(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020343

fig|1116224.3.peg.219   Staphylococcus aureus subsp. aureus VRS11a     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|1157030.3.peg.151   Staphylococcus aureus M0450     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|1158480.3.peg.1034   Staphylococcus aureus M1253     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|1158486.3.peg.2421   Staphylococcus aureus M1320     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|1158685.3.peg.976   Staphylococcus aureus M0539     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|1158687.3.peg.156   Staphylococcus aureus M0565     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|1169274.3.peg.158   Staphylococcus aureus M1309     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|359786.3.peg.1086   Staphylococcus aureus subsp. aureus JH9     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|505321.3.peg.918   Staphylococcus aureus subsp. aureus str. CF-Marseille     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|553565.3.peg.2530   Staphylococcus aureus A5937     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|553571.3.peg.2114   Staphylococcus aureus A6300     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|553581.3.peg.2139   Staphylococcus aureus A9299     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|553588.3.peg.1524   Staphylococcus aureus A9719     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|553596.3.peg.847   Staphylococcus aureus A9781     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|681288.4.peg.182   Staphylococcus aureus subsp. aureus ED98     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|703339.3.peg.214   Staphylococcus aureus 04-02981     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|889933.4.peg.169   Staphylococcus aureus subsp. aureus ECT-R 2     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|904731.3.peg.1776   Staphylococcus aureus subsp. aureus 21201     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|904750.3.peg.860   Staphylococcus aureus subsp. aureus 21272     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|904783.3.peg.1783   Staphylococcus aureus subsp. aureus IS-122     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|931446.3.peg.744   Staphylococcus aureus subsp. aureus CIG1213     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|158878.1.peg.210   Staphylococcus aureus subsp. aureus Mu50     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|158878.14.peg.212   Staphylococcus aureus subsp. aureus Mu50     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|1224926.3.peg.2407   Staphylococcus aureus M0279                                                                                                          MLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|553592.3.peg.902   Staphylococcus aureus A9763                                                                                                          MLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN
fig|548474.3.peg.2278   Staphylococcus aureus subsp. aureus TCH130     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESITYN
fig|1231383.3.peg.1390   Staphylococcus aureus KT/314250     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|196620.1.peg.186   Staphylococcus aureus subsp. aureus MW2     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|282459.1.peg.175   Staphylococcus aureus subsp. aureus MSSA476     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|282459.5.peg.197   Staphylococcus aureus subsp. aureus MSSA476     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|450394.6.peg.1961   Staphylococcus aureus subsp. aureus USA300_TCH959     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|762962.3.peg.1615   Staphylococcus aureus subsp. aureus ATCC 51811     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|931441.3.peg.426   Staphylococcus aureus subsp. aureus CIG1835     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|931459.3.peg.711   Staphylococcus aureus subsp. aureus CIGC128     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|1028799.3.peg.153   Staphylococcus aureus subsp. aureus VC40     FWLNLAAIIIISIVVSGDMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|1112349.3.peg.1089   Staphylococcus aureus subsp. aureus NN50     FWLNLAAIIIISIVVSGDMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|93061.3.peg.183   Staphylococcus aureus subsp. aureus NCTC 8325     FWLNLAAIIIISIVVSGDMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|1158539.3.peg.151   Staphylococcus aureus M0633     FWLNLAAIIIISIVVSGDMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|1305598.3.peg.208   Staphylococcus aureus M1     FWLNLAAIIIISIVVSGDMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|367830.3.peg.1664   Staphylococcus aureus subsp. aureus USA300     FWLNLAAIIIISIVVSGDMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|426430.6.peg.147   Staphylococcus aureus subsp. aureus str. Newman     FWLNLAAIIIISIVVSGDMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|455227.3.peg.219   Staphylococcus aureus D30     FWLNLAAIIIISIVVSGDMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|553590.4.peg.1208   Staphylococcus aureus A9754     FWLNLAAIIIISIVVSGDMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|553594.3.peg.867   Staphylococcus aureus A9765     FWLNLAAIIIISIVVSGDMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|904753.3.peg.2111   Staphylococcus aureus subsp. aureus 21282     FWLNLAAIIIISIVVSGDMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|904754.3.peg.2102   Staphylococcus aureus subsp. aureus 21283     FWLNLAAIIIISIVVSGDMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|904778.3.peg.144   Staphylococcus aureus subsp. aureus IS-88     FWLNLAAIIIISIVVSGDMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|93062.19.peg.188   Staphylococcus aureus subsp. aureus COL     FWLNLAAIIIISIVVSGDMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|93062.4.peg.655   Staphylococcus aureus subsp. aureus COL     FWLNLAAIIIISIVVSGDMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|931433.3.peg.763   Staphylococcus aureus subsp. aureus CIG1114     FWLNLAAIIIISIVVSGDMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|931442.3.peg.806   Staphylococcus aureus subsp. aureus CIG547     FWLNLAAIIIISIVVSGDMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|553567.3.peg.1130   Staphylococcus aureus A5948                                                                                                          MLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|1158485.3.peg.306   Staphylococcus aureus M1311     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQNGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPQNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|1213730.3.peg.320   Staphylococcus aureus M0877     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQNGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPQNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|553583.3.peg.1841   Staphylococcus aureus A9635     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQNGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPQNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|904730.3.peg.1513   Staphylococcus aureus subsp. aureus 21200     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQNGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPQNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|931454.3.peg.710   Staphylococcus aureus subsp. aureus CIG1524     FWLNLAAIIIISIVVSGGMFLAMKWE−−−−−−−−−−−−−QIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQNGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPQNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN
fig|525378.3.peg.1283   Staphylococcus epidermidis M23864:W1                                          KERQLVKDLDKTIFNVYPIKNLEDFYNIEGYKDENFDKQDKGTWYLNSAMNIQRKGEDLKSEGMLLKINRNTKTAKGYYYISSYF−−−−−−−−−TDKRGSQDSSEKRYPVKMVNNKFIITKPVHDNKVKNKIKNFKFFVQYGDFKDLKTNQYSKLGYNPNVPSYTLEYNLNNEENNVKKLREIYNIPTNKKPKLLIEGQSSLDHARVGYKSIEFSFIKRTDETISFTDNVN  
fig|1163749.3.peg.2475   Staphylococcus aureus subsp. aureus LCT-SA112       LYIIVMVLSVFIIGCDKSSDTSEK−−−−−−PKEDSKEAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|1169255.3.peg.78   Staphylococcus aureus M0946       LYIIVMVLSVFIIGCDKSSDTSEK−−−−−−PKEDSKEAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|282458.1.peg.415   Staphylococcus aureus subsp. aureus MRSA252       LYIIVMVLSVFIIGCDKSSDTSEK−−−−−−PKEDSKEAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|548470.3.peg.2108   Staphylococcus aureus subsp. aureus MN8       LYIIVMVLSVFIIGCDKSSDTSEK−−−−−−PKEDSKEAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|585150.3.peg.531   Staphylococcus aureus subsp. aureus C160       LYIIVMVLSVFIIGCDKSSDTSEK−−−−−−PKEDSKEAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|585151.3.peg.56   Staphylococcus aureus subsp. aureus C427       LYIIVMVLSVFIIGCDKSSDTSEK−−−−−−PKEDSKEAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|904728.3.peg.574   Staphylococcus aureus subsp. aureus 21195       LYIIVMVLSVFIIGCDKSSDTSEK−−−−−−PKEDSKEAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|585147.3.peg.1940   Staphylococcus aureus subsp. aureus A017934/97            MVLSVFIIGCDKSSDTSEK−−−−−−PKEDSKEAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|931453.3.peg.2534   Staphylococcus aureus subsp. aureus CIG149            MVLSVFIIGCDKSSDTSEK−−−−−−PKEDSKEAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|1137131.3.peg.1523   Staphylococcus aureus subsp. aureus 122051            MVLSVFIIGCDKSSDTSEK−−−−−−PKEDSKEAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGIWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|585160.3.peg.1953   Staphylococcus aureus subsp. aureus WBG10049            