(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020331

fig|553567.3.peg.1130   Staphylococcus aureus A5948                                                                                                                                         MLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|1158539.3.peg.151   Staphylococcus aureus M0633                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|1305598.3.peg.208   Staphylococcus aureus M1                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|367830.3.peg.1664   Staphylococcus aureus subsp. aureus USA300                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|426430.6.peg.147   Staphylococcus aureus subsp. aureus str. Newman                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|455227.3.peg.219   Staphylococcus aureus D30                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|553590.4.peg.1208   Staphylococcus aureus A9754                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|553594.3.peg.867   Staphylococcus aureus A9765                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|904753.3.peg.2111   Staphylococcus aureus subsp. aureus 21282                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|904754.3.peg.2102   Staphylococcus aureus subsp. aureus 21283                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|904778.3.peg.144   Staphylococcus aureus subsp. aureus IS-88                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|93062.19.peg.188   Staphylococcus aureus subsp. aureus COL                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|93062.4.peg.655   Staphylococcus aureus subsp. aureus COL                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|931433.3.peg.763   Staphylococcus aureus subsp. aureus CIG1114                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|931442.3.peg.806   Staphylococcus aureus subsp. aureus CIG547                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|1028799.3.peg.153   Staphylococcus aureus subsp. aureus VC40                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|1112349.3.peg.1089   Staphylococcus aureus subsp. aureus NN50                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|93061.3.peg.183   Staphylococcus aureus subsp. aureus NCTC 8325                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|1158485.3.peg.306   Staphylococcus aureus M1311                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQNGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPQNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|1213730.3.peg.320   Staphylococcus aureus M0877                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQNGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPQNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|553583.3.peg.1841   Staphylococcus aureus A9635                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQNGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPQNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|904730.3.peg.1513   Staphylococcus aureus subsp. aureus 21200                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQNGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPQNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|931454.3.peg.710   Staphylococcus aureus subsp. aureus CIG1524                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQNGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPQNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|548474.3.peg.2278   Staphylococcus aureus subsp. aureus TCH130                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESITYN   
fig|1231383.3.peg.1390   Staphylococcus aureus KT/314250                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|196620.1.peg.186   Staphylococcus aureus subsp. aureus MW2                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|282459.1.peg.175   Staphylococcus aureus subsp. aureus MSSA476                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|282459.5.peg.197   Staphylococcus aureus subsp. aureus MSSA476                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|450394.6.peg.1961   Staphylococcus aureus subsp. aureus USA300_TCH959                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|762962.3.peg.1615   Staphylococcus aureus subsp. aureus ATCC 51811                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|931441.3.peg.426   Staphylococcus aureus subsp. aureus CIG1835                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|931459.3.peg.711   Staphylococcus aureus subsp. aureus CIGC128                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN   
fig|1224926.3.peg.2407   Staphylococcus aureus M0279                                                                                                                                         MLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|553592.3.peg.902   Staphylococcus aureus A9763                                                                                                                                         MLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|158878.1.peg.210   Staphylococcus aureus subsp. aureus Mu50                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|158878.14.peg.212   Staphylococcus aureus subsp. aureus Mu50                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|1116224.3.peg.219   Staphylococcus aureus subsp. aureus VRS11a                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|1157030.3.peg.151   Staphylococcus aureus M0450                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|1158480.3.peg.1034   Staphylococcus aureus M1253                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|1158486.3.peg.2421   Staphylococcus aureus M1320                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|1158685.3.peg.976   Staphylococcus aureus M0539                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|1158687.3.peg.156   Staphylococcus aureus M0565                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|1169274.3.peg.158   Staphylococcus aureus M1309                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|359786.3.peg.1086   Staphylococcus aureus subsp. aureus JH9                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|505321.3.peg.918   Staphylococcus aureus subsp. aureus str. CF-Marseille                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|553565.3.peg.2530   Staphylococcus aureus A5937                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|553571.3.peg.2114   Staphylococcus aureus A6300                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|553581.3.peg.2139   Staphylococcus aureus A9299                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|553588.3.peg.1524   Staphylococcus aureus A9719                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|553596.3.peg.847   Staphylococcus aureus A9781                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|681288.4.peg.182   Staphylococcus aureus subsp. aureus ED98                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|703339.3.peg.214   Staphylococcus aureus 04-02981                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|889933.4.peg.169   Staphylococcus aureus subsp. aureus ECT-R 2                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|904731.3.peg.1776   Staphylococcus aureus subsp. aureus 21201                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|904750.3.peg.860   Staphylococcus aureus subsp. aureus 21272                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|904783.3.peg.1783   Staphylococcus aureus subsp. aureus IS-122                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|931446.3.peg.744   Staphylococcus aureus subsp. aureus CIG1213                                                                        KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN   
fig|525378.3.peg.1283   Staphylococcus epidermidis M23864:W1                                                   KK−−−−−−−−−−−−−−−−−−−−−−ERQLVKDLDKTIFNVYPIKNLEDFYNIEGYKDENFDKQDKGTWYLNSAMNIQRKGEDLKSEGMLLKINRNTKTAKGYYYISSYF−−−−−−−−−TDKRGSQDSSEKRYPVKMVNNKFIITKPVHDNKVKNKIKNFKFFVQYGDFKDLKTNQYSKLGYNPNVPSYTLEYNLNNEENNVKKLREIYNIPTNKKPKLLIEGQSSLDHARVGYKSIEFSFIKRTDETISFTDNVNLQPSN
fig|1137131.3.peg.1523   Staphylococcus aureus subsp. aureus 122051                      MVLSVFIIGC−−−−DKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGIWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|585160.3.peg.1953   Staphylococcus aureus subsp. aureus WBG10049                      MVLSVFIIGC−−−−DKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGIWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|548473.3.peg.39   Staphylococcus aureus subsp. aureus TCH60         MRYLNRVVLYIIVMVLSVFIIGC−−−−DKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGIWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|548473.6.peg.76   Staphylococcus aureus subsp. aureus TCH60         MRYLNRVVLYIIVMVLSVFIIGC−−−−DKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGIWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|1163749.3.peg.2475   Staphylococcus aureus subsp. aureus LCT-SA112         MRYLNRVVLYIIVMVLSVFIIGC−−−−DKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|1169255.3.peg.78   Staphylococcus aureus M0946         MRYLNRVVLYIIVMVLSVFIIGC−−−−DKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|282458.1.peg.415   Staphylococcus aureus subsp. aureus MRSA252         MRYLNRVVLYIIVMVLSVFIIGC−−−−DKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|548470.3.peg.2108   Staphylococcus aureus subsp. aureus MN8         MRYLNRVVLYIIVMVLSVFIIGC−−−−DKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|585150.3.peg.531   Staphylococcus aureus subsp. aureus C160         MRYLNRVVLYIIVMVLSVFIIGC−−−−DKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|585151.3.peg.56   Staphylococcus aureus subsp. aureus C427         MRYLNRVVLYIIVMVLSVFIIGC−−−−DKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|904728.3.peg.574   Staphylococcus aureus subsp. aureus 21195         MRYLNRVVLYIIVMVLSVFIIGC−−−−DKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|585147.3.peg.1940   Staphylococcus aureus subsp. aureus A017934/97                      MVLSVFIIGC−−−−DKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|931453.3.peg.2534   Staphylococcus aureus subsp. aureus CIG149                      MVLSVFIIGC−−−−DKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−EAQIKKSFEKTLDMYPIKNLEDLYDKEGSRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|1158485.3.peg.82   Staphylococcus aureus M1311                                        DT−−TENQREDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFEKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKNKFPDRKNYNVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSELSVVDSLNFQPAK
fig|1213730.3.peg.75   Staphylococcus aureus M0877                                        DT−−TENQREDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFEKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKNKFPDRKNYNVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSELSVVDSLNFQPAK
fig|553583.3.peg.2049   Staphylococcus aureus A9635                                        DT−−TENQREDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFEKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKNKFPDRKNYNVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSELSVVDSLNFQPAK
fig|904730.3.peg.988   Staphylococcus aureus subsp. aureus 21200                                        DT−−TENQREDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFEKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKNKFPDRKNYNVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSELSVVDSLNFQPAK
fig|931454.3.peg.938   Staphylococcus aureus subsp. aureus CIG1524                                        DT−−TENQREDSK−−−−−−−−−−−−−−−−−−−−−−EEQIKKSFEKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−EKNKFPDRKNYNVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSELSVVDSLNFQPAK
fig|1158687.3.peg.363   Staphylococcus aureus M0565                      MVVSVFIIGC−−−−NKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|553588.3.peg.1737   Staphylococcus aureus A9719                      MVVSVFIIGC−−−−NKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|681288.4.peg.395   Staphylococcus aureus subsp. aureus ED98                      MVVSVFIIGC−−−−NKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|703339.3.peg.425   Staphylococcus aureus 04-02981                      MVVSVFIIGC−−−−NKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|904750.3.peg.1068   Staphylococcus aureus subsp. aureus 21272                      MVVSVFIIGC−−−−NKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|1116224.3.peg.426   Staphylococcus aureus subsp. aureus VRS11a         MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|1157030.3.peg.354   Staphylococcus aureus M0450         MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|1158480.3.peg.1242   Staphylococcus aureus M1253         MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|1158486.3.peg.2629   Staphylococcus aureus M1320         MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|1158685.3.peg.1197   Staphylococcus aureus M0539         MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|1169274.3.peg.366   Staphylococcus aureus M1309         MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|1224926.3.peg.2616   Staphylococcus aureus M0279         MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|158878.1.peg.443   Staphylococcus aureus subsp. aureus Mu50         MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|158878.14.peg.448   Staphylococcus aureus subsp. aureus Mu50         MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|359786.3.peg.861   Staphylococcus aureus subsp. aureus JH9         MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|450394.6.peg.2223   Staphylococcus aureus subsp. aureus USA300_TCH959         MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|505321.3.peg.511   Staphylococcus aureus subsp. aureus str. CF-Marseille         MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|548474.3.peg.1829   Staphylococcus aureus subsp. aureus TCH130         MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|553565.3.peg.2743   Staphylococcus aureus A5937         MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|553571.3.peg.641   Staphylococcus aureus A6300         MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|553581.3.peg.1270   Staphylococcus aureus A9299         MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|553592.3.peg.1775   Staphylococcus aureus A9763         MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|553596.3.peg.2360   Staphylococcus aureus A9781         MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAK
fig|889933.4.peg.376   Staphylococcus aureus subsp. aureus ECT-R 2         MGYFKRVVLYIIVMVVSVFIIGC−−−−NKSSDT−−SEKPKEDSK−−−−−−−−−−−−−−−−−−−−−−ETQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSSVG