(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020380

fig|525378.3.peg.588   Staphylococcus epidermidis M23864:W1                                                MLNYITRQPLIEVN−−KNELKDI−−−−RTAFISKNE−−KNKRDSLNILGAGVAVLIATLTRSLIDYLNFSTNILINIMFVLIAIIPIVLIKSIVDRKKK−−TKLGIEL−−−−SYAESKAFILPNSKVLFQNIIYN−−−−−−LPITFIFIATTYGFLWLK−−−−QTNIIFVLGIMIFLTFILFQNVILY            
fig|525376.3.peg.328   Staphylococcus epidermidis W23144                                                 MNYLTKQVLIEID−−KDQLGNI−−−−RKNHINEN−−−−−KNNALGSIGTGIGVLFGILSKPILDYMNFTTNLLLNIILVLIAIIPLITLKEIINRKKK−−KKLKIRM−−−−TKNKMSAFVLPNFKELFKNTIIN−−−−−−IILSFIIIALVFGFIIRN−−−−QSNYIYILGIMLVLSFILFQNVLLY            
fig|979211.3.peg.1739   Staphylococcus epidermidis NIHLM023                                                 MNYLTKQVLIEID−−KDQLGNI−−−−RKNHINEN−−−−−KNNALGSIGTGIGVLFGILSKPILDYMNFTTNLLLNIILVLIAIIPLITLKEIINRKKK−−KKLKIRM−−−−TKNKMSAFVLPNFKELFKNTIIN−−−−−−IILSFIIIALVFGFIIRN−−−−QSNYIYILGIMLVLSFILFQNVLLY            
fig|525378.3.peg.1808   Staphylococcus epidermidis M23864:W1            IETIKKNSKYKLIHYRDSHYIIDLNQNKLTYIFPLLNYVTRKSLVEVK−−EKDLNDI−−−−TTIFTSKEE−−KEKRDSLTILASGISGFIAITTKSITDYLEFTTNMYINVFILLLTILPTLAFKNIFDNKKK−−−KIMIRS−−−−TEVQAYAFVLPSKKYIFQNIFLY−−−−−−TFFIYMFIVSVAGVLTLK−−−−HTNIFFVVGIIITFMAILFQNLVLYAQTTIH      
fig|525378.3.peg.586   Staphylococcus epidermidis M23864:W1           EIISIKGNSKYKLIKYEGKNYVIDLNSNKLSYIFPLLNYFAPHKLIEVS−−LNDINNEK−−−SI−−−TKNE−−DKLNDALLSLSVGITVILGVLLRPLFDYGNFPSSRIFNLLIILLTNFALILTKFIFDKRKR−−DVLALRN−−−−GTNVKLAYILPNFKIVIKNTVLY−−−−−−LILSFLYLMSLIAFYSME−−−−NSNIFFILTMIIFLLLILFQNIRLYGKIKIYGKI   
fig|1034809.4.peg.631   Staphylococcus lugdunensis N920143               IKNNSKYKIIHDGEKHYVIDLNRNKLTYIFPLLNYLLPHRLMEIS−−DDAYFSL−−−−TT−−−VQQSVESKVKNMMITLIGIVILFIYYRANVVDNFFLKHYPPL−−−IIIALMVLIFIIKWLIDKRKR−−KRLNIEQ−−−−IETEKRAYIFPEIFTMVISIILY−−−−−−VIAVVSFVFLSFKIFGSMGEPHLNSNVLIIMLAIILSFDQLLYSNSETSGKMSHIKVK  
fig|698737.3.peg.632   Staphylococcus lugdunensis HKU09-01               IKNNSKYKIIHDGEKHYVIDLNRNKLTYIFPLLNYLLPHRLMEIS−−DDAYFSL−−−−TT−−−VQQSVESKVKNMMITLIGIVILFIYYRANVVDNFFLKHYPPL−−−IIIALMVLIFIIKWLIDKRKR−−KRLNIEQ−−−−IETEKRAYIFPEIFTMVISIILY−−−−−−VIAVVSFVFLSFKIFGSMGEPHLNSNVLIIMLAIILSFDQLLYSNSETSGKMSHIKVK  
fig|525378.3.peg.1856   Staphylococcus epidermidis M23864:W1               IGESNRYKLIIYSGSFYILDIEKNIFTYFFPFINYLFPRYLREID−−QTTAERL−−−−MT−−−KQKS−−EVKKSNYVFPICLSIIISTLLRTVVHQFDISVNSIFLLFSVITSISSVLLLRLWLSYFNN−−KHIEIKY−−−−SNHKIKALLIPPRKYIFKSIGIF−−−−−−CYFSILYCLGMYAFIVSN−−−−KFNLLILIAGMILLFIITLTNYFLY            
fig|525376.3.peg.326   Staphylococcus epidermidis W23144               IHKNPRYKLIELNQKKYLIDLEANYFFYLFPMLNWILKKELIEIT−−NDKLNEI−−−−EY−−−DNKTNKERSQNIRWISGGAGVLMALLMRPFMDLLDVPSNIYINIIIFIILVFSVISIRIYLRKKWD−−LKLKE−−−−−−NNPRMNCKMRPTFKYMIVATGAY−−−−−−LLFLALSIFMFPLIFLEK−−−−−LNILMCLCSLTFFFFFSIMNIIAFDNEKVII     
fig|979211.3.peg.1741   Staphylococcus epidermidis NIHLM023               IHKNPRYKLIELNQKKYLIDLEANYFFYLFPMLNWILKKELIEIT−−NDKLNEI−−−−EY−−−DNKTNKERSQNIRWISGGAGVLMALLMRPFMDLLDVPSNIYINIIIFIILVFSVISIRIYLRKKWD−−LKLKE−−−−−−NNPRMNCKMRPTFKYMIVATGAY−−−−−−LLFLALSIFMFPLIFLEK−−−−−LNILMCLCSLTFFFFFSIMNIIAFDNEKVII     
fig|525376.3.peg.345   Staphylococcus epidermidis W23144               IHKNPRYKVIELNKTKYLIDLESNYVTYLLPMLNWILDKELIEVS−−RETLEKI−−−−EY−−−DNNTNKEQTKGLGWLAGGGGVLFATLMRPFMDLMNIPSNLFINLLIVILSIIIVVFIRAYLRKKWD−−LKLKQ−−−−−−KNHVIKCKVRSNAKHMFTAIALY−−−−−−FMFLLQSIFMISLIFGVK−−−−−NNLIIYIGLPIIIFVFSLTNLITYDNNEVIV     
fig|979211.3.peg.318   Staphylococcus epidermidis NIHLM023               IHKNPRYKVIELNKTKYLIDLESNYVTYLLPMLNWILDKELIEVS−−RETLEKI−−−−EY−−−DNNTNKEQTKGLGWLAGGGGVLFATLMRPFMDLMNIPSNLFINLLIVILSIIIVVFIRAYLRKKWD−−LKLKQ−−−−−−KNHVIKCKVRSNAKHMFTAIALY−−−−−−FMFLLQSIFMISLIFGVK−−−−−NNLIIYIGLPIIIFVFSLTNLITYDNNEVIV     
fig|525376.3.peg.327   Staphylococcus epidermidis W23144               IHKNPRYKLIELDQKKYLIDLESNCFTYLFPPLNWILKKELIEIS−−NDKLNEI−−−−EY−−−DDNNNKEQAKNIGCVSGGGGVLIATLMRPFMDLMDVPSNQSINSLIVILTVLVIIFIRGSLRKRWD−−LKLNSS−−−−−KTHIIKCIVRFKLKHMFFVIGAY−−−−−−LMFLLFSLLMIGLIFGVE−−−−−NNLMIYIGSPLIFFMFSLTNLITYDNEEIII     
fig|979211.3.peg.1740   Staphylococcus epidermidis NIHLM023               IHKNPRYKLIELDQKKYLIDLESNCFTYLFPPLNWILKKELIEIS−−NDKLNEI−−−−EY−−−DDNNNKEQAKNIGCVSGGGGVLIATLMRPFMDLMDVPSNQSINSLIVILTVLVIIFIRGSLRKRWD−−LKLNSS−−−−−KTHIIKCIVRFKLKHMFFVIGAY−−−−−−LMFLLFSLLMIGLIFGVE−−−−−NNLMIYIGSPLIFFMFSLTNLITYDNEEIII     
fig|386043.6.peg.1884   Listeria welshimeri serovar 6b str. SLCC5334            IRPIFKNTRYKILEYDSKFYLIDMDRGFYGFILFALSWLIPKKAILIP−−QMDADDL−−−−−I−−−IKKA−−YKSSHSIRVILLMCVIIISNLVLPSFLMKFFEGGLILS−−LCILSIFGVLIRIIYSKRNK−−IKCKNRE−−−−GNQEVLIKLRPQKWPYYFKSVCVY−−−−−−VLFLAVLVIGAYLFIIVK−−−−−GYWILSFCYTIVIFIFLLTNYLAY            
fig|386043.6.peg.2009   Listeria welshimeri serovar 6b str. SLCC5334            IRPIFKNTRYKILEYDSKFYLIDMDRGFYGFILFALSWLIPKKAILIP−−QMDADDL−−−−−I−−−IKKA−−YKSSHSIRVILLMCVIIISNLVLPSFLMKFFEGGLILS−−LCILSIFGVLIRIIYSKRNK−−IKCKNRE−−−−GNQEVLIKLRPQKWPYYFKSVCVY−−−−−−VLFLAVLVIGAYLFIIVK−−−−−GYWILSFCYTIVIFIFLLTNYLAY            
fig|386043.9.peg.1948   Listeria welshimeri serovar 6b str. SLCC5334     MKINVGKIRPIFKNTRYKILEYDSKFYLIDMDRGFYGFILFALSWLIPKKAILIP−−QMDADDL−−−−−I−−−IKKA−−YKSSHSIRVILLMCVIIISNLVLPSFLMKFFEGGLILS−−LCILSIFGVLIRIIYSKRNK−−IKCKNRE−−−−GNQEVLIKLRPQKWPYYFKSVCVY−−−−−−VLFLAVLVIGAYLFIIVK−−−−−GYWILSFCYTIVIFIFLLTNYLAY            
fig|386043.9.peg.2076   Listeria welshimeri serovar 6b str. SLCC5334     MKINVGKIRPIFKNTRYKILEYDSKFYLIDMDRGFYGFILFALSWLIPKKAILIP−−QMDADDL−−−−−I−−−IKKA−−YKSSHSIRVILLMCVIIISNLVLPSFLMKFFEGGLILS−−LCILSIFGVLIRIIYSKRNK−−IKCKNRE−−−−GNQEVLIKLRPQKWPYYFKSVCVY−−−−−−VLFLAVLVIGAYLFIIVK−−−−−GYWILSFCYTIVIFIFLLTNYLAY            
fig|221109.1.peg.1333   Oceanobacillus iheyensis HTE831        MKCEVQLLYKNLRYRILEINGEEYVLDFGNSIWKIIFPFLHWVLPNPVYKID−−NHEIIEKL−−−−EV−−−PQENHPKKISTGTGALGGLVGGVFLANLLRPLANVFNIPSTSLVNLIITIIVLIIALSVFVYVNRRHE−−KNLTAIVDYTHYPRKKIWIKPPTLKFFFNICFAY−−−−−−LFFMALTVVPLMGFIE−−−−−−TGDMFIFVPGVVFLFVSFMITYMTIPPGNTTVRFK  
fig|221109.4.peg.1350   Oceanobacillus iheyensis HTE831       ILKCEVQLLYKNLRYRILEINGEEYVLDFGNSIWKIIFPFLHWVLPNPVYKID−−NHEIIEKL−−−−EV−−−PQENHPKKISTGTGALGGLVGGVFLANLLRPLANVFNIPSTSLVNLIITIIVLIIALSVFVYVNRRHE−−KNLTAIVDYTHYPRKKIWIKPPTLKFFFNICFAY−−−−−−LFFMALTVVPLMGFIE−−−−−−TGDMFIFVPGVVFLFVSFMITYMTIPPGNTTVRFK  
fig|221109.1.peg.1324   Oceanobacillus iheyensis HTE831        MNCNVQFVFKNLRYRILEIDEEEYILDMGNSVWKIIFPFLHWVLPNPVYKLD−−NHEIVKRL−−−−KV−−−PEREQPKTISAGTGALGGLIGVFLASLIRPLANMFHIPSTSLINFIITILVVIIALSVFIYINTRSK−−NNLTAIVDYKHYPRKKLWIRPPSLKFFSSLCFFY−−−−−−LFFMALTVVPLMGFI                                            
fig|221109.4.peg.1340   Oceanobacillus iheyensis HTE831        MNCNVQFVFKNLRYRILEIDEEEYILDMGNSVWKIIFPFLHWVLPNPVYKLD−−NHEIVKRL−−−−KV−−−PEREQPKTISAGTGALGGLIGVFLASLIRPLANMFHIPSTSLINFIITILVVIIALSVFIYINTRSK−−NNLTAIVDYKHYPRKKLWIRPPSLKFFSSLCFFY−−−−−−LFFMALTVVPLMGFI                                            
fig|221109.1.peg.1340   Oceanobacillus iheyensis HTE831        MKCNVQGVFKNLRYRIVEIDEEKYILDMGNSIWKIIFPFLHWVLPKPVYKID−−NQVIVEKL−−−−KV−−−PDGSQPKTISTGTGALGGLIGVVLASLIRPLANMFHIPSTPLINFIITIVVVIIALSVFVYINTRSK−−RKLTAIVDYNHYPRKKLWIRLPSLKFFFNISFSY−−−−−−LFFMAFTVVPFMGFIE−−−−−−TGNIIVFIGSI                          
fig|221109.4.peg.1358   Oceanobacillus iheyensis HTE831        MKCNVQGVFKNLRYRIVEIDEEKYILDMGNSIWKIIFPFLHWVLPKPVYKID−−NQVIVEKL−−−−KV−−−PDGSQPKTISTGTGALGGLIGVVLASLIRPLANMFHIPSTPLINFIITIVVVIIALSVFVYINTRSK−−RKLTAIVDYNHYPRKKLWIRLPSLKFFFNISFSY−−−−−−LFFMAFTVVPFMGFIE−−−−−−TGNIIVFIGSI                          
fig|221109.1.peg.1338   Oceanobacillus iheyensis HTE831        MYCKAQAVYKNPRYKILVINEQRYILDMGGKSFWKILFPFMYWIFPNNTYKVN−−NLEIIEKI−−−−KT−−−PDIDQKDVGGGMSILGGVVAILLANLLRPLANVFNIPSTPIVNAIIVLMVLLLVLILVFNISKRCK−−KRINHELDIEQYEEEQVWIRPNSIKQLLFILFAY−−−−−−LFFLGFTTLALSGFIY−−−−−−SGDVMTLVMGTPILLVLLAISIITI            
fig|221109.4.peg.1356   Oceanobacillus iheyensis HTE831        MYCKAQAVYKNPRYKILVINEQRYILDMGGKSFWKILFPFMYWIFPNNTYKVN−−NLEIIEKI−−−−KT−−−PDIDQKDVGGGMSILGGVVAILLANLLRPLANVFNIPSTPIVNAIIVLMVLLLVLILVFNISKRCK−−KRINHELDIEQYEEEQVWIRPNSIKQLLFILFAY−−−−−−LFFLGFTTLALSGFIY−−−−−−SGDVMTLVMGTPILLVLLAISIITI            
fig|221109.1.peg.1335   Oceanobacillus iheyensis HTE831        MNCKVNHLDKNMRYRILIINSEQYILDMERSFWKIIFPFLFWLTPSPVFKVE−−DQDIVEEL−−−−KM−−−VKKE−−KLESSWILSLGGFGYAIGILLAPLMDYFNIPSSPLINNILLIIAIALTAFLYFGISYRRQ−−KKLQNIVELKELPRSKLWIRPSSTNLVFKFLTAY−−−−−−ICLLGFVSFLFLGFID−−−−−−TRNIMILIIASGFFFLLLLANRPTVDEGNTTVKFKDY
fig|221109.4.peg.1352   Oceanobacillus iheyensis HTE831        MNCKVNHLDKNMRYRILIINSEQYILDMERSFWKIIFPFLFWLTPSPVFKVE−−DQDIVEEL−−−−KM−−−VKKE−−KLESSWILSLGGFGYAIGILLAPLMDYFNIPSSPLINNILLIIAIALTAFLYFGISYRRQ−−KKLQNIVELKELPRSKLWIRPSSTNLVFKFLTAY−−−−−−ICLLGFVSFLFLGFID−−−−−−TRNIMILIIASGFFFLLLLANRPTVDEGNTTVKFKDY
fig|221109.1.peg.1342   Oceanobacillus iheyensis HTE831        MDCKVNGVYKNLRYRILVINSHTYILDLGKSFWKIIFPFLIWILPNPLYKIE−−NKEIVEKL−−−−KT−−−PEVH−−QTNTGGQGLIGGGIAVLIANLLRPLTDYFNIQSSTMVNSVIVIVAILLLLSLRLYINHLNK−−KNLYRVIEAEKLTPDKVLISPKPIKHFFLILGMY−−−−−−LFFLAFTILLFIAFIQ−−−−−−IPNILILLITMSLWFLVLFTNSITIAVGNTRVKF   
fig|221109.4.peg.1362   Oceanobacillus iheyensis HTE831        MDCKVNGVYKNLRYRILVINSHTYILDLGKSFWKIIFPFLIWILPNPLYKIE−−NKEIVEKL−−−−KT−−−PEVH−−QTNTGGQGLIGGGIAVLIANLLRPLTDYFNIQSSTMVNSVIVIVAILLLLSLRLYINHLNK−−KNLYRVIEAEKLTPDKVLISPKPIKHFFLILGMY−−−−−−LFFLAFTILLFIAFIQ−−−−−−IPNILILLITMSLWFLVLFTNSITIAVGNTRVKF   
fig|272558.1.peg.979   Bacillus halodurans C-125                 MNVRFRILKIEGDTYILDMSQSIWKIVFPFLTWIIPLTIYKVD−−GEEINKKL−−−−QF−−−STKD−−QKKNNISILLTAGIGIALGNLLTALTDYFYIQSTVLVNSIIAGIVMGIIIVVRFVLSNRNK−−NNFYQRVAPNVLSKERIWIRPKSFKHFIQALFGY−−−−−−IFFLVFFIAAIVLFIT−−−−−−GGNVIAIVSATIFALALSVIDVLYVVEGPTTVKFKK 
fig|221109.1.peg.3293   Oceanobacillus iheyensis HTE831        MSSEVNIIKKNLRYNLIKADNEYYIIDKDQPFLTNFLLPFLYWIFPKKVTKIS−−GDTAEQI−−−−QT−−−VSNK−−EATTSKVSYIGIGFSVILANLIGPLLDYLDVDITPFIAYSILFLITLLLVLFRVIVSNKFK−−HSLFQQLHLSPNQADETLWVTPRRVKNIASLLFLT−−−−−−IFIWAFVVGGLVSFFL−−−−−−YGNLFMLFVFTLAFFILLFLNI               
fig|221109.4.peg.3343   Oceanobacillus iheyensis HTE831        MSSEVNIIKKNLRYNLIKADNEYYIIDKDQPFLTNFLLPFLYWIFPKKVTKIS−−GDTAEQI−−−−QT−−−VSNK−−EATTSKVSYIGIGFSVILANLIGPLLDYLDVDITPFIAYSILFLITLLLVLFRVIVSNKFK−−HSLFQQLHLSPNQADETLWVTPRRVKNIASLLFLT−−−−−−IFIWAFVVGGLVSFFL−−−−−−YGNLFMLFVFTLAFFILLFLNI               
fig|467705.8.peg.1435   Streptococcus gordonii str. Challis substr. CH1                KRNLRYRILKTEDEYYLLDVERPFLIVYFLPLLIYFVPHRCYEMS−−KDEYEQLSQSMEKNTRLKEA−−FEKHGLGYSLGAGIGAMLLSRVFDINQFLKFDSSRISNFLAILIVLLVFGLRLWITASHE−−−VLSGLK−−−−NRGYHKIYVYPRFVKELFFNIFAY−−−−−−IISVLLTIVLISAFFTNQ−−−−VDNYIVHIGLLIFLSFWLFIGNMF             
fig|1138889.3.peg.1031   Enterococcus faecium E1050                    RYVILESKSGYYLIDTDHYTFWGGYLFPIFNWIIPHKVMKINLPAEEINRLILNKDL−−−QRKR−−EKEHSNVAWIGPAFAVVTSSIVGPMLESIYSDFSIGIRYLFVTLSIAVLLCIKGYVSKKNKDILTLIGVN−−−−NLSSTKIILFPESIKEGSRLLIIF−−−−−−IMLILFSVLFGVMFI−−D−−−−TNNWFILAGVMLFSSFYL                   
fig|565665.3.peg.1555   Enterococcus faecium D344SRF                    RYVILESKSGYYLIDTDHYTFWGGYLFPIFNWIIPHKVMKINLPAEEINRLILNKDL−−−QRKR−−EKEHSNVAWIGPAFAVVTSSIVGPMLESIYSDFSIGIRYLFVTLSIAVLLCIKGYVSKKNKDILTLIGVN−−−−NLSSTKIILFPESIKEGSRLLIIF−−−−−−IMLILFSVLFGVMFI−−D−−−−TNNWFILAGVMLFSSFYL                   
fig|979221.3.peg.1756   Staphylococcus epidermidis NIH05001               IYKNPRYNIIQKDNRYLMVDLEQNWYSYLCPMLNWFIPIKFTELT−−YQEFNNI−−−−NI−−−FHNG−−−−GQKSHGMMAAGVGVTISVLLRSLVGYIDINISRIWIVFMFLIGFVAVITLRLSIRKKLN−−HPAFN−−−−−−KKSKQKVILIPSFKNMILVVFCY−−−−−−FMMLFFSIAPFQMIFEE−−−−KKNILGYILWVGVLFIFTTLNMASISDRKVHAKIKN 
fig|525374.3.peg.927   Staphylococcus epidermidis BCM-HMP0060               IYKNPRYNIIQKDNRYLMVDLEQNWYSYLCPMLNWFIPIKFTELT−−YQEFNNI−−−−NI−−−FHNG−−−−GQKSQGMLAGGIGVTISVLLRSLVGYIDINISRIWIVFMFLIGFVAVITLRLSIRKKLN−−HPAFN−−−−−−KKSKQKVILIPSFKNMILVVFCY−−−−−−FMMLFFSIAPFQMIFEE−−−−KKNILGYILWVGVLFIFTTLNMASITDRKVHAKIKN 
fig|525376.3.peg.318   Staphylococcus epidermidis W23144               IYKNPRYKIIQKDNRYLMVDLEQNWYSYLCPMLNWFIPIKCTELT−−YQEFNNL−−−−NI−−−FNNG−−−−GQNSHGMMAAGIGVTISVLLRSIVGFMDINISRIWIAIMFLIGFIAVIALRLSIRKKLN−−HPAFN−−−−−−KKSKQKVMLIPSFKNMILVVFCY−−−−−−LMSIYLITGLFHMMVIEN−−−−IQNIWIYICWLGIFFAFTFMNIAAILDRKVHAKLKM 
fig|979211.3.peg.1749   Staphylococcus epidermidis NIHLM023               IYKNPRYKIIQKDNRYLMVDLEQNWYSYLCPMLNWFIPIKCTELT−−YQEFNNL−−−−NI−−−FNNG−−−−GQNSHGMMAAGIGVTISVLLRSIVGFMDINISRIWIAIMFLIGFIAVIALRLSIRKKLN−−HPAFN−−−−−−KKSKQKVMLIPSFKNMILVVFCY−−−−−−LMSIYLITGLFHMMVIEN−−−−IQNIWIYICWLGIFFAFTFMNIAAILDRKVHAKLKM 
fig|1034809.4.peg.637   Staphylococcus lugdunensis N920143               IYKNPRYKIIQKDNRYLMIDLEQNWYSYLCPMLNWFIPIKYTELS−−YKEFNNL−−−−NI−−−FNNQ−−−−NQSNQGLIAAGIGVTISVLLRSFIGLMNINISQIWMFVLFLIGFVGVIALRLSIRKKLN−−HPAFN−−−−−−KNSTQKVMLIPSFKNMVLVVFCY−−−−−−LISIYLIVGLFYMMVIEN−−−−IQNIWIYICWLGIFFVFSFMNMASISDRKVHAKIKN 
fig|698737.3.peg.638   Staphylococcus lugdunensis HKU09-01               IYKNPRYKIIQKDNRYLMIDLEQNWYSYLCPMLNWFIPIKYTELS−−YKEFNNL−−−−NI−−−FNNQ−−−−NQSNQGLIAAGIGVTISVLLRSFIGLMNINISQIWMFVLFLIGFVGVIALRLSIRKKLN−−HPAFN−−−−−−KNSTQKVMLIPSFKNMVLVVFCY−−−−−−LISIYLIVGLFYMMVIEN−−−−IQNIWIYICWLGIFFVFSFMNMASISDRKVHAKIKN 
fig|525378.3.peg.1857   Staphylococcus epidermidis M23864:W1               IYKNPRYKIIQKDNQYLMVDLEQNWCSYLFPMLNWFIPIKYTKLT−−YQEFNNL−−−−DI−−−FSNG−−−−SGASQGMITGGIGVIISVLLRSIVGLMDINVSRIWTLIMFLIGFVAVVGLRLALRKKLK−−HQSFN−−−−−−KNSKQKVRLIPSFKNFALMVFCY−−−−−−VIAIYLVVGLFYIMVINN−−−−VQNIMIYICWLGIFLAFLFMNIASISDRKVHAKI   
fig|450394.6.peg.1156   Staphylococcus aureus subsp. aureus USA300_TCH959        MLCESRIIDKNAKYRIIKYNDEYFMIDLSSNCISYLLPMINWFIPKKGVKLS−−VKEVEKL−−−−DT−−−IKPQ−−−−KNSALNWYIGFSVLLTVIFRKYISLLDLQIERYINISISLLIILFIILFRLYINKKLT−−IKNFHQN−−−−−−EYRTLMLIPTWKSFIFTSFAF−−−−−−VFIGLISIFTIIVTFYYE−−−−NQNIIVFLTEVAMILIFSFLNVLSISDSKVHVIIKEN
fig|698737.3.peg.542   Staphylococcus lugdunensis HKU09-01        MLCESKIINMNPKYRIIKYNDDYLMVDTISHWITFLFPMINWFVPKRYAKLS−−EEEYNNL−−−−DI−−−VKPV−−−−KNSGASIGVGIIIILNVLFRKYIDVFNVQVQESVAILSCVIGFLGIFIFFLYINKKVT−−LDIYKRN−−−−−KTKSKIILIPTLKNFGFTLFSY−−−−−−LLFGGISWVTMEMLTIDH−−−−LYNIFMFIVWIGIIAAFFFVNMFAIIDKKVHIILKN 
fig|1034809.4.peg.546   Staphylococcus lugdunensis N920143        MLCESKIIRMNPKYRIIKYNNDYFMVDTICHWITFLFPMINWFVSKRYAKLS−−EEEYNNL−−−−DI−−−VKPV−−−−KNSGASIGAGLAILISALLRNYVNIFNIQIQESVAVLSCVIGFLGVFIFFLHINKKVT−−LDIYKRN−−−−−KTHSKTILIPTLKSIGFTLTSY−−−−−−VLCGGCALIIMEMLTIDH−−−−LYNVFIFILWVIWIAFFFFINMFAIMDKKVHVILKN 
fig|698737.3.peg.543   Staphylococcus lugdunensis HKU09-01        MLCESKIIRMNPKYRIIKYNNDYFMVDTICHWITFLFPMINWFVSKRYAKLS−−EEEYNNL−−−−DI−−−VKPV−−−−KNSGASIGAGLAILISALLRNYVNIFNIQIQESVAVLSCVIGFLGVFIFFLHINKKVT−−LDIYKRN−−−−−KTHSKTILIPTLKSIGFTLTSY−−−−−−VLCGGCALIIMEMLTIDH−−−−LYNVFIFILWVIWIAFFFFINMFAIMDKKVHVILKN 
fig|698737.3.peg.545   Staphylococcus lugdunensis HKU09-01        VLCESKIINKNPKYRIIKYKDDYLMVDIVSHWFTFLFPMINWFIPKRYAKLS−−EEEYNNL−−−−NI−−−VKPV−−−−KNSGASIGVGLAILISVLLRKYVFIFDVQVQQSIAVISCIIGFLCVFIFFLYINKKVT−−LDIYKIN−−−−−KTHSKIILIPTLKNIGFTLFSY−−−−−−IFLGGFVWMILYGLTVEN−−−−LYNIFIFIIWIGSIALFFFFNMFAIMDKKVHIILKN 
fig|585152.3.peg.520   Staphylococcus aureus subsp. aureus D139        MLCESWNINKNPRYKIIKYKNEFLMIDVTSSWIFFFIPMLNWGVPKKFAKIS−−QSKFEEL−−−−NT−−−FTPK−−−−NSRSAGWIAGGGSVLLAVLTRKYIQLLNIQVNQIAVNILCCLVLLGVFLSALYINSKSK−−LNVYDRN−−−−−NCDEKIILIPTFKNLCLMLLSY−−−−−−ILFGGLSILAFYMFITEG−−−−IQNIILFITWIMLVIMFLLSNVALVVNKKVNVIKR  
fig|585155.3.peg.1148   Staphylococcus aureus subsp. aureus H19        MLCESWNINKNPRYKIIKYKNEFLMIDVTSSWIFFFIPMLNWGVPKKFAKIS−−QSKFEEL−−−−NT−−−FTPK−−−−NSRSAGWIAGGGSVLLAVLTRKYIQLLNIQVNQIAVNILCCLVLLGVFLSALYINSKSK−−LNVYDRN−−−−−NCDEKIILIPTLKFMLNAPFVY−−−−−−SFWWFKHTCFLYV                                              
fig|450394.6.peg.1161   Staphylococcus aureus subsp. aureus USA300_TCH959        MLCESWNINKNPRYKIIKYKNEFLMVDVTSSWIFFFIPMLNWGVPKKFAKIS−−QSEFEEL−−−−NT−−−FTPK−−−−NSSSAGWIAGGGSVLLAVLTRKYIQLLNIQVNQIAVNILCCLVLLGVFLSALYINSKSK−−LNVYNRN−−−−−NCDEKIILIPTFKNLCLMLLSY−−−−−−IIFGGLSILAFYMFITEG−−−−IQNIILFITWIMLVIMFLLSNVALVVNKKVYVIKR  
fig|1213730.3.peg.2536   Staphylococcus aureus M0877        LICESKNINKNPRYKIIKYKNEFLMVDVTSSWIFFFIPMLNWGVPKKYAKIS−−QSEFEEL−−−−NT−−−FTPK−−−−NSSSAGWIAGGGSVLLAVLTRKYIQLLNIQVNQIAVNILCCLVLLGVFLSALYINSKSK−−LNVYDRN−−−−−NCDEKIILIPTFKNLYLMLLSY−−−−−−IIFGGLSILAFYMFITEG−−−−IQNIILFITWIMLVIMFLLSNVALVVNKKVYVIKR  
fig|553565.3.peg.1859   Staphylococcus aureus A5937        MLCESKIINKNPKYRIIKYNDEYLMIDIISTWISLFFPFINWFIPKRYVKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVASISTLFAVTLRKYTLLLDTQLDKKLVIAICCTTFIGILIFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIILIPTLKNFCFTLFGY−−−−−−VFLIFWTVIFSYALLSMS−−−−YQNIIVYFAWITAIIGFFLVNI               
fig|505321.3.peg.2147   Staphylococcus aureus subsp. aureus str. CF-Marseille        MLCESKIINKNPKYRIIKYNDEYLMIDIISTWISLFFPFINWFIPKRYVKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVASISTLFAVTLRKYTLLLDTQLDKKLVIAICCTTFIGILIFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIILIPTLKNFCFTLFGY−−−−−−VFLIFWTVIFSYALLSMS−−−−YQNIIVYFAWITAIIGFF                   
fig|1157010.3.peg.507   Staphylococcus aureus M0102        MLCESKIINKNPKYRIIKYNDEYLMIDIISTWISLFFPFINWFIPKRYVKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVASISTLFAVTLRKYTLLLDTQLDKKLVIAICCTTFIGILIFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIILIPTLKNFCFTLFGY−−−−−−VFLIFWTVIFSYALLSMS−−−−YQNIIVYFAWITAIIGFFLVNIALIIDKNIHVILKN 
fig|548474.3.peg.1628   Staphylococcus aureus subsp. aureus TCH130        MLCESKIINKNPKYRIIKYNDEYLMIDIISTWISLFFPFINWFIPKRYVKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVASISTLFAVTLRKYTLLLDTQLDKKLVIAICCITFIGILIFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIILIPTLKNFCFTLFGY−−−−−−VFLIFWTVIFSYALLSMS−−−−YQNIIVYFAWITAIIGFFLVNIALIIDKNIHVILKN 
fig|1213730.3.peg.2534   Staphylococcus aureus M0877        MLCESKIINKNPKYRIIKYNDEYLMIDIISTWISLFFPFINWFITKRYVKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVAGISTLFAVTLRKYTHLLDTQLDKKLVIAICCITFIGILIFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIILIPTLKNFCFTLFGY−−−−−−VFLIFWTVIFSYALLSMS−−−−YQNIIVYFAWITAIMGFFLVNIALIIDKNIHVILKN 
fig|450394.6.peg.1163   Staphylococcus aureus subsp. aureus USA300_TCH959        MLCESKIINKNPKYRIIKYNDEYLMIDIISTWISLFFPFINWFITKRYVKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVAGISTLFAVTLRKYTHLLDTQLDKKLVIAICCITFIGILIFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIILIPTLKNFCFTLFGY−−−−−−VFLIFWTVVFSYALLSMS−−−−YQNIIVYFAWITAIMGFFLVNIALIIDKNIHVILKN 
fig|585155.3.peg.1143   Staphylococcus aureus subsp. aureus H19        MLCESKIINKNPKYRIIKYNDEYLMVDIISTWISLFFPFINWFIPKRYIKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVAGISALFAVTLRKYTHLLDTQLDRKLVIAICCITFIGILTFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIILIPTLKKFLFHIVYI−−−−−−CFFYFMDSYFLIFSIINE                                         
fig|282459.5.peg.584   Staphylococcus aureus subsp. aureus MSSA476        MLCESKIINKNPKYRIIKYNDEYLMIDIISTWISLFFPFINWFIPKRYVKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVAGISTLFAVTLRKYTHLLDTQLDRKLVIAICCITFIGILTFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIILIPTLKKFLFNIV                                                                    
fig|196620.1.peg.556   Staphylococcus aureus subsp. aureus MW2        MLCESKIINKNPQYRIIKYNDEYLMIDIISTWISLFFPFINWFIPKRYVKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVAGISTLFAVTLRKYTHLLDTQLDRKLVIAICCITFIGILTFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIILIPTLKNFCLTLFRY−−−−−−AFFILWTVIFSYALLSMS−−−−YQNIIVYFAWITAIMGFFLVNIALIIDKNIHVILKN 
fig|93061.3.peg.572   Staphylococcus aureus subsp. aureus NCTC 8325        MLCESKIINKNPKYRIIKYNDEYLMIDIISTWISLFFPFINWFIPKRYVKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVAGISTLFAVTLRKYTHLLDTQLDRKLVIAICCITFIGILTFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIILIPTLKNFCLTLFRY−−−−−−AFFILWTVIFSYALLSMS−−−−YQNIIVYFAWITAIMGFF                   