MVLSVFIIGCDKSSDTSEK−−−−−−PKEDSKEAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGIWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|548473.3.peg.39   Staphylococcus aureus subsp. aureus TCH60       LYIIVMVLSVFIIGCDKSSDTSEK−−−−−−PKEDSKEAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGIWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|548473.6.peg.76   Staphylococcus aureus subsp. aureus TCH60       LYIIVMVLSVFIIGCDKSSDTSEK−−−−−−PKEDSKEAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGIWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|1158485.3.peg.82   Staphylococcus aureus M1311                                       EDSKEEQIKKSFEKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKNKFPDRKNYNVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSELSVVDSLNF 
fig|1213730.3.peg.75   Staphylococcus aureus M0877                                       EDSKEEQIKKSFEKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKNKFPDRKNYNVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSELSVVDSLNF 
fig|553583.3.peg.2049   Staphylococcus aureus A9635                                       EDSKEEQIKKSFEKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKNKFPDRKNYNVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSELSVVDSLNF 
fig|904730.3.peg.988   Staphylococcus aureus subsp. aureus 21200                                       EDSKEEQIKKSFEKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKNKFPDRKNYNVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSELSVVDSLNF 
fig|931454.3.peg.938   Staphylococcus aureus subsp. aureus CIG1524                                       EDSKEEQIKKSFEKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKNKFPDRKNYNVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSELSVVDSLNF 
fig|1158687.3.peg.363   Staphylococcus aureus M0565            MVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|553588.3.peg.1737   Staphylococcus aureus A9719            MVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|681288.4.peg.395   Staphylococcus aureus subsp. aureus ED98            MVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|703339.3.peg.425   Staphylococcus aureus 04-02981            MVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|904750.3.peg.1068   Staphylococcus aureus subsp. aureus 21272            MVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|1116224.3.peg.426   Staphylococcus aureus subsp. aureus VRS11a       LYIIVMVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|1157030.3.peg.354   Staphylococcus aureus M0450       LYIIVMVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|1158480.3.peg.1242   Staphylococcus aureus M1253       LYIIVMVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|1158486.3.peg.2629   Staphylococcus aureus M1320       LYIIVMVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|1158685.3.peg.1197   Staphylococcus aureus M0539       LYIIVMVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|1169274.3.peg.366   Staphylococcus aureus M1309       LYIIVMVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|1224926.3.peg.2616   Staphylococcus aureus M0279       LYIIVMVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|158878.1.peg.443   Staphylococcus aureus subsp. aureus Mu50       LYIIVMVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|158878.14.peg.448   Staphylococcus aureus subsp. aureus Mu50       LYIIVMVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|359786.3.peg.861   Staphylococcus aureus subsp. aureus JH9       LYIIVMVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|450394.6.peg.2223   Staphylococcus aureus subsp. aureus USA300_TCH959       LYIIVMVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|505321.3.peg.511   Staphylococcus aureus subsp. aureus str. CF-Marseille       LYIIVMVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|548474.3.peg.1829   Staphylococcus aureus subsp. aureus TCH130       LYIIVMVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|553565.3.peg.2743   Staphylococcus aureus A5937       LYIIVMVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|553571.3.peg.641   Staphylococcus aureus A6300       LYIIVMVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|553581.3.peg.1270   Staphylococcus aureus A9299       LYIIVMVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|553592.3.peg.1775   Staphylococcus aureus A9763       LYIIVMVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|553596.3.peg.2360   Staphylococcus aureus A9781       LYIIVMVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|889933.4.peg.376   Staphylococcus aureus subsp. aureus ECT-R 2       LYIIVMVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|904731.3.peg.1569   Staphylococcus aureus subsp. aureus 21201       LYIIVMVVSVFIIGCNKSSDTSEK−−−−−−PKEDSKETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNF 
fig|585152.3.peg.353   Staphylococcus aureus subsp. aureus D139       LYISIMALSIFIIGCDKSSVTAEK−−−−−−AKEDSKEEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFEKGDKGMWTIYTD</