CDC1873-00                        SEDDINMTLAYFTKCGLIQIDDDGHATLSQAKAM−−−−−−−−−−−−−−−−−−−−−−−−VESETNWAKYKREQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RKQAQNMARLESVQDSGTDSNSCPTEIEID−−−KES−−−−−−−−−−−−−−−−−−−−−−−−−−−DKDKELYKEY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ILSGKPDFTFPNWLTPRMIEEITKGHPE−−−−−−−−KYLIRIPLAYLNHTVGK−−−−−−−−−−−NYK−−−YLDKNLKPIMARFKEGY−−−−−−−−TLEDFKQVIDIKTAEWK−−DS−−−−−PEFSKYLRPETLFGTKFDGYLNQKPKTIK     
fig|453362.4.peg.2392   Streptococcus pneumoniae CDC1873-00                        SEDDINMTLAYFTKCGLIQIDDDGHATLSQAKAM−−−−−−−−−−−−−−−−−−−−−−−−VESETNWAKYKREQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RKQAQNMARLESVQDSGTDSNSCPTEIEID−−−KES−−−−−−−−−−−−−−−−−−−−−−−−−−−DKDKELYKEY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ILSGKPDFTFPNWLTPRMIEEITKGHPE−−−−−−−−KYLIRIPLAYLNHTVGK−−−−−−−−−−−NYK−−−YLDKNLKPIMARFKEGY−−−−−−−−TLEDFKQVIDIKTAEWK−−DS−−−−−PEFSKYLRPETLFGTKFDGYLNQKPKTIK     
fig|453362.4.peg.1784   Streptococcus pneumoniae CDC1873-00                        SEDDINMTLAYFTKCGLIQIDDDGHATLSQAKAM−−−−−−−−−−−−−−−−−−−−−−−−VESETNWAKYKREQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RKQAQNMARLESVQDSGTDSNSCPTEIEIE−−−NRVN−−−−−−−−−−−−−−−−−−−−−−−−−−−SKSNNLYLDN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ILSGNPDLTFPTWLEETAIKDLERTKHK−−−−−−−−E−−LWVPIAYLNQVANK−−−−−−−−−−−RYK−−−FVDKTKRLLLARFKEGY−−−−−−−−TLEDFKQVIDIKTAEWK−−DS−−−−−PEFSKYLRPETLFGSKFDGYLNQKPKTIK     
fig|453362.3.peg.1728   Streptococcus pneumoniae CDC1873-00                        SEDDINMTLAYFTKCGLIQIDDDGHATLSQAKAM−−−−−−−−−−−−−−−−−−−−−−−−VESETNWAKYKREQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RKQAQNMARLESVQDSGTDSNSCPTEIEIE−−−NRVN−−−−−−−−−−−−−−−−−−−−−−−−−−−SKSNNLYLDN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ILSGNPDLTFPTWLEETAIKDLERTKHK−−−−−−−−E−−LWVPIAYLNQVANK−−−−−−−−−−−RYK−−−FVDKTKRLLLARFKEGY−−−−−−−−TLEDFKQVIDIKTAEWK−−DS−−−−−PEFSKYLRPETLFGSKFDGYLNQKPKTIK     
fig|575607.3.peg.1529   Lactobacillus jensenii SJ-7A-US                        GRDALRAGLKELEEKG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YLKRYRKRNDKGQV−−−−−−−−−−−−−−VDSEWILSDVPMFDKPML−−−−−−−−−−−−−NEPMLEKPTQVNRTLQNKYLTKK−−−DNTK−−−−−−−−−−−−−−−−−−−−−−−−−−−ERYIYSPAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PDNSTKKIDK−−−−−−−−SKQVKAIVQFLNEKTGS−−−−−−−−−−−HYR−−ASSAKTKKLIHARLKEGF−−−−−−−−TVDDFEKVIVKKCKDWK−−ND−−−−−SKMAKYLRPETLFGTKFEGYLNE           
fig|596326.3.peg.2589   Lactobacillus jensenii 208-1                        GRDALRAGLKELEEKG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YLKRYRKRNDKGQV−−−−−−−−−−−−−−VDSEWILSDVPMFDKPML−−−−−−−−−−−−−NEPMLEKPTQVNQTLQNKYLTKK−−−DNTK−−−−−−−−−−−−−−−−−−−−−−−−−−−ERYIYSPAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PDNSTKKIDK−−−−−−−−SKQVKAIVQFLNEKTGS−−−−−−−−−−−HYR−−ASSAKTKKLIHARLKEGF−−−−−−−−TVDDFERVIVKKCKDWK−−ND−−−−−SKMSKYLRPETLFGTKFEGYLNE           
fig|596326.3.peg.2269   Lactobacillus jensenii 208-1                        GRASLRAGLKELEDKG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YLKRYRKRNDKGQV−−−−−−−−−−−−−−IDSDWIITDEPMFNNPMS−−−−−−−−−−−−−EKPMFEKPTQVNRTLQNKDLTKK−−−DNTK−−−−−−−−−−−−−−−−−−−−−−−−−−−ERHTKYSLAQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PDNSSKKVEN−−−−−−−−SKQIKTIVQFLNDKTGS−−−−−−−−−−−HYR−−ASSAKTKKLIHARLNEGF−−−−−−−−TVDDFEKVIVKKCKDWK−−AD−−−−−TKMAKYLRPETLFGTKFEGYLNE           
fig|525330.3.peg.172   Lactobacillus johnsonii ATCC 33200                        GKGSMQTARDELVKFG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YLKRKRNRNSKGQ−−−−−−−−−−−−−−−−−−−−−−−−−−−FTDPDWLLIPEPTSDFPMLDKPKQEKPALENQQLQSTNSTKY−−−SSNKVR−−−−−−−−−−−−−−−−−−−−−−−−−TKDIGQVEPD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NPSKSNPEE−−−−−−−−EIPYKEIIDYLNEKTGR−−−−−−−−−−−RFP−−ASAKRSKEPIHARWREGY−−−−−−−−RLQDFKRVIDNKCFSWG−−ND−−−−−PKMSAYLRPTTLFSPKFIDYLNENNIPAN     
fig|315749.4.peg.3025   Bacillus cereus subsp. cytotoxis NVH 391-98                        GLDSLRAGMNELKEHG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YLHRFPVKDDKNKI−−−−−−−−−−−−−−−−VKWETVI−−−YEIPKKEPVAEIPLV−−−−EKPLVEKPLVENPPVENPKLLNT−−−KEPN−−−−−−−−−−−−−−−−−−−−−−−−−−−TKELNTDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKYIVEIVTYLNDVCSS−−−−−−−−−−−SYR−−STTKKTQSLIKARLSEKF−−−−−−−−TVDDFKKVIDVKHAEWT−−G−−−−−−TPQAKYLRPETLFGTKFESYLQQ           
fig|358681.3.peg.2891   Brevibacillus brevis NBRC 100599                        GEDSLRTGLKELKRLG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YLHRFPVKENGKIV−−−−−−−−−−−−−−−−−RWETHV−−−FETPQEELPEEVKPQQ−−−EKPEVEKPDVEFPDVENPTLLSI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNTKYLSLLNNND−−−−−−−−NVPFAEIIEYLNQKAGT−−−−−−−−−−−SYR−−ATSKKTKQLITARWNEGF−−−−−−−−RLDDFIRVIDNKTTEWL−−NN−−−−−PEWSKYLRPETLFSPKFEGYLNQKA         
fig|358681.3.peg.5329   Brevibacillus brevis NBRC 100599                        GEDSLRTGLKELKRLG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YLHRFPVKENGKIV−−−−−−−−−−−−−−−−−RWETHV−−−FETPQEELPEEVKPQQ−−−EKPEVEKPDVEFPDVENPTLLSI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNTKYLSLLNNND−−−−−−−−NVPFAEIIEYLNQKAGT−−−−−−−−−−−SYR−−ATSKKTKQLITARWNEGF−−−−−−−−RLDDFIRVIDNKTTEWL−−NN−−−−−PEWSKYLRPETLFSPKFEGYLNQKA         
fig|469604.7.peg.830   Fusobacterium nucleatum subsp. vincentii 3_1_36A2                        GLESVYSGLKELIEAK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YISRRKNKDGT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDYFVFEDNSENNIIDYSIQKPNCEKPDKEKPNQGFADVLII−−−KDSN−−−−−−−−−−−−−−−−−−−−−−−−−−−NTEYNKKELS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKEN−−−−−−−−IKEIEEVVNHLNEKAGT−−−−−−−−−−−KYK−−SSSKNTTKHIKARINDGY−−−−−−−−TLEDFKTVIDKKCSEWL−−N−−−−−−TDMEKYLCPDTLFGSKFEKYLNQKI         
fig|457396.3.peg.138   Clostridium sp. 7_2_43FAA                                                                                                                                                  DDEVSYKNYVRLSTEKDKG−−−SASK−−−−−−−−−−−−−−−−−−−−−−−−−−−CSSKTNILKD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SSTIDTNLYKY−−−−−−−−−IKEASEIISYLNLSLGT−−−−−−−−−−−KYK−−EKNKGTLTSINKRINEGY−−−−−−−−NVDYFKSVISKKVKKWK−−C−−−−−−TKFEQYLNQQTLFGDKFEVYLNQNII        
fig|457396.3.peg.816   Clostridium sp. 7_2_43FAA                        GKRTIMLRMLKLRDLD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ILTHYTKKEGGTYSFFALGPKYIELISSTKDIKEENL−−−NEKVTKPSNARKGVHENEQGMHRNEQGVHENVEGVCVEMNTG−−−CASE−−−−−−−−−−−−−−−−−−−−−−−−−−−CTTKTHLLNN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SSTKKT−−−−−−−−−−−−−−−LNKKYI−−−−−−−−KKDVDEVVEYLNIKTGA−−−−−−−−−−−RYK−−SNSRNTIKLISARFNDGY−−−−−−−−SVDDFKKVIDKKVKEWK−−G−−−−−−TKFEQYLTPQTLFGNKFENYLNQK−−−−II    
fig|451756.6.peg.2395   Clostridium perfringens CPE str. F4969                        GKDSINTAIKELEKFG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YINRNLKRDEKGKL−−−−−−−−−−−−−−−IGGYDYLI−−−REIPLTEIGF−−−−−PVIGDSPNREKPPLINTEL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKNT−−−−−−−−NNIYSRVIDYLNLKTGK−−−−−−−−−−−TYK−−ATTKKTQSLIKARIEEGF−−−−−−−−IEEEFFKVIDNKVSEWK−−G−−−−−−TDYEKYLRPETLFGNKFEGYLNQ           
fig|333990.5.peg.917   Carnobacterium sp. AT7                                                                                                                                                                 VSEH−−−QVNS−−−−−−−−−−−−−−−−−−−−−−−−−−−DRTTSEQQAH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TYKNDKNEKNDKN−−−−−−−−KDIYSPVVNYLNEKAGT−−−−−−−−−−−NFK−−ASSKATQRLIDARLNEKF−−−−−−−−SEDDFKKVIDNKVNEWS−−SK−−−−−PDMIQYLRPTTLFGTKFEGYLNQKPK        
fig|326036.2.peg.22   Siphoviridae Staphylococcus phage phiETA2                        GLSGLKSGIKELEEIG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YIQRSRKRDKSGRL−−−−−−−−−−−−−−−−NGYEYLV−−−YEQPHHI−−−−−−−−−−−−−−−RFSNVGKTVNGKTNNGKTVN−−−GKSH−−−−−−−−−−−−−−−−−−−−−−−−−−−TTNNNSTNND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNNNNTNNEGSILSGNPTVS−−−−−−−−SIPYKEIIEYLNKKAGK−−−−−−−−−−−HFK−−HNTAKTKDFIKARWNQDF−−−−−−−−RLEDFKKVIDIKTAEWL−−N−−−−−−TDSDKYLRPETLFGSKFEGYLNQKIQPTG     
fig|553581.3.peg.608   Staphylococcus aureus A9299                        GLSGLKSGIKELEEIG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YIQRSRKRDKSGRL−−−−−−−−−−−−−−−−NGYEYLV−−−YEQPHHI−−−−−−−−−−−−−−−RFSNVGKTVNGKTNNGKTVN−−−GKSH−−−−−−−−−−−−−−−−−−−−−−−−−−−TTNNNSTNND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNNNNTNNEGSILSGNPTVS−−−−−−−−SIPYKEIIEYLNKKAGK−−−−−−−−−−−HFK−−HNTAKTKDFIKARWNQDF−−−−−−−−RLEDFKKVIDIKTAEWL−−N−−−−−−TDSDKYLRPETLFGSKFEGYLNQKIQPTG     
fig|1144272.3.peg.1568   Staphylococcus aureus subsp. aureus GR1                        GLSGLKSGIKELEEIG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YIQRSRKRDKSGRL−−−−−−−−−−−−−−−−NGYEYLV−−−YEQPHHI−−−−−−−−−−−−−−−RFSNVGKTVNGKTNNGKTVN−−−GKSH−−−−−−−−−−−−−−−−−−−−−−−−−−−TTNNNSTNND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNNNNTNNEGSILSGNPTVS−−−−−−−−SIPYKEIIEYLNKKAGK−−−−−−−−−−−HFK−−HNTAKTKDFIKARWNQDF−−−−−−−−RLEDFKKVIDIKTAEWL−−N−−−−−−TDSDKYLRPETLFGSKFEGYLNQKIQPTG     
fig|1216363.3.peg.2715   Staphylococcus aureus subsp. aureus 06BA18369                        GLSGLKSGIKELEEIG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YIQRSRKRDKSGRL−−−−−−−−−−−−−−−−NGYEYLV−−−YEQPHHI−−−−−−−−−−−−−−−RFSNVGKTVNGKTNNGKTVN−−−GKSH−−−−−−−−−−−−−−−−−−−−−−−−−−−TTNNNSTNND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNNNNTNNEGSILSGNPTVS−−−−−−−−SIPYKEIIEYLNKKAGK−−−−−−−−−−−HFK−−HNTAKTKDFIKARWNQDF−−−−−−−−RLEDFKKVIDIKTAEWL−−N−−−−−−TDSDKYLRPETLFGSKFEGYLNQKIQPTG     
fig|53369.2.peg.20   Siphoviridae Staphylococcus phage 80alpha                        GLSGLKSGIKELEEIG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YIQRSRKRDKSGRL−−−−−−−−−−−−−−−−NGYEYLV−−−YEQPHHI−−−−−−−−−−−−−−−RFSNVGKTVNGKTNNGKTVN−−−GKSH−−−−−−−−−−−−−−−−−−−−−−−−−−−TTNNNSTNND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNNNNTNNEGSILSGNPTVS−−−−−−−−SIPYKEIIEYLNKKAGK−−−−−−−−−−−HFK−−HNTAKTKDFIKARWNQDF−−−−−−−−RLEDFKKVIDIKTAEWL−−N−−−−−−TDSDKYLRPETLFGSKFEGYLNQKIQPTG     
fig|904738.3.peg.1484   Staphylococcus aureus subsp. aureus 21235                        GLSGLKSGIKELEEIG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YIQRSRKRDKSGRL−−−−−−−−−−−−−−−−NGYEYLV−−−YEQPHHI−−−−−−−−−−−−−−−RFSNVGKTVNGKTNNGKTVN−−−GKSH−−−−−−−−−−−−−−−−−−−−−−−−−−−TTNNNSTNND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNNNNTNNEGSILSGNPTVS−−−−−−−−SIPYKEIIEYLNKKAGK−−−−−−−−−−−HFK−−HNTAKTKDFIKARWNQDF−−−−−−−−RLEDFKKVIDIKTAEWL−−N−−−−−−TDSDKYLRPETLFGSKFEGYLNQKIQPTG     
fig|1116217.3.peg.2683   Staphylococcus aureus subsp. aureus VRS4                        GLSGLKSGIKELEEIG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YIQRSRKRDKSGRL−−−−−−−−−−−−−−−−NGYEYLV−−−YEQPHHI−−−−−−−−−−−−−−−RFSNVGKTVNGKTNNGKTVN−−−GKSH−−−−−−−−−−−−−−−−−−−−−−−−−−−TTNNNSTNND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNNNNTNNEGSILSGNPTVS−−−−−−−−SIPYKEIIEYLNKKAGK−−−−−−−−−−−HFK−−HNTAKTKDFIKARWNQDF−−−−−−−−RLEDFKKVIDIKTAEWL−−N−−−−−−TDSDKYLRPETLFGSKFEGYLNQKIQPTG     
fig|1158535.3.peg.759   Staphylococcus aureus M0562                        GLSGLKSGIKELEEIG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YIQRSRKRDKSGRL−−−−−−−−−−−−−−−−NGYEYLV−−−YEQPHHI−−−−−−−−−−−−−−−RFSNVGKTVNGKTNNGKTVN−−−GKSH−−−−−−−−−−−−−−−−−−−−−−−−−−−TTNNNSTNND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNNNNTNNEGSILSGNPTVS−−−−−−−−SIPYKEIIEYLNKKAGK−−−−−−−−−−−HFK−−HNTAKTKDFIKARWNQDF−−−−−−−−RLEDFKKVIDIKTAEWL−−N−−−−−−TDSDKYLRPETLFGSKFEGYLNQKIQPTG     
fig|1158694.3.peg.1453   Staphylococcus aureus M0719                        GLSGLKSGIKELEEIG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YIQRSRKRDKSGRL−−−−−−−−−−−−−−−−NGYEYLV−−−YEQPHHI−−−−−−−−−−−−−−−RFSNVGKTVNGKTNNGKTVN−−−GKSH−−−−−−−−−−−−−−−−−−−−−−−−−−−TTNNNSTNND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNNNNTNNEGSILSGNPTVS−−−−−−−−SIPYKEIIEYLNKKAGK−−−−−−−−−−−HFK−−HNTAKTKDFIKARWNQDF−−−−−−−−RLEDFKKVIDIKTAEWL−−N−−−−−−TDSDKYLRPETLFGSKFEGYLNQKIQPTG     
fig|130478.1.peg.21   Staphylococcus aureus temperate phage phiSLT                        GLSGLKSGIKELEEIG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YIQRSRKRDKSGRL−−−−−−−−−−−−−−−−NGYEYLV−−−YEQPHHI−−−−−−−−−−−−−−−RFSNVGKTVNGKTNNGKTVN−−−GKSH−−−−−−−−−−−−−−−−−−−−−−−−−−−TTNNNSTNND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNNNNTNNEGSILSGNPTVS−−−−−−−−SIPYKEIIEYLNKKAGK−−−−−−−−−−−HFK−−HNTAKTKDFIKARWNQDF−−−−−−−−RLEDFKKVIDIKTAEWL−−N−−−−−−TDSDKYLRPETLFGSKFEGYLNQKIQPTG     
fig|553596.3.peg.1747   Staphylococcus aureus A9781                        GLSGLKSGIKELEEIG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YIQRSRKRDKSGRL−−−−−−−−−−−−−−−−NGYEYLV−−−YEQPHHI−−−−−−−−−−−−−−−RFSNVGKTVNGKTNNGKTVN−−−GKSH−−−−−−−−−−−−−−−−−−−−−−−−−−−TTNNNSTNND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNNNNTNNEGSILSGNPTVS−−−−−−−−SIPYKEIIEYLNKKAGK−−−−−−−−−−−HFK−−HNTAKTKDFIKARWNQDF−−−−−−−−RLEDFKKVIDIKTAEWL−−N−−−−−−TDSDKYLRPETLFGSKFEGYLNQKIQPTG     
fig|585155.3.peg.2445   Staphylococcus aureus subsp. aureus H19                        GLSGLKSGIKELEEIG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YIQRSRKRDKSGRL−−−−−−−−−−−−−−−−NGYEYLV−−−YEQPHHI−−−−−−−−−−−−−−−RFSNVGKTVNGKTNNGKTVN−−−GKSH−−−−−−−−−−−−−−−−−−−−−−−−−−−TTNNNS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TNNEGSILSGNPTVS−−−−−−−−SIPYKEIIEYLNKKAGK−−−−−−−−−−−HFK−−HNTAKTKDFIKARWNQDF−−−−−−−−RLEDFKKVIDIKTAEWL−−N−−−−−−TDSDKYLRPETLFGSKFEGYLNQKIQPTG     
fig|585152.3.peg.1821   Staphylococcus aureus subsp. aureus D139                        GLSGLKSGIKELEEIG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YIQRSRKRDKSGRL−−−−−−−−−−−−−−−−NGYEYLV−−−YEQPHHI−−−−−−−−−−−−−−−RFSNVGKTVNGKTNNGKTVN−−−GKSH−−−−−−−−−−−−−−−−−−−−−−−−−−−TTNNNSTNND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNNNNTNNEGSILSGNPTVS−−−−−−−−SIPYKEIIEYLNKKAGK−−−−−−−−−−−HFK−−HNTAKTKDFIKARWNQDF−−−−−−−−RLEDFKKVIDIKTAEWL−−N−−−−−−TDSDKYLRPETLFGSKFEGYLNTKNTTN     
fig|585150.3.peg.2460   Staphylococcus aureus subsp. aureus C160                        GLSGLKSGIKELEEIG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YIQRSRKRDKSGRL−−−−−−−−−−−−−−−−NGYEYLV−−−YEQPHHI−−−−−−−−−−−−−−−RFSNVGKTVNGKTNNGKTVN−−−GKSH−−−−−−−−−−−−−−−−−−−−−−−−−−−TTNNNSTNND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNNNNTNNEGSILSGNPTVS−−−−−−−−SIPYKEIIEYLNKKAGK−−−−−−−−−−−HFK−−HNTAKTKDFIKARWNQDF−−−−−−−−RLEDFKKVIDIKTAEWL−−N−−−−−−TDSDKYLRPETLFGNKFEGYLNQKAEPTG     
fig|872294.5.peg.46   Staphylococcus phage SAP-26.                        GQKSINSGVQELMDNK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YVHRIQKRAENGVF−−−−−−−−−−−−−−−−KGFEYLV−−−YEKPTEM−−−−−−−−−−−−−−−PFSENGLSANGFSENGKTEN−−−RKGR−−−−−−−−−−−−−−−−−−−−−−−−−−−TTNNNSTNND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNNNNTNNEGSILSGNPTVS−−−−−−−−SIPYKEIIEYLNKKAGK−−−−−−−−−−−HFK−−HNTAKTKDFIKARWNQDF−−−−−−−−RLEDFKKVIDIKTAEWL−−N−−−−−−TDSDKYLRPETLFGNKFEGYLNQKIQPTG     
fig|387910.2.peg.19   Siphoviridae Staphylococcus aureus phage phiNM4                        GQKSINSGVQELMDNK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YVHRIQKRAENGVF−−−−−−−−−−−−−−−−KGFEYLV−−−YEKPTEM−−−−−−−−−−−−−−−PFSENGLSANGFSENGKTEN−−−RKGR−−−−−−−−−−−−−−−−−−−−−−−−−−−TTNNNSTNND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNNNNTNNDGSILSGNPTVY−−−−−−−−SIPYKEIIEYLNKKAGK−−−−−−−−−−−HFK−−HNTAKTKDFIKARWNQDF−−−−−−−−RLEDFKKVIDIKTAEWL−−N−−−−−−TDSDKYLRPETLFGSKFEGYLNQKIQPTG     
fig|553581.3.peg.2063   Staphylococcus aureus A9299                        GQKSINSGVQELMDNK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YVHRIQKRAENGVF−−−−−−−−−−−−−−−−KGFEYLV−−−YEKPTEM−−−−−−−−−−−−−−−PFSENGLSANGFSENGKTEN−−−RKGR−−−−−−−−−−−−−−−−−−−−−−−−−−−TTNNNSTNND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNNNNTNNDGSILSGNPTVY−−−−−−−−SIPYKEIIEYLNKKTGK−−−−−−−−−−−HFK−−HNTAKTKDFIKARWNQDF−−−−−−−−RLEDFKKVIDIKTAEWL−−N−−−−−−TDSDKYLRPETLFGNKFEGYLNQKAEPTG     
fig|585157.3.peg.1198   Staphylococcus aureus subsp. aureus M809                        GQKSINSGVQELMDNK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YVHRIQKRAENGVF−−−−−−−−−−−−−−−−KGFEYLV−−−YEKPTEM−−−−−−−−−−−−−−−PFSENGLSANGFSENGKTEN−−−RKGR−−−−−−−−−−−−−−−−−−−−−−−−−−−TTNNNSTNND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNNNNTNNDGSILSGNPTVY−−−−−−−−SIPYKEIIEYLNKKTGK−−−−−−−−−−−HFK−−HNTAKSKDFIKARWNQDF−−−−−−−−RLEDFKKVIDIKTAEWL−−N−−−−−−TDSDKYLRPETLFGNKFEGYLNQKAQPTG     
fig|360398.2.peg.22   Staphylococcus phage                        GQKSINSGVQELMDNK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YVHRIQKRAENGVF−−−−−−−−−−−−−−−−KGFEYLV−−−YEKPTEM−−−−−−−−−−−−−−−PFSENGLSANGFSENGKTEN−−−RKGR−−−−−−−−−−−−−−−−−−−−−−−−−−−TTNNNSTNND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNNNNTNNDGSILSGNPTVY−−−−−−−−SIPYKEIIEYLNKKTGK−−−−−−−−−−−HFK−−HNTAKSKDFIKARWNQDF−−−−−−−−RLEDFKKVIDIKTAEWL−−N−−−−−−TDSDKYLRPETLFGNKFEGYLNQKAQPTG     
fig|585159.3.peg.2056   Staphylococcus aureus subsp. aureus M899                        GQKSINSGVQELMDNK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YVHRIQKRAENGVF−−−−−−−−−−−−−−−−KGFEYLV−−−YEKPTEM−−−−−−−−−−−−−−−PFSENGLSANGFSENGKTEN−−−RKGR−−−−−−−−−−−−−−−−−−−−−−−−−−−TTNNNSTNND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTNNNNTNNDGSILSGNPTVY−−−−−−−−SIPYKEIIEYLNKKTGK−−−−−−−−−−−HFK−−HNTAKSKDFIKARWNQDF−−−−−−−−RLEDFKKVIDIKTAEWL−−N−−−−−−TDSDKYLRPETLFGNKFEGYLNQKAQPTG     
fig|585161.3.peg.1828   Staphylococcus aureus subsp. aureus WW2703/97                        TKVTVSRRIANLKECG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YLHVEIIRNGNEIK−−−−−−−−−−−−−−−QRKLYPLT−−−−−−−−−−−−−−−−−−−−EMIRPINTNDNTPINNSVNAPIITN−−−VKEN−−−−−−−−−−−−−−−−−−−−−−−−−−−NTSINNTSNN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NINRVDILSGNPT−−−−−−−−−−RIPYKEIIDYLNEKTGK−−−−−−−−−−−KFK−−HNTTKTKDFIKARWNQDF−−−−−−−−RLEDFKKVIDIKTAEWL−−N−−−−−−TDSDKYLRPETLFGSKFEGYLNQKIQPTG     
fig|1116224.3.peg.822   Staphylococcus aureus subsp. aureus VRS11a                         KETISRRISNLTNFG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YLKIEIIKEGNEVK−−−−−−−−−−−−−−−QRKMYPLT−−−−−−−−−−−−−−−−−−−−QTSIPIDAKINTPIDNSVNTPIDAN−−−VKEN−−−−−−−−−−−−−−−−−−−−−−−−−−−ITSINNTSNN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NINRIDILSGNPT−−−−−−−−−−RIPYKEIIDYLNEKTGK−−−−−−−−−−−KFS−−HKSKANQKLIQARFNEDN−−−−−−−−SKEDFFTVIDNMTAQWK−−GN−−−−−PKMDEYLRPKTLFSGNFDNYKNQTAKINN     
fig|931444.3.peg.1381   Staphylococcus aureus subsp. aureus CIG1150                         KETISRRISNLIKFG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YLKIEIIKEGNEVK−−−−−−−−−−−−−−−QRKMYPLT−−−−−−−−−−−−−−−−−−−−QSSMPIDAKINTPIDNSVNTPIDAN−−−VKEN−−−−−−−−−−−−−−−−−−−−−−−−−−−NTSINNTSNN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NINRIDILSGNPTAS−−−−−−−−SIPYKEIIDYLNKKAGK−−−−−−−−−−−HFK−−HNTAKTKDFIKARWNQDF−−−−−−−−RLEDFKKVIDIKTAEWL−−N−−−−−−TDSDKYLRPETLFGNKFEGYLNQKAEPTG     
fig|525375.3.peg.1914   Staphylococcus epidermidis M23864:W2(grey)                        SKYQVMRSIKKLKSMG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IVETALKKANGAPT−−−−−−−−−−−−−−−−−VHYKVD−−−SKVTSQWIVK−−−−−−−−−−−−FLNNGKSTYLTMDSKETQKS−−−LTEI−−−−−−−−−−−−−−−−−−−−−−−−−−−TTEITTEITN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNILSPSST−−−−−−−−AYPYKDVIDYLNQQTGK−−−−−−−−−−−NYK−−STTKKNQTVIRSRTDEGF−−−−−−−−SLDDFKRVIDNKVAEWK−−G−−−−−−TNMEKYLRPETLFGTKFEGYLNQELQPSG     
fig|527000.3.peg.931   Bacillus pseudomycoides DSM 12442                        R−−−−−−AIKILIDKG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FVEVKKFKFNGAPT−−−−−−−−−−−−−−−−−NHIKLN−−−TSEVTERVKW−−−−−−−−−ILTFGEIPNSPLSEMELIETVNS−−−LTEI−−−−−−−−−−−−−−−−−−−−−−−−−−−TTETTTKSTT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LEDNMSSDQKERSKD−−−−−−−−CIPYEDIVSYLNEKAGK−−−−−−−−−−−SYK−−YKTAKTKDLIKARFNQGF−−−−−−−−TIEDFKKVIDIKASHWL−−TD−−−−−EEYNQYLRPSTLFGTKFEEYLNQQPK        
fig|347495.3.peg.5396   Bacillus cereus F837/76                        TERQVRYSTKKLVASG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YVETALKKANGAPT−−−−−−−−−−−−−−−−−VHYKLD−−−FDKLLDSILT−−−−−−−−−−−−NCQNGNLHIVGMEPDKMSES−−−LTEI−−−−−−−−−−−−−−−−−−−−−−−−−−−TTETTTKITT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKDNMSSDQKERSKD−−−−−−−−YIPYEDIVSYLNEQAGK−−−−−−−−−−−SFK−−HKTAKTRSLIKARFKDGF−−−−−−−−TIDDFKQVIDIKTAQWL−−TD−−−−−QNMNQYLRPETLFGTKFEGYLNEK          
fig|412694.7.peg.26   Bacillus thuringiensis str. Al Hakam                        TERQVRYSTKKLVASG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YVETALKKANGAPT−−−−−−−−−−−−−−−−−VHYKLD−−−FDKLLDSILT−−−−−−−−−−−−NCQNGNLHIVGMEPDKMSES−−−LTEI−−−−−−−−−−−−−−−−−−−−−−−−−−−TTETTTKITT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKDNMSSDQKERSKD−−−−−−−−YIPYEDIVSYLNEQAGK−−−−−−−−−−−SFK−−HKTAKTRSLIKARFKDGF−−−−−−−−TIDDFKQVIDIKTAQWL−−TD−−−−−QNMNQYLRPETLFGTKFEGYLNEK          
fig|563194.3.peg.1655   Pediococcus acidilactici 7_4                        LKLLLTKQFIFAFESG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VVVIKDWKIHNYIR−−−−−−−−−−−−−−−KDTYNTTI−−−YGDEKEQLEQDANGSYTLR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LRAVDEPSTQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VRLGKVRLG−−−−−KDSNIYSSSNDEPHID−−−−−−LKKFKEIISYLNEKAGT−−−−−−−−−−−KYR−−ASGSKTQRLIKARFNDGF−−−−−−−−NDEDFKKVIDIKVAEWS−−G−−−−−−TDMAKYLRPETLFGTKFESYLNQQIKPK      
fig|278197.10.peg.897   Pediococcus pentosaceus ATCC 25745                        LKLLLTKNFIFAFESG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VVVIKDWKIHNYIR−−−−−−−−−−−−−−−KDTYNTTI−−−YGDEKEQLSQDENGSYTLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PRAVDEPSPQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VRLGKVRLG−−−−−KDNNIYSSSNDEPHID−−−−−−LKTFKEIISYLNEKAGT−−−−−−−−−−−KYR−−ASGSKTQRLIKARFNDGF−−−−−−−−NDEDFKKVINIKVAEWS−−G−−−−−−TDMAKYLRPETLFGTKFESYLNQEVKKSK     
fig|762051.3.peg.1867   Leuconostoc kimchii IMSNU11154         NTKTIQRMIGSSEDDRKLLIAKQFLLPFDSG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VVVIKDWRVHNYIR−−−−−−−−−−−−−−−KDTYNKTI−−−YPNELEQLQINESGQYEHRNLVTYTER−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PRDVDETLTQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VRLGKDRLGKVRIDKDSKDILSGSDEPD−−−−−−−−HVPYKEIVDYLNKKTGN−−−−−−−−−−−KYR−−NSGSKTKSLIKTRFNEGF−−−−−−−−SLDDFKAVIDVKSSQWL−−ND−−−−−QKMNKFLRPETLFSNKFESYLNENNVKPNN    
fig|762051.3.peg.429   Leuconostoc kimchii IMSNU11154                        LSLLKAKGFIIMFENG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSVVKDWNLNNKIR−−−−−−−−−−−−−−−KDRMKPTI−−−YRSEKSILNVDVDGSYFIRNKMTTIS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QPDDNQMSAQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DRLGKDRLG−−−−−KDSKDILSGSDEPD−−−−−−−−HVPYKEIVDYLNKKTRN−−−−−−−−−−−KYR−−SSGSKTKSLIKARFNEGF−−−−−−−−SLDDFKAVIDVKSSQWV−−ND−−−−−QKMNKFLRPETLFSNKFEGYLNENNVKPNN    
fig|525326.3.peg.994   Lactobacillus gasseri JV-V03                        LKILIEKGYVLVFEDG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AIAITDWFVHNYIP−−−−−−−−−−−−−−−KDRYHETV−−−YKEDKKQLELSETK−−−−−QYRLVTSSPIVQDTESKQNDNNL−−−DTPC−−−−−−−−−−−−−−−−−−−−−−−−−−−IQDDNKVYTE−−−−−−−−−−−−−−−−−−VKLSKV−−−−−−KLSKDNINKSSSSEN−−−−−−−−−−−VDPKPKQKSQ−−−−−−−−KIPYEKIIDYLNRKTNS−−−−−−−−−−−HYR−−PTSKATRRLIKARYNEGF−−−−−−−−TDIDFKTVIDKKCAEWL−−QD−−−−−GNMVQYLRPETLFGTKFEAYLN            
fig|324831.10.peg.555   Lactobacillus gasseri ATCC 33323                        LKILVEKGYVIVFEDG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VIAITDWFVHNYIP−−−−−−−−−−−−−−−KDRYHETV−−−YKEDKKQLELSETK−−−−−QYRLVTRKPIVQDTKSKQVVDNM−−−DTSC−−−−−−−−−−−−−−−−−−−−−−−−−−−IQDDNKVYTE−−−−−−−−−−−−−−−−−−DKLSKD−−−−−−KLSKDNNIYKLSSSEN−−−−−−−−−−−IDTDPEQKSQ−−−−−−−−KIPYEKIIDYLNRKTNS−−−−−−−−−−−HYR−−PTSKATRRLIKARYNEGF−−−−−−−−TDIDFKSVIDKKCAEWL−−QD−−−−−GNMVQYLRPETLFGTKFEAYLNQ           
fig|324831.10.peg.606   Lactobacillus gasseri ATCC 33323                        LKILVEKGYVIVFEDG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VIAITDWFVHNYIP−−−−−−−−−−−−−−−KDRYHETV−−−YKEDKKQLELSETK−−−−−QYRLVTRKPIVQDTKSKQVVDNM−−−DTSC−−−−−−−−−−−−−−−−−−−−−−−−−−−IQDDNKVYTE−−−−−−−−−−−−−−−−−−DKLSKD−−−−−−KLSKDNNIYKLSSSEN−−−−−−−−−−−IDTDPEQKSQ−−−−−−−−KIPYEKIIDYLNRKTNS−−−−−−−−−−−HYR−−PTSKATRRLIKARYNEGF−−−−−−−−TDIDFKSVIDKKCAEWL−−QD−−−−−GNMVQYLRPETLFGTKFEAYLNQ           
fig|1154822.3.peg.203   Streptococcus agalactiae LMG 15093                        MKLLIAKGFLIPFDSG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VVVIRHWRIHNYIQ−−−−−−−−−−−−−−−SDRFQSTL−−−YQSEKAQLEYDKSKTASLKPIGNC−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IQNVSKMETQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VRLSKGSLDKDSLTT−−−YPTVSDNEEE−−−−−−−−DIPYKEIISYLNEKANR−−−−−−−−−−−NYR−−PNIQKNKTLIKARWSEGF−−−−−−−−RLDDFKHVIDTTVKDWS−−G−−−−−−TKYEKYLRPETLFGSKFEGYLNQAP         
fig|575596.3.peg.1357   Lactobacillus crispatus MV-1A-US                          RSVNRYLELLEEKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LISRENIKSSENGA−−−−−−−−−−−−−−−−−−−−−−−−−−IIGRKIRAGDDLMTYMSRGWQNECQGGTGTDVVAPMTPRSTK−−−YNSN−−−−−−−−−−−−−−−−−−−−−−−−−−−NR