fig|426430.6.peg.560   Staphylococcus aureus subsp. aureus str. Newman        MLCESKIINKNPKYRIIKYNDEYLMIDIISTWISLFFPFINWFIPKRYVKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVAGISTLFAVTLRKYTHLLDTQLDRKLVIAICCITFIGILTFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIILIPTLKNFCLTLFRY−−−−−−AFFILWTVIFSYALLSMS−−−−YQNIIVYFAWITAIMGFFLVNIALIIDKNIHVILKN 
fig|451515.3.peg.652   Staphylococcus aureus subsp. aureus USA300_FPR3757        MLCESKIINKNPKYRIIKYNDEYLMIDIISTWISLFFPFINWFIPKRYVKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVAGISTLFAVTLRKYTHLLDTQLDRKLVIAICCITFIGILTFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIILIPTLKNFCLTLFRY−−−−−−AFFILWTVIFSYALLSMS−−−−YQNIIVYFAWITAIMGFFLVNIALIIDKNIHVILKN 
fig|452948.4.peg.972   Staphylococcus aureus 930918-3        MLCESKIINKNPKYRIIKYNDEYLMIDIISTWISLFFPFINWFIPKRYVKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVAGISTLFAVTLRKYTHLLDTQLDRKLVIAICCITFIGILTFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIILIPTLKNFCLTLFRY−−−−−−AFFILWTVIFSYALLSMS−−−−YQNIIVYFAWITAIMGFFLVNIALIIDKNIHVILKN 
fig|546342.3.peg.2262   Staphylococcus aureus subsp. aureus str. JKD6008        MLCESKIINKNPKYRIIKYNDEYLMIDIISTWISLFFPFINWFIPKRYVKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVAGISTLFAVTLRKYTHLLDTQLDRKLVIAICCITFIGILTFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIILIPTLKNFCLTLFRY−−−−−−AFFILWTVIFSYALLSMS−−−−YQNIIVYFAWITAIMGFFLVNIALIIDKNIHVILKN 
fig|553567.3.peg.437   Staphylococcus aureus A5948        MLCESKIINKNPKYRIIKYNDEYLMIDIISTWISLFFPFINWFIPKRYVKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVAGISTLFAVTLRKYTHLLDTQLDRKLVIAICCITFIGILTFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIILIPTLKNFCLTLFRY−−−−−−AFFILWTVIFSYALLSMS−−−−YQNIIVYFAWITAIMGFFLVNIALIIDKNIHVILKN 
fig|93062.4.peg.141   Staphylococcus aureus subsp. aureus COL        MLCESKIINKNPKYRIIKYNDEYLMIDIISTWISLFFPFINWFIPKRYVKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVAGISTLFAVTLRKYTHLLDTQLDRKLVIAICCITFIGILTFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIILIPTLKNFCLTLFRY−−−−−−AFFILWTVIFSYALLSMS−−−−YQNIIVYFAWITAIMGFFLVNIALIIDKNIHVILKN 
fig|585155.3.peg.1158   Staphylococcus aureus subsp. aureus H19        MLCESKIINKNAKYRIIKYNGEYLMVDIISTWISLFFPFINWFIPKRYVKIS−−KEDFENL−−−−NI−−−VKPA−−−−KKNVFWPVAGISALFAVTLRKYTHLLDTQLDKKLVIAICCITFIGILIFYVRLIKKSS−−LNIYNP−−−−−KNERSKIVLIPTLKNVCFTLFGY−−−−−−ILFGGLTMLFLNALLSMS−−−−YQNIIVYFAWIAVIMGFFLVNIALIIDKNIYVILKN 
fig|273036.3.peg.585   Staphylococcus aureus RF122        LLCESKIINKNPKYRVIKYNDEYLMIDIISTWISLFFSFINWFIPKRCVKIS−−REEFENL−−−−NI−−−FKPA−−−−KKNVFWPVAGISALFAVTLRKYTHLLDTQLDKKLVIAICCITFIGILTFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIILIPTLKNVCFTLFGY−−−−−−ILFGGLTMLFLNALLSMS−−−−YQNIIVYFAWIAVIMGFFLVNIALIIDKNIHVILKN 
fig|273036.6.peg.598   Staphylococcus aureus RF122        LLCESKIINKNPKYRVIKYNDEYLMIDIISTWISLFFSFINWFIPKRCVKIS−−REEFENL−−−−NI−−−FKPA−−−−KKNVFWPVAGISALFAVTLRKYTHLLDTQLDKKLVIAICCITFIGILTFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIILIPTLKNVCFTLFGY−−−−−−ILFGGLTMLFLNALLSMS−−−−YQNIIVYFAWIAVIMGFFLVNIALIIDKNIHVILKN 
fig|548470.3.peg.1493   Staphylococcus aureus subsp. aureus MN8                                                                                          KNVFWPVAGSSALLGVALRKYTHLLDVQLDKKLVIAICCITFIGILIFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIFLIPTLKNVCFTLFGY−−−−−−ILFGGLTMLFLDALLSMS−−−−YQNIIVYFAWIAVMMGFFLVNIALIIDKNIHVILKN 
fig|585150.3.peg.1153   Staphylococcus aureus subsp. aureus C160                                                                                          KNVFWPVAGSSALLGVALRKYTHLLDVQLDKKLVIAICCITFIGILIFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIFLIPTLKNVCFTLFGY−−−−−−ILFGGLTMLFLDALLSMS−−−−YQNIIVYFAWIAVMMGFFLVNIALIIDKNIHVILKN 
fig|585160.3.peg.125   Staphylococcus aureus subsp. aureus WBG10049                                                                                          KNVFWPVAGSSALLGVALRKYTHLLDVQLDKKLVIAICCITFIGILIFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIFLIPTLKNVCFTLFGY−−−−−−ILFGGLTMLFLDALLSMS−−−−YQNIIVYFAWIAVMMGFFLVNIALIIDKNIHVILKN 
fig|426430.6.peg.565   Staphylococcus aureus subsp. aureus str. Newman        LLCESKIINKNQKYRIIKYNDEYLMVDIISTWISLFFPFINWFIPKEYVKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVAGSSALLGVALRKYTHLLDIQLDKKLVIAICCITFIGILIFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIFLIPTLKNVCFTLFGY−−−−−−ILFGGLTMLFLDALLSMS−−−−YQNIIVYFVWIAVIMGFFLVNIALIIDKNIHVILKN 
fig|196620.1.peg.562   Staphylococcus aureus subsp. aureus MW2        LLCESKIINKNPKYRIIKYNDEYLMVDIISTWISLFFPFINWFIPKEYVKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVAGSSALLGVALRKYTHLLDIQLDKKLVIAICCITFIGILIFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIFLIPTLKNVCFTLFGY−−−−−−ILFGGLTMLFLDALLSMS−−−−YQNIIVYFVWIAVIMGFFLVNIALIIDKNIHVILKN 
fig|282459.5.peg.591   Staphylococcus aureus subsp. aureus MSSA476        LLCESKIINKNPKYRIIKYNDEYLMVDIISTWISLFFPFINWFIPKEYVKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVAGSSALLGVALRKYTHLLDIQLDKKLVIAICCITFIGILIFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIFLIPTLKNVCFTLFGY−−−−−−ILFGGLTMLFLDALLSMS−−−−YQNIIVYFVWIAVIMGFFLVNIALIIDKNIHVILKN 
fig|451515.3.peg.660   Staphylococcus aureus subsp. aureus USA300_FPR3757        LLCESKIINKNPKYRIIKYNDEYLMVDIISTWISLFFPFINWFIPKEYVKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVAGSSALLGVALRKYTHLLDIQLDKKLVIAICCITFIGILIFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIFLIPTLKNVCFTLFGY−−−−−−ILFGGLTMLFLDALLSMS−−−−YQNIIVYFVWIAVIMGFFLVNIALIIDKNIHVILKN 
fig|452948.4.peg.962   Staphylococcus aureus 930918-3        LLCESKIINKNPKYRIIKYNDEYLMVDIISTWISLFFPFINWFIPKEYVKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVAGSSALLGVALRKYTHLLDIQLDKKLVIAICCITFIGILIFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIFLIPTLKNVCFTLFGY−−−−−−ILFGGLTMLFLDALLSMS−−−−YQNIIVYFVWIAVIMGFFLVNIALIIDKNIHVILKN 
fig|546342.3.peg.521   Staphylococcus aureus subsp. aureus str. JKD6008        LLCESKIINKNPKYRIIKYNDEYLMVDIISTWISLFFPFINWFIPKEYVKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVAGSSALLGVALRKYTHLLDIQLDKKLVIAICCITFIGILIFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIFLIPTLKNVCFTLFGY−−−−−−ILFGGLTMLFLDALLSMS−−−−YQNIIVYFVWIAVIMGFFLVNIALIIDKNIHVILKN 
fig|93061.3.peg.580   Staphylococcus aureus subsp. aureus NCTC 8325        LLCESKIINKNPKYRIIKYNDEYLMVDIISTWISLFFPFINWFIPKEYVKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVAGSSALLGVALRKYTHLLDIQLDKKLVIAICCITFIGILIFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIFLIPTLKNVCFTLFGY−−−−−−ILFGGLTMLFLDALLSMS−−−−YQNIIVYFVWIAVIMGFFLVNIALIIDKNIHVILKN 
fig|93062.4.peg.147   Staphylococcus aureus subsp. aureus COL        LLCESKIINKNPKYRIIKYNDEYLMVDIISTWISLFFPFINWFIPKEYVKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVAGSSALLGVALRKYTHLLDIQLDKKLVIAICCITFIGILIFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIFLIPTLKNVCFTLFGY−−−−−−ILFGGLTMLFLDALLSMS−−−−YQNIIVYFVWIAVIMGFFLVNIALIIDKNIHVILKN 
fig|553567.3.peg.429   Staphylococcus aureus A5948        LLCESKIINKNPKYRIIKYNDEYLMVDIISTWISLFFPFINWFIPKEYVKIS−−REEFENL−−−−NI−−−VKPA−−−−KKNVFWPVAGSSALLGVALRKYTHLLDIQLDKKLVIAICCITFIGILIFYVRLIKKSS−−LNIYNT−−−−−KNKRSKIFLIPTLKNVYFTLFGY−−−−−−ILFGGLTMLFLDALLSMS−−−−YQNIIVYFVWIAVIMGFFLVNIALIIDKNIHVILKN 
fig|196620.1.peg.555   Staphylococcus aureus subsp. aureus MW2        MLCESRVINQNPKYRIIKYNNEYFMVDLVSTWIAYFLPMINWFIPKKYAKIS−−REEFESL−−−−NI−−−VKPA−−−−KNNTFWPVAGFAVLLTTLTRKYIYLLNIHLEKEIVILTCCMILLGVFALFIYINTKLK−−LHIFDKN−−−−KSNNEKIILIPTFKNICLSLFAY−−−−−−ILFGGLSTMALSMLVTSS−−−−PQNIIEFLALIGMTACFFLLNMSSVLDKKIHVILKTN
fig|282459.5.peg.582   Staphylococcus aureus subsp. aureus MSSA476        MLCESRVINQNPKYRIIKYNNEYFMVDLVSTWIAYFLPMINWFIPKKYAKIS−−REEFESL−−−−NI−−−VKPA−−−−KNNTFWPVAGFAVLLTTLTRKYIYLLNIHLEKEIVILTCCMILLGVFALFIYINTKLK−−LHIFDKN−−−−KSNNEKIILIPTFKNICLSLFAY−−−−−−ILFGGLSTMALSMLVTSS−−−−PQNIIEFLALIGMTACFFLLNMSSVLDKKIHVILKTN
fig|426430.6.peg.559   Staphylococcus aureus subsp. aureus str. Newman        MLCESRVINQNPKYRIIKYNNEYFMVDLVSTWIAYFLPMINWFIPKKYAKIS−−REEFESL−−−−NI−−−VKPA−−−−KNNTFWPVAGFAVLLTTLTRKYIYLLNIHLEKEIVILTCCMILLGVFALFIYINTKLK−−LHIFDKN−−−−KSNNEKIILIPTFKNICLSLFAY−−−−−−ILFGGLSTMALSMLVTSS−−−−PQNIIEFLALIGMTACFFLLNMSSVLDKKIHVILKTN
fig|452948.4.peg.974   Staphylococcus aureus 930918-3        MLCESRVINQNPKYRIIKYNNEYFMVDLVSTWIAYFLPMINWFIPKKYAKIS−−REEFESL−−−−NI−−−VKPA−−−−KNNTFWPVAGFAVLLTTLTRKYIYLLNIHLEKEIVILTCCMILLGVFALFIYINTKLK−−LHIFDKN−−−−KSNNEKIILIPTFKNICLSLFAY−−−−−−ILFGGLSTMALSMLVTSS−−−−PQNIIEFLALIGMTACFFLLNMSSVLDKKIHVILKTN
fig|546342.3.peg.2260   Staphylococcus aureus subsp. aureus str. JKD6008        MLCESRVINQNPKYRIIKYNNEYFMVDLVSTWIAYFLPMINWFIPKKYAKIS−−REEFESL−−−−NI−−−VKPA−−−−KNNTFWPVAGFAVLLTTLTRKYIYLLNIHLEKEIVILTCCMILLGVFALFIYINTKLK−−LHIFDKN−−−−KSNNEKIILIPTFKNICLSLFAY−−−−−−ILFGGLSTMALSMLVTSS−−−−PQNIIEFLALIGMTACFFLLNMSSVLDKKIHVILKTN
fig|553567.3.peg.439   Staphylococcus aureus A5948        MLCESRVINQNPKYRIIKYNNEYFMVDLVSTWIAYFLPMINWFIPKKYAKIS−−REEFESL−−−−NI−−−VKPA−−−−KNNTFWPVAGFAVLLTTLTRKYIYLLNIHLEKEIVILTCCMILLGVFALFIYINTKLK−−LHIFDKN−−−−KSNNEKIILIPTFKNICLSLFAY−−−−−−ILFGGLSTMALSMLVTSS−−−−PQNIIEFLALIGMTACFFLLNMSSVLDKKIHVILKTN
fig|93061.3.peg.570   Staphylococcus aureus subsp. aureus NCTC 8325        MLCESRVINQNPKYRIIKYNNEYFMVDLVSTWIAYFLPMINWFIPKKYAKIS−−REEFESL−−−−NI−−−VKPA−−−−KNNTFWPVAGFAVLLTTLTRKYIYLLNIHLEKEIVILTCCMILLGVFALFIYINTKLK−−LHIFDKN−−−−KSNNEKIILIPTFKNICLSLFAY−−−−−−ILFGGLSTMALSMLVTSS−−−−PQNIIEFLALIGMTACFFLLNMSSVLDKKIHVILKTN
fig|93062.4.peg.140   Staphylococcus aureus subsp. aureus COL        MLCESRVINQNPKYRIIKYNNEYFMVDLVSTWIAYFLPMINWFIPKKYAKIS−−REEFESL−−−−NI−−−VKPA−−−−KNNTFWPVAGFAVLLTTLTRKYIYLLNIHLEKEIVILTCCMILLGVFALFIYINTKLK−−LHIFDKN−−−−KSNNEKIILIPTFKNICLSLFAY−−−−−−ILFGGLSTMALSMLVTSS−−−−PQNIIEFLALIGMTACFFLLNMSSVLDKKIHVILKTN
fig|451515.3.peg.650   Staphylococcus aureus subsp. aureus USA300_FPR3757        MLCESRVINQNPKYRIIKYNNEYFMVDLVSTWIAYFLPMINWNSPKKYAKIS−−REEFESL−−−−NI−−−VKPA−−−−KNNTFWPVAGFAVLLTTLTRKYIYLLNIHLEKEIVILTCCMILLGVFALFIYINTKLK−−LHIFDKN−−−−KSNNEKIILIPTFKNICLSLFAY−−−−−−ILFGGLSTMALSMLVTSS−−−−PQNIIEFLALIGMTACFFLLNMSSVLDKKIHVILKTN
fig|450394.6.peg.1162   Staphylococcus aureus subsp. aureus USA300_TCH959                                MVDLVSTWIAYFLPMINWFIPKKYVKIS−−REEFESL−−−−NI−−−VKPA−−−−KNNTFWPVAGFAVLLTTLTRKYIYLLNIHLEKELVILTCCMILLGVFALFIYINTKLK−−LHIFDKN−−−−KSNNEKIILIPTFKNICLSLFAY−−−−−−ILFGGLSTMALSMLVTSS−−−−PQNIIEFLALIGMTACFFLLNMSSVLDKNIHVILKTN
fig|1213730.3.peg.2535   Staphylococcus aureus M0877                                MVDLVSTWIAYFLPMINWFIPKKYAKIS−−REEFESL−−−−NI−−−VKPA−−−−KNNTFWPVAGFAVLLTTLTRKYIYLLNIHLEKELVILTCCMILLGVFALFIYINTKLK−−LHIFDKN−−−−KSNNEKIILIPTFKNICLSLFAY−−−−−−ILFGGLSTMALSMLVTLS−−−−PQNIIEFLALIGMTACFFLLNMSSVLDKNIHVILKTN
fig|450394.6.peg.1160   Staphylococcus aureus subsp. aureus USA300_TCH959        MLCEFKIINKNPKYRIIKYNDEYLIVDLVSSWIVFFLPMINWFIPKNYVKIS−−KEEFDVL−−−−NI−−−FKPV−−−−RNNAFWPVTGALVLLVTLSKKYIYLLNTHLDKKTVIIICFVILLCVITCFLYLNQKLK−−LHIWDKN−−−−KGENEKIILIPTLKNIFMSLFAY−−−−−−IFFGSFSILSLNILLTMD−−−−SQNIIGFLGWIVTTSCFFFVNRSSIIGGNVRVILKKY
fig|585155.3.peg.1147   Staphylococcus aureus subsp. aureus H19     MKILLCESIIINKNPKYRIIKYNDGYLMVDLVSSWIVFFLPMINWFIPKNYVKIS−−KEEFDVL−−−−NI−−−VKPV−−−−RNNAFWPVTGALVLLVTLSKKYIYLLNTHLDKKTVIIICFVIFLCVITCFLYLNQKLK−−LHIWDKN−−−−KSENEKIILIPTLKNIFMSLFAY−−−−−−IFFGSFSILSLNILLTMD−−−−FQNIIGFLGWIVTTSCFFFVNRSSIIGGNVRVILKKY
fig|585152.3.peg.519   Staphylococcus aureus subsp. aureus D139     MKILLCESIIINKNPKYRIIKYNDGYLMVDLVSSWIVFFLPMINWFIPKNYVKIS−−KEEFDVL−−−−NI−−−VKPV−−−−RNNAFWPVTGALVLLVTLSKKYIYLLNTHLDKKTVIIICFVIFLCVITCFLYLNQKLK−−LHIWDKN−−−−KSENEKIILIPTLKNIFMSLFAY−−−−−−IFFGSFSILSLNILLTMD−−−−SQNIIGFLGWIVTTSCFFFVNRSSIIGGNVRVILKKY
fig|450394.6.peg.1157   Staphylococcus aureus subsp. aureus USA300_TCH959        MLCDVEVVNKNPKYRIIKYNDEYLMIDLVSTWLTLFLPMMNWLIPKKYVKIS−−KEEFENL−−−−KI−−−VKPV−−−−KNNAFWPAAGGSVLFGVTFRKYTQFLNIQLEKNLVIAICCMIFLAVFTLFLYLNKKLK−−LHMFEDN−−−−KNDNDKIILIPTFKNICLSLIAY−−−−−−VFFGGFSIMLLSMLMTLN−−−−PQNIIGFLALFGMIAAFFIANRSSIIDKNVYAILRS 
fig|585152.3.peg.516   Staphylococcus aureus subsp. aureus D139     VKTLLCDVEVVNKNPKYRIIKYNDEYLMIDLVSTWLTLFLPMMNWLIPKKYVKIN−−KEEFENL−−−−NI−−−VKPT−−−−KNRAFWPAAGGSVLFGVTFRKYTQFLNIQLEKNLVIAICCMIFLAVFTLFLYLNKKLK−−LHMFEDN−−−−KNDNDKIILIPTFKNICLSLIAY−−−−−−VFFGGFSIMLLSMLMTLN−−−−PQNIIGFLALFGMIAAFFIANRSSIIDKNVYAILRS 
fig|585155.3.peg.1144   Staphylococcus aureus subsp. aureus H19     VKTLLCDVEVVNKNPKYRIIKYNDEYLMIDLVSTWLTLFLPMMNWLIPKKYVKIN−−KEEFENL−−−−NI−−−VKPT−−−−KNRAFWPAAGGSVLFGVTFRKYTQFLNIQLEKNLVIAICCMIFLAVFTLFLYLNKKLK−−LHMFEDN−−−−KNDNDKIILIPTFKNICLSLIAY−−−−−−VFFGGFSIMLLSMLMTLN−−−−PQNIIGFLALFGMIAAFFIANRSSIIDKNVYAILRS 
fig|585152.3.peg.529   Staphylococcus aureus subsp. aureus D139                                MIDLVSTWLTLFLPMINWLIPKKYVKIS−−KKEFDDL−−−−NI−−−VKPV−−−−KNKAFWPVAGSTILFGVTFRKYIPSLNIQLEKNMVIVICCAIFLGVLILFLFLNRKLR−−LEIYNNN−−−−−SSKGKIILFPSLKNFCFTLFYY−−−−−−FLFGGLSIMALSMLLTLN−−−−PQNIIGFIGWLVMTAGFFLLNMSSIIDKKIYVISKTN
fig|585155.3.peg.1156   Staphylococcus aureus subsp. aureus H19                                MIDLVSTWLTLFLPMINWLIPKKYVKIS−−KKEFDDL−−−−NI−−−VKPV−−−−KNKAFWPVAGSTILFGVTFRKYIPSLNIQLEKNMVIVICCAIFLGVLILFLFLNRKLR−−LEIYNNN−−−−−SSKGKIILFPSLKNFCFTLFYY−−−−−−FLFGGLSIMALSMLLTLN−−−−PQNIIGFIGWLVMTAGFFLLNMSSIIDKKIYVISKTN
fig|273036.3.peg.584   Staphylococcus aureus RF122        MLCESKVINKNPKYRVIKYGDEYLMIDLVSTWLTLFLPMINWLIPKKYVKIS−−KKEFDDL−−−−NI−−−VKPV−−−−KNKAFWPVAGSTILFGVTFRKYIPSLNIQLEKNMVIVICCAIFLGVLILFLFLNRKLR−−LEIYNNN−−−−−SSKGKIILFPSLKNFCFTIFYY−−−−−−FLFGGLSIMALSMLLTLN−−−−PQNIIGFIGW                           
fig|426430.6.peg.564   Staphylococcus aureus subsp. aureus str. Newman        MLCESKVINKNPKYRVIKYGDEYLMIDLVSTWLTLFLPMINWLIPKKYVKIS−−KKEFDDL−−−−NI−−−VKPV−−−−KNKAFWPVAGSTILFGVTFRKYIPSLNIQLEKNMVIVICCAIFLGVLILFLFLNRKLR−−LEIYNNN−−−−−SSKGKIILFPSLKNFCFTIFYY−−−−−−FLFGGLSIMALSMLLTLN−−−−PQNIIGFIGWLVMTAGFFLLNMSSIIDKKIYVLSKTN
fig|93061.3.peg.578   Staphylococcus aureus subsp. aureus NCTC 8325        MLCESKVINKNPKYRVIKYGDEYLMIDLVSTWLTLFLPMINWLIPKKYVKIS−−KKEFDDL−−−−NI−−−VKPV−−−−KNKAFWPVAGSTILFGVTFRKYIPSLNIQLEKNMVIVICCAIFLGVLILFLFLNRKLR−−LEIYNNN−−−−−SSKGKIILFPSLKNFCFTIFYY−−−−−−FLFGGLSIMALSMLLTLN−−−−PQNIIGFIGWLVMTAGFFLLNMSSIIDKKIYVLSKTN
fig|93062.4.peg.146   Staphylococcus aureus subsp. aureus COL        MLCESKVINKNPKYRVIKYGDEYLMIDLVSTWLTLFLPMINWLIPKKYVKIS−−KKEFDDL−−−−NI−−−VKPV−−−−KNKAFWPVAGSTILFGVTFRKYIPSLNIQLEKNMVIVICCAIFLGVLILFLFLNRKLR−−LEIYNNN−−−−−SSKGKIILFPSLKNFCFTIFYY−−−−−−FLFGGLSIMALSMLLTLN−−−−PQNIIGFIGWLVMTAGFFLLNMSSIIDKKIYVLSKTN
fig|196620.1.peg.561   Staphylococcus aureus subsp. aureus MW2                                MIDLVSTWLTLFLPMINWLIPKKYVKIS−−KKEFDDL−−−−NI−−−VKPV−−−−KNKAFWPVAGSTILFGVTFRKYIPSLNIQLEKNMVIVICCAIFLGVLILFLFLNRKLR−−LEIYNNN−−−−−SSKGKIILFPSLKNFCFTIFYY−−−−−−FLFGGLSIMALSMLLTLN−−−−PQNIIGFIGWLVMTAGFFLLNMSSIIDKKIYVLSKTN
fig|282459.5.peg.590   Staphylococcus aureus subsp. aureus MSSA476                                MIDLVSTWLTLFLPMINWLIPKKYVKIS−−KKEFDDL−−−−NI−−−VKPV−−−−KNKAFWPVAGSTILFGVTFRKYIPSLNIQLEKNMVIVICCAIFLGVLILFLFLNRKLR−−LEIYNNN−−−−−SSKGKIILFPSLKNFCFTIFYY−−−−−−FLFGGLSIMALSMLLTLN−−−−PQNIIGFIGWLVMTAGFFLLNMSSIIDKKIYVLSKTN
fig|451515.3.peg.658   Staphylococcus aureus subsp. aureus USA300_FPR3757                                MIDLVSTWLTLFLPMINWLIPKKYVKIS−−KKEFDDL−−−−NI−−−VKPV−−−−KNKAFWPVAGSTILFGVTFRKYIPSLNIQLEKNMVIVICCAIFLGVLILFLFLNRKLR−−LEIYNNN−−−−−SSKGKIILFPSLKNFCFTIFYY−−−−−−FLFGGLSIMALSMLLTLN−−−−PQNIIGFIGWLVMTAGFFLLNMSSIIDKKIYVLSKTN
fig|452948.4.peg.964   Staphylococcus aureus 930918-3                                MIDLVSTWLTLFLPMINWLIPKKYVKIS−−KKEFDDL−−−−NI−−−VKPV−−−−KNKAFWPVAGSTILFGVTFRKYIPSLNIQLEKNMVIVICCAIFLGVLILFLFLNRKLR−−LEIYNNN−−−−−SSKGKIILFPSLKNFCFTIFYY−−−−−−FLFGGLSIMALSMLLTLN−−−−PQNIIGFIGWLVMTAGFFLLNMSSIIDKKIYVLSKTN
fig|546342.3.peg.523   Staphylococcus aureus subsp. aureus str. JKD6008                                MIDLVSTWLTLFLPMINWLIPKKYVKIS−−KKEFDDL−−−−NI−−−VKPV−−−−KNKAFWPVAGSTILFGVTFRKYIPSLNIQLEKNMVIVICCAIFLGVLILFLFLNRKLR−−LEIYNNN−−−−−SSKGKIILFPSLKNFCFTIFYY−−−−−−FLFGGLSIMALSMLLTLN−−−−PQNIIGFIGWLVMTAGFFLLNMSSIIDKKIYVLSKTN
fig|553567.3.peg.431   Staphylococcus aureus A5948                                MIDLVSTWLTLFLPMINWLIPKKYVKIS−−KKEFDDL−−−−NI−−−VKPV−−−−KNKAFWPVAGSTILFGVTFRKYIPSLNIQLEKNMVIVICCAIFLGVLILFLFLNRKLR−−LEIYNNN−−−−−SSKGKIILFPSLKNFCFTIFYY−−−−−−FLFGGLSIMALSMLLTLN−−−−PQNIIGFIGWLVMTAGFFLLNMSSIIDKKIYVLSKTN
fig|904785.3.peg.2127   Staphylococcus aureus subsp. aureus IS-157                                MIDLVSTWLTLFLPMINWLIPKKYVKIS−−KKEFDDL−−−−NI−−−VKPV−−−−KNKAFWPVAGSTILFGVTFRKYIPSLNIQLEKNMVIVICCAIFLGVLILFLFLNRKLR−−LEIYNNN−−−−−SSKGKIILFPSLKNFCFTIFYY−−−−−−FLFGGLSIMALSMLLTLN−−−−PQNIIGFIGWLVMTAGFFLLNMSSIIDKKIYVLSKTN
fig|273036.6.peg.597   Staphylococcus aureus RF122                                MIDLVSTWLTLFLPMINWLIPKKYVKIS−−KKEFDDL−−−−NI−−−VKPV−−−−KNKAFWPVAGSTILFGVTFRKYIPSLNIQLEKNMVIVICCAIFLGVLILFLFLNRKLR−−LEIYNNN−−−−−SSKGKIILFPSLKNFCFTIFYY−−−−−−FLFGGLSIMALSMLLTLN−−−−PQNIIGFIGW                           
fig|543538.3.peg.1768   Staphylococcus aureus subsp. aureus CGS00        LLCESKVINKNPKYRVIKYGDEYLMIDLVSTWLTLFLPMINWLIPKKYVKIS−−KKEFDDL−−−−NI−−−VKPV−−−−KNKAFWPVAGSTILFGVTFRKYIPSLNIQLEKNMVIVICCAIFLGVLILFLFLNRKLR−−LEIYNNN−−−−−SSKGKIILFPSLKNFCFTIFYY−−−−−−FLFGGLSIMALSMLLTLN−−−−PQNIIGFIGWLVMTAGFFLLNMSSIIDKKIYVLSKTN
fig|548470.3.peg.1496   Staphylococcus aureus subsp. aureus MN8        LLCESKVINKNPKYRVIKYGDEYLMIDLVSTWLTLFLPMINWLIPKKYVKIS−−KKEFDDL−−−−NI−−−VKPV−−−−KNKAFWPVAGSTILFGVTFRKYIPSLNIQLEKNMVIVICCAIFLGVLILFLFLNRKLR−−LEIYNNN−−−−−SSKGKIILFPSLKNFCFTIFYY−−−−−−FLFGGLSIMALSMLLTLN−−−−PQNIIGFIGWLVMTAGFFLLNMSSIIDKKIYVLSKTN
fig|585150.3.peg.1150   Staphylococcus aureus subsp. aureus C160        LLCESKVINKNPKYRVIKYGDEYLMIDLVSTWLTLFLPMINWLIPKKYVKIS−−KKEFDDL−−−−NI−−−VKPV−−−−KNKAFWPVAGSTILFGVTFRKYIPSLNIQLEKNMVIVICCAIFLGVLILFLFLNRKLR−−LEIYNNN−−−−−SSKGKIILFPSLKNFCFTIFYY−−−−−−FLFGGLSIMALSMLLTLN−−−−PQNIIGFIGWLVMTAGFFLLNMSSIIDKKIYVLSKTN
fig|585160.3.peg.122   Staphylococcus aureus subsp. aureus WBG10049        LLCESKVINKNPKYRVIKYGDEYLMIDLVSTWLTLFLPMINWLIPKKYVKIS−−KKEFDDL−−−−NI−−−VKPV−−−−KNKAFWPVAGSTILFGVTFRKYIPSLNIQLEKNMVIVICCAIFLGVLILFLFLNRKLR−−LEIYNNN−−−−−SSKGKIILFPSLKNFCFTIFYY−−−−−−FLFGGLSIMALSMLLTLN−−−−PQNIIGFIGWLVMTAGFFLLNMSSIIDKKIYVLSKTN
fig|1157010.3.peg.506   Staphylococcus aureus M0102        MLCESKVINKNPKYRIIKYESEYLMIDLASNWIVFFFPFINWLIPKTYVKIT−−KNDYEKL−−−−NI−−−VKPV−−−−KNKSIGWTIFAGIVLLGGTVRRNTYLFDFQLEKLIVWSSCFIGFLGVIFFYCYLNKKLT−−LNVYKEN−−−−KNNELKLRLLPSFKNMCFTIFYY−−−−−−LFTGFMSYGAFYLLVFEN−−−−VQNLILYISWLFMTMLFMLMNMHSIIDKKVHIFLKSN
fig|548474.3.peg.1629   Staphylococcus aureus subsp. aureus TCH130        MLCESKVINKNPKYRIIKYESEYLMIDLASNWIVFFFPFINWLIPKTYVKIT−−KNDYEKL−−−−NI−−−VKPV−−−−KNKSIGWTIFAGIVLLGGTVRRNTYLFDFQLEKLIVWSSCFIGFLGVIFFYCYLNKKLT−−LNVYKEN−−−−KNNELKLRLLPSFKNMCFTIFYY−−−−−−LFTGFMSYGAFYLLVFEN−−−−VQNLILYISWLFMTMLFMLMNMHSIIDKKVHIFLKSN
fig|553565.3.peg.1858   Staphylococcus aureus A5937        MLCESKVINKNPKYRIIKYESEYLMIDLASNWIVFFFPFINWLIPKTYVKIT−−KNDYEKL−−−−NI−−−VKPV−−−−KNKSIGWTIFAGIVLLGGTVRRNTYLFDFQLEKLIVWSSCFIGFLGVIFFYCYLNKKLT−−LNVYKEN−−−−KNNELKLRLLPSFKNMCFTIFYY−−−−−−LFTGFMSYGAFYLLVFEN−−−−VQNLILYISWLFMTMLFMLMNMHSIIDKKVHIFLKSN
fig|505321.3.peg.2149   Staphylococcus aureus subsp. aureus str. CF-Marseille        MLCESKVINKNPKYRIIKYESEYLMIDLASNWIVFFFPFINWLIPKTYVKIT−−KNDYEKL−−−−NI−−−VKPV−−−−KNKSIGWTIFAGIVLLGGTVRRNTYLFDFQLEKLIVWSSCFIGFLGVIFFYCYLNKKLT−−LNVYK