(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020328

fig|585161.3.peg.978   Staphylococcus aureus subsp. aureus WW2703/97                                                            MLNEQKQEQKEKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKENAEKERK−−−−−−−−−KKQQEEKEQNELDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QANQYQQLPQQNQYQYVPPQ−−−−−QQAPTKQRPAKEENDDKA−−−−−−SKDESKDKDDK−−−−−−−−−−−−−−ASQDKSDDN−−−−−QKKTDDNKQP−−AQPKPQPQQPTPKPNNNQQNNQSNQ−−−−QAKPQA−−−−−−−−−PQQNSQSTTNKQNNANDK                                
fig|1158485.3.peg.2383   Staphylococcus aureus M1311     MSNQNYDYKTNEDGSKKKMSTTAKVVSIATVLLLLGGLVFAIFAYVDHSNKAKERMLNEQKQEQKEKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKENAEKERK−−−−−−−−−KKQQEEKEQNELDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QTNQYQQLPQQNQYQYVPPQ−−−−−QQAPTKQRPAKEENDDKA−−−−−−SKDESKDKDDK−−−−−−−−−−−−−−ASQDKSDDN−−−−−QKKTDDNKQP−−AQPKPQPQQPTPKPNNNQQNNQSNQ−−−−QAKPQA−−−−−−−−−SQQNSQSTTNKQNNANDK                                
fig|904727.3.peg.1876   Staphylococcus aureus subsp. aureus 21194     MSNQNYDYKTNEDGSKKKMSTTAKVVSIATVLLLLGGLVFAIFAYVDHSNKAKERMLNEQKQEQKEKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKENAEKERK−−−−−−−−−KKQQEEKEQNELDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QTNQYQQLPQQNQYQYVPPQ−−−−−QQAPTKQRPAKEENDDKA−−−−−−SKDESKDKDDK−−−−−−−−−−−−−−ASQDKSDDN−−−−−QKKTDDNKQP−−AQPKPQPQQPTPKPNNNQQNNQSNQ−−−−QAKPQA−−−−−−−−−SQQNSQSTTNKQNNANDK                                
fig|585147.3.peg.365   Staphylococcus aureus subsp. aureus A017934/97                       MSTTAKVVSIATVLLLLGGLVFAIFAYVDHSNKAKERMLNEQKQEQKEKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKENAEKERK−−−−−−−−−KKQQEEKEQNELDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QANQYQQLPQQNQYQYVPPQ−−−−−QQAPTKQRPAKEENDDKA−−−−−−SKDESKDKDDK−−−−−−−−−−−−−−ASQDKSDDN−−−−−QKKTDDNKQP−−AQPKPQPQQPTPKPNNNQQNNQSNQ−−−−QAKPQA−−−−−−−−−PQQNSQSTTNKQNNANDK                                
fig|1157018.3.peg.258   Staphylococcus aureus M0239     MSNQNYDYNKNEDGSKKKMSTTAKVVSIATVLLLLGGLVFAIFAYVDHSNKAKERMLNEQKQEQKEKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKENAEKERK−−−−−−−−−KKQQEEKEQNELDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QANQYQQLPQQNQYQYVPPQ−−−−−QQAPTKQRPAKEENDDKA−−−−−−SKDESKDKDDK−−−−−−−−−−−−−−ASQDKSDDN−−−−−QKKTDDNKQP−−AQPKPQPQQPTPKPNNNQQNNQSNQ−−−−QAKPQA−−−−−−−−−PQQNSQSTTNKQNNANDK                                
fig|553568.3.peg.1905   Staphylococcus aureus A6224     MSNQNYDYNKNEDGSKKKMSTTAKVVSIATVLLLLGGLVFAIFAYVDHSNKAKERMLNEQKQEQKEKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKENAEKERK−−−−−−−−−KKQQEEKEQNELDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QANQYQQLPQQNQYQYVPPQ−−−−−QQAPTKQRPAKGENDDKA−−−−−−SKDESKDKDDN−−−−−−−−−−−−−−ASQDKSDDN−−−−−QKKTDDNKQP−−AQPKPQPQQPTPKPNNNQQNNQSNQ−−−−QAKPQA−−−−−−−−−PQQNSQSTTNKQNNANDK                                
fig|282459.1.peg.730   Staphylococcus aureus subsp. aureus MSSA476     MSNQNYDYNKNEDGSKKKMSTTAKVVSIATVLLLLGGLVFAIFAYVDHSNKAKERMLNEQKQEQKEKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKENAEKERK−−−−−−−−−KKQQEEKEQNELDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QANQYQQLPQQNQYQYVPPQ−−−−−QQAPTKQRPAKEENDDKA−−−−−−SKDESKDKDDN−−−−−−−−−−−−−−ASQDKPDDN−−−−−QKKTDDNKQP−−AQPKPQPQQPTPKPNNNQQNNQSNQ−−−−QAKPQA−−−−−−−−−PQQNSQSTTNKQNNANDK                                
fig|1169274.3.peg.690   Staphylococcus aureus M1309     MSNQNYDYNKNEDGSKKKMSTTAKVVSIATVLLLLGGLVFAIFAYVDHSNKAKERMLNEQKQEQKEKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKENAEKERK−−−−−−−−−KKQQEEKEQNELDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QANQYQQLPQQNQYQYVPPQ−−−−−QQAPTKQRPAKEENDDKA−−−−−−SKDESKDKDDN−−−−−−−−−−−−−−ASQDKSDDN−−−−−QKKTDDNKQP−−AQPKPQPQQPTPKPNNNQQNNQSNQ−−−−QAKPQA−−−−−−−−−PQQNSQSTTNKQNNANDK                                
fig|553580.3.peg.1637   Staphylococcus aureus A8819     MSNQNYDYNKNEDGSKKKMSTTAKVVSIATVLLLLGGLVFAIFAYVDHSNKAKERMLNEQKQEQKEKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKENAEKERK−−−−−−−−−KKQQEEKEQNELDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QANQYQQLPQQNQYQYVPPQ−−−−−QQAPTKQRPAKEENDDKA−−−−−−SKDESKDKDDN−−−−−−−−−−−−−−ASQDKSDDN−−−−−QKKTDDNKQP−−AQPKPQPQQPTPKPNNNQQNNQSNQ−−−−QAKPQA−−−−−−−−−PQQNSQSTTNKQNNANDK                                
fig|1158486.3.peg.288   Staphylococcus aureus M1320     MSNQNYDYNKNEDGSKKKMSTTAKVVSIATVLLLLGGLVFAIFAYVDHSNKAKERMLNEQKQEQKEKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKENAEKERK−−−−−−−−−KKQQEEKEQNELDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QANQYQQLPQQNQYQYVPPQ−−−−−QQAPTKQRPAKEENDDKA−−−−−−SKDESKDKDDN−−−−−−−−−−−−−−ASQDKSDDN−−−−−QKKTDDNKQP−−AQPKPQPQQPTPKPNNNQQNNQSNQQAKPQAKPQA−−−−−−−−−PQQNSQSTTNKQNNANDK                                
fig|1158501.3.peg.292   Staphylococcus aureus M1533     MSNQNYDYNKNEDGSKKKMSTTAKVVSIATVLLLLGGLVFAIFAYVDHSNKAKERMLNEQKQEQKEKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKENAEKERK−−−−−−−−−KKQQEEKEQNELDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QANQYQQLPQQNQYQYVPPQ−−−−−QQAPTKQRPAKEENDDKA−−−−−−SKDESKDKDDN−−−−−−−−−−−−−−ASQDKSDDN−−−−−QKKTDDNKQP−−AQPKPQPQQPTPKPNNNQQNNQSNQQAKPQAKPQA−−−−−−−−−PQQNSQSTTNKQNNANDK                                
fig|553574.3.peg.2375   Staphylococcus aureus A8117                       MSTTAKVVSIATVLLLLGGLVFAIFAYVDHSNKAKERMLNEQKQEQKEKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKENAEKERK−−−−−−−−−KKQQEEKEQNELDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QANQYQQLPQQNQYQYVPPQ−−−−−QQAPTKQRPAKEENDDKA−−−−−−SKDESKDKDDN−−−−−−−−−−−−−−ASQDKSDDN−−−−−QKKTDDNKQP−−AQPKPQPQQPTPKPNNNQQNNQSNQ−−−−QAKPQA−−−−−−−−−PQQNSQSTTNKQNNANDK                                
fig|553596.3.peg.1818   Staphylococcus aureus A9781                       MSTTAKVVSIATVLLLLGGLVFAIFAYVDHSNKAKERMLNEQKQEQKEKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKENAEKERK−−−−−−−−−KKQQEEKEQNELDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QANQYQQLPQQNQYQYVPPQ−−−−−QQAPTKQRPAKEENDDKA−−−−−−SKDESKDKDDN−−−−−−−−−−−−−−ASQDKSDDN−−−−−QKKTDDNKQP−−AQPKPQPQQPTPKPNNNQQNNQSNQQAKPQAKPQA−−−−−−−−−PQQNSQSTTNKQNNANDK                                
fig|450394.6.peg.1334   Staphylococcus aureus subsp. aureus USA300_TCH959     MSNQNYDYNKNEDGSKKKMSTTAKVVSIATVLLLLGGLVFAIFAYVDHSNKAKERMLNEQKQEQKEKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKENAEKERK−−−−−−−−−KKQQEEKEQNELDS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QANQYQQLPQQNQYQYVPPQ−−−−−QQAPTKQRPAKEENDDKA−−−−−−SKDESKDKDDN−−−−−−−−−−−−−−ASQDKSDDN−−−−−QKKTDNNKQP−−AQPKPQPQQPTPKPNNNQQNNQSNQ−−−−QAKPQA−−−−−−−−−PQQNSQSTTNKQNNANDK                                
fig|698737.3.peg.1996   Staphylococcus lugdunensis HKU09-01     MSKENKQFNDYEDSDKKRMGTGAKVISIITVLLLLGGLVFAVFSFVDHSNRANERLNKQSTEEKKEGS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KKKDNKTNEQ−−−−−−−−−KKKQPTQETQQTQQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QIPQTQQTPQTTQQPPATQQKPR−−−−−KPSTEERNTQEKNTKEP−−−−−−STEENNQPDKT−−−−−−−−−−−KEPATQEKSKES−−−−−NSRNDNKTPT−−−−RESSGQQRSNKPSAQQPSSNQNGQQNKQRNS−−−−−−−−−−−HQSNTSQSTSK                                       
fig|596319.3.peg.807   Staphylococcus warneri L37603           DFNEYDNQGKKGMSCIAKIISIIIVLLLLGGLTFAIFSFVDHSKKANERLNNETKQEQKDKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKDDKEKKEK−−−−−−−−−SSDKKSDEKQNTQQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KPSQQQTRQQPTTQQQPSTQQPKSQ−−−−−QPKTQQKPKVDNKTKEA−−−−−−PTKEKPSKQEK−−−−−−−−−−−−−PSTQEKPSTQ−−−−−EKPSTQEKPS−−TQEKPSTQQKPSTQEKPSTQQKPSTQEKPSA                                                               
fig|629742.3.peg.115   Staphylococcus hominis SK119     MSKKNRNLKDYEAHEKKKMSGISKIISTLIVLLLLGGLVFAVFAFVDNSNRVNERLNNQSTEEHKDKKDK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DTKSNKKNEE−−−−−−−−−STQENTTSENNTNN−−−−−−−−−−−−−−−−SKENKLDNVKNPNVTDNYSNEQNNSIKVQPTNQGKTAQ−−−−−TQQSSKETSTKQPNTNQIQSTQQKENSQTQQKENA−−−−−−−−−−−−−−PTQEKATQE−−−−−ETDKSNENTQ−−SSQSSRSNDSTETSQHKSSNNDTTTTQE                                                                  
fig|279808.8.peg.2085   Staphylococcus haemolyticus JCSC1435     MSKNNRNRDDFGEPEKKKMSGISKLISTIIVLLLLSGLAFAIFAFVDHSNRSSERLNNQSTEEHKDKNDKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKEDKDKKDK−−−−−−−−−SDKDKKTSEDSSNV−−−−−−−−−−−−−−−−−−−−−−−−TQENVTQQTAQTQQRQTQQATPSTQQRTKQ−−−−−QPLTEEKQRTKEAQTKEE−−−−−−KTQERTTKEEA−−−−−−−−−−−−−−TTEEARTKE−−−−−QATQESNSNN−−SSDSNSSESNTDKSNSNQTSNQTRTQQSP                                                                 
fig|411486.3.peg.2814   Clostridium sp. M62/1                                                                                                            RREGSGREASESYSQRARHEEAASREERGQRSE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RNQRTDMTRETYRGPERAEE−−−−−HRRGGYTRPAQERTAAGR−−−−−−DRMQESRREQE−−−−LEFEEIRRRPQSQRPSAST−−−−−ENGRREAYGR−−NYGYPEERDSYSQRRTSPRPDRRNSPDRR                                                                 
fig|469609.3.peg.553   Streptococcus sp. 2_1_36FAA                                                                                                            SQNRNDRRNR−−−−−−−−−QEQGNQHRNQGQSQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YNQQRQSFNQGPKIDFKARAAALKAEQNAEYARSSEERFKQAK−−−−−−ANKEALREQNK−−−−−−−−−−−−−−RKEQAKLEDLFVEVESPKTTAQAP−−ATPAPTTQEPAVDTRRKKQARPDKERDNFDHEEDG−−−−−−−−−PRKQQKNRSS                                        
fig|467705.8.peg.539   Streptococcus gordonii str. Challis substr. CH1                                                                                                            SQNRNDRRNR−−−−−−−−−QEQGNQHRNQGQSQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YNQQRQSFNQGPKIDFKARAAALKAEQNAEYARSSEERFKQAK−−−−−−ANKEALREQNK−−−−−−−−−−−−−−RKEQAKLEDLFVEVESPKPTAKAP−−ATPAPTAQDPAVDTRRKKQARPDKERDNFDHEEDG−−−−−−−−−PRKQQKNRSS                                        
fig|517417.4.peg.876   Chlorobaculum parvum NCIB 8327                                                                                                         DKLQKSEDQRLQKATEQDKEIQKKEDNKLQQKDDVD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IQKSEDDKLQKATEPDKDIQKKK−−−−−DDKLQQKNDEELQKSED−−−−−−DKLQKATEPDK−−−−−−−−−−−−−−DIQKKEDDKL−−−−QQKEDETLQK−−SEDDKLQKATELDKDIQKKEDDKLQKT−−−−−−−−−−−−−−−−−EGDKLQRKENSQAT                                    
fig|316273.3.peg.3457   Xanthomonas campestris pv. vesicatoria str. 85-10                                                    RMQASVAAQARQEREQQDRL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AQEQHAAQVR−−−−−−−−−EHLQQAQPQREERS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QSEQAVQAHAVLEGQRQAEQ−−−−−QRELEERQLQERQAQTS−−−−−−QQRELQEREER−−−−−−−−−−−−−−DVQERQVQE−−−−−RQAQDNQQRE−−QQDRQAQEATRVEVQERQAQQDPSQHA−−−−−−−−−−−−−−−−−WQQADPQPHAPNA                                     
fig|445972.6.peg.3010   Anaerotruncus colihominis DSM 17241                                                                                                          KLTEEQLSMGVEALEKRSVVERAAPRKKKTRQPVK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ETAARLLQKVTPEQAEETS−−−−−−−−−−−−AKPAAKKSASRA−−−−−−EKPAKKEPQKR−−−−−−−−−−−−−−DAAKKEPAR−−−−−KEPAKKEPSV−−KKENGEPRQPKRGRKPSPKASAP                                                                       
fig|510951.3.peg.8356   Neurospora tetrasperma FGSC 2508 mat A                                                                                                            NKRVHEEAQP−−−−−−KVHRKAQQRPREHDQKQ−−−−−−−−−−−−−−−−GQQKIQEQTQDHDQRGGQKEAPENSTFTTPARTVQPMK−−−−−PNNQDPAGEEQSVNSLQ−−−−−−VEPPKPKTSQP−−−−−−−−−−−−−−MKSAMKQSF−−−−−AQESQSRTIN−−FPVVKDPQDPNTRARLSQKSGSQKNEGNVTRKQLAFDPQPTILGPSAQARPGQTKPN                                     
fig|525376.3.peg.600   Staphylococcus epidermidis W23144                         VIIITILLLASSFILLLNLRHRDVTKSLFDNLKSSSNHASESIKQKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EQNKIKKEEKAQLKEEKIERKKQKKSRQNNNVI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KDVSDFPEISQSNDI−−−−−PIYGHNEQEDKRQNTTN−−−−−−QRQKRVLDNEQ−−−−−−−−−−−−−−FQQSLPSTK−−−−−NQSINNNQPS−−TTAENNQQQSKAEGSISEAGEEANIEYTVPPLSLLKQ−−−−−−−PTKQKTTSK                                         
fig|525264.4.peg.1927   Corynebacterium pseudogenitalium ATCC 33035                                                             SQPANSKPATG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QQQAQKPDSP−−−−−KRVPANSAKKQPQPQPAP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KKNAQPSKPSQPQKGQGSAR−−−−−TPETAKQKAGPQASAPSA−−−−−−PKPKKGTTAPT−−−PKVASPKTAADASQQKARST−−−−−QNKTTQDGNK−−VVQPKSQQGAPSKGNLPKQEAKTQQPQ−−−−−−−−−−−−−−−−−PKAKEATPQNKTKKATKRR                               
fig|435590.6.peg.3633   Bacteroides vulgatus ATCC 8482                                                                                                            EDEMWKREQK−−−−−−−−−QQDRERQKQQKDAP−−−−−−−−−−−−−−−−−−−−QHRNTSQHHDAASQHRNTSQHHDAAPQQRNTSQH−−−−−−−−−−−HDTAPQQRNTSQ−−−−−−HHDAASQHRNT−−−−−−−−−−−−−−−SQHHDTAS−−−−−QHHDAASQHH−−NTSQHHDAAPQQRNTAQRKPHIPLQPP                                                                   
fig|314291.3.peg.4598   Vibrio splendidus 12B01                                         DRGEQRNERGDRSEQRNERGDNRNENRDNKRRRKPVRDEKT−−−−−−−−−−−−−−−−−−−−−−−−−−EEQKEAAPQQ−−−−−−−−−TRQPRKPKQDRRNK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PRDEQKQQEEQVPSKLAEEGLQLAA−−−−−EAQADKPEAPKAKPEAKA−−−−−−VKIKERRQRRK−−−−−−−−−−−−LNKLVRVKDQQ−−−−−AQAEADNNAD−−−−−−−−NASKEQKAQTANHEQAVAQEQ−−−−−−−−−−−−−−−−−KVVEQVGATQVNA                                     
fig|530557.3.peg.317   Vibrio splendidus 12F01                                         DRGEQRNERGDRSEQRNERGDNRNENRDNKRRRKPVRDEKT−−−−−−−−−−−−−−−−−−−−−−−−−−EEQKEAAPQQ−−−−−−−−−TRQPRKPKQDRRNK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PRDEQKQQEEQVPSKLAEEGLQLAA−−−−−EAQADKPEAPKAKPEAKA−−−−−−VKIKERRQRRK−−−−−−−−−−−−LNKLVRVKDQQ−−−−−AQAEADNNAD−−−−−−−−NASKEQKAQTANHEQAVAQEQ−−−−−−−−−−−−−−−−−KVVEQVGATQVNA                                     
fig|150340.18.peg.3336   Vibrio sp. Ex25                                                                                                          EQANEQNEAQQQ−−−−−−−−−TNKQQNRNQKRKPK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AQQADKAQEQKANAKVAEKGLQLAAEARTETKPEESKPKQQNAKAEK−−−−−−VKERRQRRKLN−−−−−−−−−−−−−−KSVRVKDQE−−−−−AVEKKTEETA−−VKTQEMVETKVEKPTEAAVETQQDNKQ−−−−−−−−−−−−−−−−−AESKQRRNRRSPRHLRASGQ                              
fig|314288.6.peg.3408   Vibrio alginolyticus 12G01                                                                                                          EQANEQNEAQQQ−−−−−−−−−TNKPQNRNQKRKPK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AQQADKAQEQKANAKVAEKGLQLAAEARTETKPEESKPKQQNAKAEK−−−−−−VKERRQRRKLN−−−−−−−−−−−−−−KSVRVKDQE−−−−−AIEKKAEETA−−VKTQETVEAKVEKPTEAAVEAQQDNKQ−−−−−−−−−−−−−−−−−AESKQRRNRRSPRHLRASGQ                              
fig|391591.24.peg.4991   Vibrio shilonii AK1                                                                 NDRNKNRRNKPARDE−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKESKDNAQE−−−−−−−−−SRKQQNRRGKQQDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RNKKRDEESGKSKVEEQGQQIAA−−−−−DVQAEKKAPRSEEKAAK−−−−−−VKERRQRRKLS−−−−−−−−−−−−−−KQVRVKDQK−−−−−−AQQEEQAAQ−−VTSVETAQTAVEKPQAPEAATEAPVKEEGKQRRNRRSPRHLRASGQRRRRGRDRRPN                                     
fig|575586.4.peg.1643   Acinetobacter johnsonii SH046                                                                                                            EKEERGTRHN−−−−−−−−−KKRPNKHKESREQN−−−−−−−−−−−−−−−−AQHDN−−−−−−−−−−−−−QIHEEIVQVSRQDQQRQDRY−−−−−EQRPERNEPQRQERHEQR−−−−−−SERSEQQRQDR−−−−−−−−−−−−−−−SERSEQQR−−−−−QEPRENKRSS−−−−−−−RRQHGEQQQNTDVQNEQQNAMPRRDRRNQ−−−−−−−−−−PRPERPNRHRDPS                                     
fig|65393.5.peg.3642   Cyanothece sp PCC 7424                                                                 EEEIQK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QRQAEAKRQA−−−−−−−−−KLERQRREEEAQRQ−−−−−−−−−−−−−−−−AELDRQR−−−−−−−−−−−REEEAQRQAELDRQRREEEI−−−−−−−−−−−−QKQRQAEAKRQ−−−−−−AKLERQRREEE−−−−−−−−−−−−−−AQRQAELDR−−−−−QRREEEIQKQ−−−−−−−RQAEAKRQAKLERQRREEEAQKRF−−−−−−−−−−−−−−−NSERQQTTSQSST                                     
fig|203122.12.peg.1048   Saccharophagus degradans 2-40                                                              DPEEKEADNTADKVMRMAVPDSQIAKVPTNTGGVFRKLFRRPAKPNNEEKISRKAPNEEPQLKEDKELQRKEDRELQRT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EDKELQRKGDRELQRAEDKE−−−−−−−−−−−LQRKENEELQRK−−−−−−EDKELQRKEDE−−−−−−−−−−−−−−NLQRKEDKE−−−−−LQRKEEDIQR−−−−−−−−−−−−ASQPDKELARKPEQEQEPKIARKPQVEEQQLQRKAHEQQEEIQRKAEGSPDAGSN                             
fig|203122.15.peg.1150   Saccharophagus degradans 2-40                                                              DPEEKEADNTADKVMRMAVPDSQIAKVPTNTGGVFRKLFRRPAKPNNEEKISRKAPNEEPQLKEDKELQRKEDRELQRT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EDKELQRKGDRELQRAEDKE−−−−−−−−−−−LQRKENEELQRK−−−−−−EDKELQRKEDE−−−−−−−−−−−−−−NLQRKEDKE−−−−−LQRKEEDIQR−−−−−−−−−−−−ASQPDKELARKPEQEQEPKIARKPQVEEQQLQRKAHEQQEEIQRKAEGSPDAGSN                             
fig|413071.3.peg.2586   Trichoderma virens Gv29-8                                                                 EAEKKKIAEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KQKAEEKRKQ−−−−−−−−−KEAQKKAEEDARLK−−−−−−−−−−−−−−−−KEAERLRR−−−−−−−−−−IHEQKEKQAESERKAREAKE−−−−−−−−−−−REKKLKDEQRTR−−−−−−EREAREQKERE−−−−−−−−−−−−−−AQERKEKQE−−−−−RDKREKEARA−−−−−−−AKAQKESQEAAEAAREQQLQLQRAKEEKAA−−−−−−−−−PKVSSVQVTQTQPS                                    
fig|536232.3.peg.528   Clostridium botulinum A2 str. Kyoto                                                             NKSAEVVKSNTENEKKLVAIK−−−−−−−−−−−−−−−−−−−−−−−−−−SEKEQEREKSSEPVQTKATEEAQKKAAEETQRK−−−−−−−−−−−−−−−−ATEDAQRK−−−−−−−−−−EAEEAQRKVAEETQRKEAEE−−−−−AQRKAAEEAQRKEAEES−−−−−−QRKAAEETQRK−−−−−−−−−−−−−−−−−−−EAEE−−−−−AQRKEAEEAQ−−−−−−−−−−−−RKAAEAEASKSQQKEQSNVSEKAPA                                                           
fig|445335.4.peg.455   Clostridium botulinum NCTC 2916                                                             NKSAEVVKSNTENEKKLVAIK−−−−−−−−−−−−−−−−−−−−−−−−−−SEKEQEREKSSEPVQTKATEEAQKKAAEETQRK−−−−−−−−−−−−−−−−ATEDAQRK−−−−−−−−−−EAEEAQRKVAEETQRKEAEE−−−−−AQRKAAEEAQRKEAEEA−−−−−−QRKAAEETQRK−−−−−−−−−−−−−−−−−−−EAEE−−−−−AQRKEAEEAQ−−−−−−−−−−−−RKAAEAEASKSQQKEQSNVSEKAPA                                                           
fig|272635.1.peg.508   Mycoplasma pulmonis UAB CTIP                                                                                                            NNSNNKTNDS−−−−−−−−−SSSEKQEKNESPMG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NQMNLNTLKPKVDEKTNQ−−−−−KNTNQMEKTPQQGPIKPQ−−−−−−DEVEDKTQTKP−−−−−−−−−−−−−−NQPQKDTNE−−−−−PSKMEPKPES−−KPKNNENAKANSKDKNNQDSLAKKEEK−−−−−−−−−−−−−−−−−PKTQEKNLNNSQK                                     
fig|272635.4.peg.513   Mycoplasma pulmonis UAB CTIP                                                                                                            NNSNNKTNDS−−−−−−−−−SSSEKQEKNESPMG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NQMNLNTLKPKVDEKTNQ−−−−−KNTNQMEKTPQQGPIKPQ−−−−−−DEVEDKTQTKP−−−−−−−−−−−−−−NQPQKDTNE−−−−−PSKMEPKPES−−KPKNNENAKANSKDKNNQDSLAKKEEK−−−−−−−−−−−−−−−−−PKTQEKNLNNSQK                                     
fig|335543.9.peg.1579   Syntrophobacter fumaroxidans MPOB                                                            EPRGPRQPEQRI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KRDEPSQQGP−−−−−−−−−GQRPQLQDQRRPPA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QDDRRTIKPQEQQPQRR−−−−−PDMQEQKRPGVQEQRRPQ−−−−−−MQEQRRPEVQE−−−−−−−−−−−−−−−QRRPQVQE−−−−−QRRPPAQDDR−−RTIKPQEQQPQRRPEVQEQRRPQVQEQRRPQMQEQRR−−−−−−−PQVQEQRRPQMQEQRPGA                                
fig|411468.9.peg.1102   Clostridium scindens ATCC 35704                                                                                                            NRQAPQQGRP−−−−−−−MQVNNGRPAKQQARPA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−APAQETTQQARPQERPADKS−−−−−FEQAKRPAAASQERAQTQ−−−−−−ERQAERPASDR−−−−−−−−−−−−SQAPRRQERSD−−−−−DRRQDTRGNS−−GNRPQGGRPQGNRQDRPQGSRPQQGGR−−−−−−−−−−−−−−−−−PQGNRQDRLQGDRNQSRK                                
fig|272635.1.peg.734   Mycoplasma pulmonis UAB CTIP                                                                NNQDTGKINNNSPTSSKPNIGNIE−−−−−−−−−−−−−−−−−−−−QEGSQTPNNP−−−−−−−−−NVEEQKSDSPKAPD−−−−−−−−−−−−−−−−TQDSGKKQE−−−−−−−−−EELKSPSSPDAGQSQPESPQ−−−−−NPSTPNSEDKDQKPEEPQ−−−−−−APDKSKDENQM−−−−−−−−−−−−−−LGESQTPDT−−−−−PNVEDTQPEA−−PQSPNPEEPNNSEENMDSNSDKEKESK−−−−−−−−−−−−−−−−−PKWWEKSENAPVELLNIISD                              
fig|272635.4.peg.750   Mycoplasma pulmonis UAB CTIP                                                                NNQDTGKINNNSPTSSKPNIGNIE−−−−−−−−−−−−−−−−−−−−QEGSQTPNNP−−−−−−−−−NVEEQKSDSPKAPD−−−−−−−−−−−−−−−−TQDSGKKQE−−−−−−−−−EELKSPSSPDAGQSQPESPQ−−−−−NPSTPNSEDKDQKPEEPQ−−−−−−APDKSKDENQM−−−−−−−−−−−−−−LGESQTPDT−−−−−PNVEDTQPEA−−PQSPNPEEPNNSEENMDSNSDKEKESK−−−−−−−−−−−−−−−−−PKWWEKSENAPVELLNIISD                              
fig|585530.3.peg.1625   Brevibacterium mcbrellneri ATCC 49030                                              WVAHGNPNDETVLHRSNINLTDEQKNTLFPAEDPKE−−−−−−−−−−−−−−−−−−−−−−−−−−QETQDPKDPE−−−−−−−−−TQDPQEPTEPEAPD−−−−−−−−−−−−−−−−TKEPET−−−−−−−−−−−−PETQKPNEPGTPENGNDEAT−−−−−EPGTKEPEAPDTPENGD−−−−−−DKPTDPETQDP−−−−−−−−−−−−KEPEVPDTKEP−−−−−EVPEAQEPNE−−PGTPENGDGEPTEPGTKEPEVKEPE−−−−−−−−−−−−−−−−−−−VIQPEAQGPDGQN                                     
fig|262543.8.peg.1797   Exiguobacterium sibiricum 255-15                                                                DVEADQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TTDEPTTDEP−−−−−−−−−TTDEPTTDEPTTDE−−−−−−−−−−−−−−−−PETD−−−−−−−−−−−−−−EPTTDEPTTDEPATDEPTTD−−−−−EPTTDEPATDEPTTDE−−−−−−PTTDEPTTDEP−−−−−−−−−−−−−−TTDEPTTDE−−−−−PAASDGASTQ−−SNRGNSSNGNQGRGQDNSPADQQSESE                                                                   
fig|434271.4.peg.1172   Actinobacillus pleuropneumoniae serovar 3 str. JL03                                      LLAGLVITACGSKNHSIDIKPKSDKPKQEQPKQPQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PKQDQPKQEQ−−−−−−−−−PKQEQPKQEQPKQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QPKQEQPKQDQPKQEQPKQE−−−−−QPKQ−−DQPKQEQPKQDQ−−−−−−PKQDQPKQEQP−−−−−−−−−−−−−−−−KQDQPKQ−−−−−EQPKQDQPKQ−−−DQPKQDQPKQDQPKQDQPKQEQPKQDQPKDKTSGGVFIVEGVSKNLPQLTKEK                                        
fig|497964.5.peg.4277   Chthoniobacter flavus Ellin428                                                                                                             KPNQPPRKP−−−−−−−−−AEAEKPAPPEKKPE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KKSERPAQPQQPIEKPEKPA−−−−−KPQKPERPPKEEIKRPQAPVEPMTKRPPAEAPKE−−−−−−−−−−−KRPEQPVPKPPE−−−−−ERPREGKHKE−−PAPQVSRPETKEAPKPENKSKEPPKE                                                                    
fig|419610.8.peg.4347   Methylobacterium extorquens PA1                                                                 ERPAAQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RQERPERPDR−−−−−−−−−QERQERPDRQERPE−−−−−−−−−−−−−−−−RATPPQRPDRSEEQPAAPASRERAPDRDAPARREAPER−−−−−EAPARRETPERPDRDGQ−−−−−−DRPGRPAGREA−−−−−−−−−−−−−−DRPDGAPNQ−−−−−RRAPNAPTPP−−NAERPEQATPPTATNPAQPNTPPNQRPGVPGRPAT−−−−−−−−−PNVQQPT                                           
fig|9606.3.peg.28909   Homo sapiens (Human)                                                                                                    QPLGPAKPPAQQTGSEKP−−−−−−−−−SSEQPGPKALAQPP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GVGKTPAQQPGPAKPPTQ−−−−−QVGTPKPLAQQPGLQSP−−−−−−AKAPGPTKTPP−−−−−−−−−−−−−−−−GSAKPPS−−−−−QQPGSTKPPP−−QQPGPAKPSPQQPGSTKPPSQQPGSAK−−−−−−−−−−−−−−−−−PSAQQPSPAKPSAQQSTK                                
fig|7227.3.peg.14477   Drosophila melanogaster (Fruit fly)                                                                                                             EEKSEAEEP−−−−−−−−−TKMETSSSEIKADV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DVEVEVEEKDKEKPAQTDTESK−−−−−−−−−−−ETPAKEEIADDK−−−−−−SKQDEPEEKKI−−−−−−−−−−−−−−EKQSREGEE−−−−−KSETDEKPTEMTTVSTEEEKQPTANCDNHQQNNNSNSKA−−−−−−−−−−−−−−−−−SNDQQPSTSK                                        
fig|7227.3.peg.14476   Drosophila melanogaster (Fruit fly)                                                                                                             EEKSEAEEP−−−−−−−−−TKMETSSSEIKADV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DVEVEVEEKDKEKPAQTDTESK−−−−−−−−−−−ETPAKEEIADDK−−−−−−SKQDEPEEKKI−−−−−−−−−−−−−−EKQSREGEE−−−−−KSETDEKPTEMTTVSTEEEKQPTANCDNHQQNNNSNSKA−−−−−−−−−−−−−−−−−SNDQQPSTSK                                        
fig|7227.3.peg.14475   Drosophila melanogaster (Fruit fly)                                                                                                             EEKSEAEEP−−−−−−−−−TKMETSSSEIKADV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DVEVEVEEKDKEKPAQTDTESK−−−−−−−−−−−ETPAKEEIADDK−−−−−−SKQDEPEEKKI−−−−−−−−−−−−−−EKQSREGEE−−−−−KSETDEKPTEMTTVSTEEEKQPTANCDNHQQNNNSNSKA−−−−−−−−−−−−−−−−−SNDQQPSTSK                                        
fig|487214.5.peg.767   Streptococcus pneumoniae Hungary19A-6                                                                TNQEQARTENQVVE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEEAPKEEAP−−−−−−−−−RTEESPKEEPKSEV−−−−−−−−−−−−−−−−−−−−−−−−KPTDDTLPKVEEGKEDSAEPAPVEEVGGEV−−−−−ESKPEEKVAVKPESQPS−−−−−−DKPAEESKVEP−−−−−−−−−−PVEQAKVPEQPVQ−−−−−PTQAEQPSTP−−KESSQQENPKEDRGAEETPKQEDEQPAEAPE                                                               
fig|487214.3.peg.752   Streptococcus pneumoniae Hungary19A-6                                                                TNQEQARTENQVVE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEEAPKEEAP−−−−−−−−−RTEESPKEEPKSEV−−−−−−−−−−−−−−−−−−−−−−−−KPTDDTLPKVEEGKEDSAEPAPVEEVGGEV−−−−−ESKPEEKVAVKPESQPS−−−−−−DKPAEESKVEP−−−−−−−−−−PVEQAKVPEQPVQ−−−−−PTQAEQPSTP−−KESSQQENPKEDRGAEETPKQEDEQPAEAPE                                                               
fig|869304.3.peg.712   Streptococcus pneumoniae SPN034183                                                                TNQEQARTENQVVE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEEAPKEEAP−−−−−−−−−KTEESPKEEPKSEV−−−−−−−−−−−−−−−−−−−−−−−−KPTDDTLPKVEEGKEDSAEPSPVEEVGGEV−−−−−ESKPEEKVAVKPESQPS−−−−−−DKPAEESKVEP−−−−−−−−−−PVEQAKVPEQPVQ−−−−−PTQAEQPSTP−−KESSQQENPKEDRGAEETPKQEDEQPAEAPEIKVE−−−−−−−−−EPVESKEETVNQ                                      
fig|1159094.3.peg.328   Streptococcus pneumoniae PNI0153                                                                TNQEQARTENQVVE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEEAPKEEAP−−−−−−−−−KTEESPKEEPKSEV−−−−−−−−−−−−−−−−−−−−−−−−KPTDDTLPKVEEGKEDSAEPAPVEEVGGEV−−−−−ESKPEEKVAVKPESQPS−−−−−−DKPAEESKVEP−−−−−−−−−−PVEQAKVPEQPVQ−−−−−PTQAEQPSTP−−KESSQQENPKEDRGAEETPKQEDEQPAEAPE                                                               
fig|760884.3.peg.632   Streptococcus pneumoniae NP070                                                                TNQEQARTENQVVE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEEAPKEEAP−−−−−−−−−KTEESPKEEPKSEI−−−−−−−−−−−−−−−−−−−−−−−−KPTDDTLPKVEEGKEDSAEPAPVEEVGGEV−−−−−ESKPEEKVAVKPESQPS−−−−−−DKSAEESKVEP−−−−−−−−−−PVEQAKVPEQPVQ−−−−−PTQAEQPSTP−−KESSQEDNSKEDRGAEETPKQEDEQ                                                                     
fig|914139.3.peg.681   Streptococcus pneumoniae 2070005                                                                TNQEQARTENQVVE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEEAPKEEAP−−−−−−−−−KTEESPKEEPKSEI−−−−−−−−−−−−−−−−−−−−−−−−KPTDDTLPKVEEGKEDSAEPAPVEEVGGEV−−−−−ESKPEEKVAVKPESQPS−−−−−−DKSAEESKVEP−−−−−−−−−−PVEQAKVPEQPVQ−−−−−PTQAEQPSTP−−KESSQEDNSKEDRGAEETPKQEDEQ                                                                     
fig|406557.4.peg.1123   Streptococcus pneumoniae SP6-BS73                                                                TNQEQARTENQVVE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEEAPKEEAP−−−−−−−−−KTEESPKEEPKSEI−−−−−−−−−−−−−−−−−−−−−−−−KPTDDTLPKVEEGKEDSAEPAPVEEVGGEV−−−−−ESKPEEKVAVKPESQPS−−−−−−DKSAEESKVEP−−−−−−−−−−PVEQAKVPEQPVQ−−−−−PTQAEQPSTP−−KESSQEDNSKEDRGAEETPKQEDEQ                                                                     
fig|488221.3.peg.744   Streptococcus pneumoniae 70585                                                                TNQEQARTENQVVE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEEAPKEEAP−−−−−−−−−KTEESPKEEPKSEV−−−−−−−−−−−−−−−−−−−−−−−−KPTDDTLPKVEEGKEDSAEPAPVEEVGGEV−−−−−ESKPEEKVAVKPESQPS−−−−−−DKPAEESKVEP−−−−−−−−−−PVEQAKVPEQPVQ−−−−−PTQAEQPSTP−−KETSQQENPKEDRGAEETPKQEESTPDTKAE−−−−−−−−−−−−−ETVEPKEETKTAKGTQ                                  
fig|512566.5.peg.642   Streptococcus pneumoniae G54                                                                TNQEQARTENQVVE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEEAPKEEAP−−−−−−−−−KTEESSKEEPKSEV−−−−−−−−−−−−−−−−−−−−−−−−KPTDDTLPKVEEGKEDSAEPAPVEEVGGEV−−−−−ESKPEEKVAVKPESQPS−−−−−−DKPAEESKVEQ−−−−−−−−−−−−−−−−−AGEPVA−−−−−PREDEKAPVE−−−PEKQPEAPEEEKAVEETPKQEESTPDTKAE−−−−−−−−−−−−−ETVEPKEETKTAKGTQEEGKE                             
fig|1159210.3.peg.653   Streptococcus pneumoniae SPAR48                                                                TNQEQARTENQVVE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEEAPKEEAP−−−−−−−−−KTEESPKEEPKSEV−−−−−−−−−−−−−−−−−−−−−−−−KPTDDTLPKVEEGKEDSAEPAPVEEVGGEV−−−−−ESKPEEKVAVKPESQPS−−−−−−DKPAEESKVEQ−−−−−−−−−−−−−−−−−AGEPVA−−−−−PREDEKAPVE−−−PEKQPEAPEEEKAVEETPKQEESTPDTKAE−−−−−−−−−−−−−ETVEPKEETVNQ                                      
fig|170187.1.peg.616   Streptococcus pneumoniae TIGR4                                                                TNQEQARTENQVVE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEEAPKEEAP−−−−−−−−−KTEESPKEEPKSEV−−−−−−−−−−−−−−−−−−−−−−−−KPTDDTLPKVEEGKEDSAEPAPVEEVGGEV−−−−−ESKPEEKVAVKPESQPS−−−−−−DKPAEESKVEQ−−−−−−−−−−−−−−−−−AGEPVA−−−−−PREDEKAPVE−−−PEKQPEAPEEEKAVEETPKQEESTPDTKAE−−−−−−−−−−−−−ETVEPKEETVNQ                                      
fig|406562.5.peg.356   Streptococcus pneumoniae SP19-BS75                                                             QSTTNQEQARTENQVVE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEEA−−−−−−−−−−−−−−−−−−−−PKEEPKSEV−−−−−−−−−−−−−−−−−−−−−−−−KPTDDTLPKVEEGKEDSAEPAPVEEVGGEV−−−−−ESKSEEKVAVKPESQPS−−−−−−DKPAEESKVEQ−−−−−−−−−−−−−−−−−AGEPVA−−−−−PREDEKAPVE−−−PEKQPEAPEEEKAVEETPKQEDTQPE                                                                   
fig|1105118.3.peg.2015   Streptococcus pneumoniae GA58581                                                                TNQEQARTENQVVE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEEAPKEEAP−−−−−−−−−KTEESPKEEPKSEV−−−−−−−−−−−−−−−−−−−−−−−−KPTDDTLPKVEEGKEDSAEPAPVEEVGGEV−−−−−ESKSEEKVAVKPESQPS−−−−−−DKPAEESKVEQ−−−−−−−−−−−−−−−−−AGEPVA−−−−−PREDEKAPVE−−−PEKQPEAPEEEKAVEETPKQEDTQPE                                                                   
fig|512769.4.peg.1036   Streptococcus pneumoniae BS458                                                                TNQEQARTENQVVE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEEAPKEEAP−−−−−−−−−KTEESPKEEPKSEV−−−−−−−−−−−−−−−−−−−−−−−−KPTDDTLPKVEEGKEDSAEPAPVEEVGGEV−−−−−ESKSEEKVAVKPESQPS−−−−−−DKPAEESKVEQ−−−−−−−−−−−−−−−−−AGEPVA−−−−−PREDEKAPVE−−−PEKQPEAPEEEKAVEETPKQEDTQPE                                                                   
fig|575615.3.peg.852   Prevotella sp. oral taxon 317 str. F0108                                                         YAAQERARELKEQKA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MERENAKRTA−−−−−−−−−DSIKVAQKMEKQQS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EADKKKSDSSAPQEDVDASQ−−−−−TPQVEDTALPKEEKDGQ−−−−−−SKENPESKSKD−−−−−−−−−−−−−−DGQSTEKPV−−−−−TEEKRAEEKK−−SETKEDHESPEAKPSGENGKSEEGSDN−−−−−−−−−−−−−−−−−SDNKEKAESGIVKHVSET                                
fig|553201.3.peg.608   Rothia mucilaginosa ATCC 25296     AIYELVDIAL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AAR−−−−−−−−−−−−−−−−−−−−−−−−−−QATQPEAHQP−−−−−−−−−GEPARKAPARKKPA−−−−−−−−−−−−−−−−QKKT−−−−−−−−−−−−−−VQKELTQNEPIPQESETAAR−−−−−DISARPQKVTKASEGGE−−−−−−QKPAPKKTASK−−−−−−−−−−−−−−−KVAAKKTA−−−−−PAKKATESES−−SVKRVADSKTATQKTPAPKNAAPKTMLKK−−−−−A−−−−−−−−−PAQKTSAKKATTK−−−−−−−−−−−−−−−KVAAEKPTSAAAE−−−−AKSRA
fig|521004.3.peg.103   Haemophilus influenzae 6P18H1                                                            KVEKDEIQEAPQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MTSETSPKQAEPAPEKVSTDTKVEETQVQAQPQ−−−−−−−−−−−−−−−−−−−−−−TQSTTVVAVEATSPNSKLAAETQPSEKANAEP−−−−−VTSVSQNQPENKVSQPTE−−−−−−TEKTAKVEKEK−−−−−−−−−−−−−−TQEAPKVTS−−−−−QVSPKQEQSE−−TVQPQAVLESEKVPTVNNAEAQPQTQPSATVSTEQ−−−−−−−−−PAKETSSN                                          
fig|439375.7.peg.2527   Ochrobactrum anthropi ATCC 49188                                                                                              TALVALGLVAMPCFSGIDSDQAQAQTFIERILKQDAQKAKQHRKRPA−−−−−−−−−−−−−−−−−−−−−−−−VKRSQKKPASKQQTATQSESAPAKAETKPAPMIPVPTPAPRPENTATKGAEPETPPIPTEKPEAEPQNQP−−−−−−−−−−−−−−LAKPAPTTP−−−−−TQAAPPKPAD−−NPKPMDEKLQETKPAPDQQPKPEKDERVYQVSCPA                                                           
fig|682148.3.peg.358   Gardnerella vaginalis 5-1                                                                                                       RHDARMQKLREAQQREIEQREINKSEAKQRESQQHEVQ−−−QRDGIDSQLGSSSEQVNFGHSYAVSAPAPVQPVHPAVKPESTPTLKPTAKP−−−−−ESTSTAEQDAKQPAETKQ−−−−−−PEAKQPEENAG−−−−−−−−−−−−−−DVKPAEVKP−−−−−GENKQPAQPA−−NTQPVNTESAKPANEQNTSEQSSST−−−−−−−−−−−−−−−−−−−HAENAPALSNANA                                     
fig|525258.3.peg.1701   Clostridium difficile NAP07                                                             AYAVHSAKEKAKSSVSDFKRG−−−−−−−−−−−−−−−−−−−−−−−−−−MVQEQQSRQS−−−−−−−−−GRMEKREQHRQNIA−−−−−−−−−−−−DKRMELQKAQEARQAQRKADGSATTGATRPHERPATASTIPK−−−−−PSAEKTQEVKRPATATT−−−−−−SKTNEPVKTTV−−−−−−−−IKERPLSSGTSDRKT−−−−−SQPTQPVHRQ−−NVEKVVSQETRQNDTKDRRTKVQQTQS−−−−−−−−−−−−−−−−−VQKNQQTTEKTRN                                     
fig|626522.3.peg.1748   Prevotella tannerae ATCC 51259                                                                 KGKTDPQQDKAEPAKGK−−−−−−−−−−−−−−−−−−−−−−−−−−TEQKQDKQEP−−−−−−−−−TKDKQEADPKAEPA−−−−−−−−−−−−−−−−KQK−−−−−−−−−−−−−−−QEPTPPPPPVVPEDDDSYPD−−−−−DPPAKTEKPVKQEEEQQP−−−−−−AKEPAKQQPAK−−−−−−−−−−−−−−QQKKGTPTK−−−−−KTPAKTKPQQ−−PAKQKTTDPTQKKETKNQDKQSET−−−−−−−−−−−−−−−−−−−−PKKDTPQKENPQK                                     
fig|626522.3.peg.2611   Prevotella tannerae ATCC 51259                                                                 KGKTDPQQDKAEPAKGK−−−−−−−−−−−−−−−−−−−−−−−−−−TEQKQDKQEP−−−−−−−−−TKDKQEADPKAEPA−−−−−−−−−−−−−−−−KQK−−−−−−−−−−−−−−−QEPTPPPPPVVPEDDDSYPD−−−−−DPPAKTEKPVKQEEEQQP−−−−−−AKEPAKQQPAK−−−−−−−−−−−−−−QQKKGTPTK−−−−−KTPAKTKPQQ−−PAKQKTTDPTQKKETKNQDKQSET−−−−−−−−−−−−−−−−−−−−PKKDTPQKENPQK                                     
fig|527019.3.peg.6702   Bacillus thuringiensis IBL 200                                                             KQTTEEQKNGD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AQQPTEQQKD−−−−−−−−−GNPQKPAKQPKDGN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TQQPAEQPKNGNLQQPVEQP−−−−−KDGNTQQPAEQPKDGNT−−−−−−QQPVEQPKDGN−−−−−−−−−−−−−−−−−−−−−−−−−−−−TQQPAEQPKE−−GHPQPLAKQPKDGETQQPTENPGENPD−−−−−−−−−−−−−−−−−PSPKQIKEN                                         
fig|9606.3.peg.16560   Homo sapiens (Human)                                                                    ESKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LQGSNTQQKP−−−−−−−−−ASNQRPLTQQETPA−−−−−−−−−−−−−−−−QHDAES−−−−−−−−−−−−QKEPRAQQKSASQEEFLAPQ−−−−−KPAPQQSPYIQRVLLTQ−−−−−−QEAASQQGPGLGKE−−−−−−−−−SITQQEPALRQ−−−−−RHVAQPGPGP−−GEPPPAQQEAESTPAAQAKPGAKREPS−−−−−−−A−−−−−−−−−PTESTSQETPEQSD                                    
fig|679196.3.peg.2152   Lactobacillus gasseri 224-1                                                                  EPTKPEEPTTPDKPAQ−−−−−−−−−−−−−−−−−−−−−−−−−−PSEPTKPEEP−−−−−−−−−ITPDKPAQPSEPTK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PEEPTTPDKPARPTEPTKPE−−−−−EPTTPDKPAQPSEPIKP−−−−−−EEPTTPDKPAQ−−−−−−−−−−−−−−PSEPTEPKE−−−−−PTTPDKPTQP−−SEPTKPEEQTISNKSNQSSETESSKTA−−−−−−−−−−−−−−−−−MQINKSNKSKNVEATN                                  
fig|324831.10.peg.1514   Lactobacillus gasseri ATCC 33323                                                                  EPTKPEEPTTPDKPAQ−−−−−−−−−−−−−−−−−−−−−−−−−−PSEPTKPEEP−−−−−−−−−ITPDKPAQPSEPTK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PEEPTTPDKPARPTEPTKPE−−−−−EPTTPDKPAQPSEPIKP−−−−−−EEPTTPDKPAQ−−−−−−−−−−−−−−PSEPTEPKE−−−−−PTTPDKPTQP−−SEPTKPEEQTISNKSNQSSETESSKTA−−−−−−−−−−−−−−−−−MQINKSNKSKNVEATN                                  
fig|575603.3.peg.1595   Lactobacillus gasseri SJ-9E-US                                                                  EPTKPEEPTTPDKPAQ−−−−−−−−−−−−−−−−−−−−−−−−−−PSEPTKPEEP−−−−−−−−−ITPDKPAQPSEPTK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PEEPTTPDKPARPTEPTKPE−−−−−EPTTPDKPAQPSEPIKP−−−−−−EEPTTPDKPAQ−−−−−−−−−−−−−−PSEPTEPKE−−−−−PTTPDKPTQP−−SEPTKPEEQTISNKSNQSSETESSKTA−−−−−−−−−−−−−−−−−MQINKSNKSKNVEATN                                  
fig|644042.3.peg.2462   Lactobacillus plantarum JDM1                                                                KKSAIK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PEEPGQPEQP−−−−−−−−−SQPEKPGHPEQPSQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PEEPGHPEQPSQPEEPGHPE−−−−−QPSQPEEPGQHEQPSQP−−−−−−EEPGQSEKPGE−−−−−−−−−−−−−−LQKPSQPAD−−−−−SEQPDGLSDQ−−ANLSR−−NQAEQSRTSQPSQAESDQSV−−−−−−−−−−−−−−−−−VQTNQQKTA                                         
fig|525338.3.peg.2776   Lactobacillus plantarum subsp. plantarum ATCC 14917                                                                KKSAIKPEEPGQPEQPSQ−−−−−−−−−−−−−−−−−−−−−−−−−−PEEPGQPEQP−−−−−−−−−SQPEEPGQPEQPSQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PEEPGQPEQPSQPEEPGHPE−−−−−QPSQPEEPGQPEQPSQP−−−−−−EEPGQSEKPGE−−−−−−−−−−−−−−LQKPSQPAD−−−−−SEQPDGLSDQ−−ANLSR−−NQAEQSRTSQPSQAESDQSV−−−−−−−−−−−−−−−−−VQTNQQKTA                                         
fig|220668.9.peg.2555   Lactobacillus plantarum WCFS1                                                                KKSAIK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PEEPGQPEQP−−−−−−−−−SQPEEPGQPEQPSQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PEEPGQPEQPSQPEEPGHPE−−−−−QPSQPEEPGQPEQPSQP−−−−−−EEPGQSEKPGE−−−−−−−−−−−−−−LQKPSQPAD−−−−−SEQPDGLSDQ−−ANLSR−−NQAEQSRTSQPSQAESDQSV−−−−−−−−−−−−−−−−−VQTNQQKTA                                         
fig|220668.1.peg.2503   Lactobacillus plantarum WCFS1                                                                KKSAIK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PEEPGQPEQP−−−−−−−−−SQPEEPGQPEQPSQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PEEPGQPEQPSQPEEPGHPE−−−−−QPSQPEEPGQPEQPSQP−−−−−−EEPGQSEKPGE−−−−−−−−−−−−−−LQKPSQPAD−−−−−SEQPDGLSDQ−−ANLSR−−NQAEQSRTSQPSQAESDQSV−−−−−−−−−−−−−−−−−VQTNQQKTA                                         
fig|160490.1.peg.1553   Streptococcus pyogenes M1 GAS                                                                 NSTSSTDQPTTADTDTD−−−−−−−−−−−−−−−−−−−−−−−−−−DESETPKKDK−−−−−−−−−KSKETASQHDTQKD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HKPSHTHPTPPSNDTKQTD−−−−−QASSEATDKPNKDKNDTK−−−−−−QPDSSDQSTPS−−−−−−−−−−−−−−PKDQSSQKE−−−−−SQNKDGRPTP−−SPDQQKDQTPDKTPEKSADKTPEK−−−−−−−−−−−−−−−−−−−−GPEKATDKTPEPN                                     
fig|471876.6.peg.1729   Streptococcus pyogenes NZ131                                                                 NSTSSTDQPTTADTDTD−−−−−−−−−−−−−−−−−−−−−−−−−−DESETPKKDK−−−−−−−−−KSKETASQHDTQKD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HKPSHTHPTPPSNDTKQTD−−−−−QALSEATDKPNKDKNNTN−−−−−−QPDSSDQSTPS−−−−−−−−−−−−−−PKDQSSQKE−−−−−SQNKDGRSTS−−SPDQQKDQTPDKTPEKSADKTPEK                                                                      
fig|198466.1.peg.1731   Streptococcus pyogenes MGAS315                                                                 NSTSSTDQPTTADTDTD−−−−−−−−−−−−−−−−−−−−−−−−−−DESETAKKDK−−−−−−−−−KSKETASQHDTQKD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HKPSHNHPTPPSNDTKQTD−−−−−QASSEATDKPNKDKNDTK−−−−−−QPNSSDQSTPS−−−−−−−−−−−−−−PKDQSSQKE−−−−−SQNKDGRPTP−−SPDQQKDQTPDKTPEKSADKTPEK−−−−−−−−−−−−−−−−−−−−GPEKATEKTPEPN                                     
fig|160491.19.peg.1769   Streptococcus pyogenes str. Manfredo                                                                 NSTSSTDQPTTADTDTD−−−−−−−−−−−−−−−−−−−−−−−−−−DESETPKKDK−−−−−−−−−KSKETASQHDTQKD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HKPSHNHPTPPSNDTKQTD−−−−−QASSEATDKPNKDKNNTN−−−−−−QPNSSDQSTPS−−−−−−−−−−−−−−PKDQSSQKE−−−−−SQNKDGRPTP−−SPDQQKDQTPDKTPEKSADKTPEK−−−−−−−−−−−−−−−−−−−−GPEKATEKTPEPN                                     
fig|370552.4.peg.1821   Streptococcus pyogenes MGAS10270                                                                 NSTSSTDQPTTADTDTD−−−−−−−−−−−−−−−−−−−−−−−−−−DESETAKKDK−−−−−−−−−KSKETASQHDTQKD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HKPSHTHPTPSSNDTKQTD−−−−−QASSEATDKPNKDKNDTK−−−−−−QPDSSDQSTPS−−−−−−−−−−−−−−PKDQSSQKE−−−−−SQNKDGRPTP−−SPDQQKDQTPDKTPEKSADKTPEK−−−−−−−−−−−−−−−−−−−−GPEKSAKKTPEPN                                     
fig|486410.3.peg.905   Streptococcus dysgalactiae subsp. equisimilis GGS_124                                                                RNNTSSTDQPTTADTATD−−−−−−−−−−−−−−−−−−−−−−−−−−DESETAKKDK−−−−−−−−−KTKETASQYDTQKD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HKPSHDHLPPSLNDTEQTD−−−−−QASSEATDKPNKDKNNTN−−−−−−QPDSSDQSTPS−−−−−−−−−−−−−−PKDQSSQKE−−−−−SQNKDGRPTP−−SPDQQKDQTPDKTPEKSAEKTPEK−−−−−−−−−−−−−−−−−−−−GPEKSAEKTPEPN                                     
fig|319701.6.peg.1757   Streptococcus pyogenes MGAS6180                                                                                                             ESETAKKDK−−−−−−−−−KSKETASQHETQKD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HKSSHTHLTPPSNDTKQTD−−−−−QASSEATDKPNKDKNDTK−−−−−−QPDSSDQSTPS−−−−−−−−−−−−−−PKDQSSQKE−−−−−SQNKDGRPTP−−SPDQQKDQTPDKTPEKSADKTPEK−−−−−−−−−−−−−−−−−−−−GPEKATDKTPEPN                                     
fig|1213458.3.peg.1651   Streptococcus pyogenes BJCYGAS15                                                                                                             ESETAKKDK−−−−−−−−−KSKETASQHDTQKD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HKSSHTHPTPPSNDTKQTD−−−−−QASSEATDKPNKDKNVTK−−−−−−QPDSSDQSTPS−−−−−−−−−−−−−−PKDQSSQKE−−−−−SQNKDGRPTP−−SPDQQKDQTPDKTPEKSADKTPEK−−−−−−−−−−−−−−−−−−−−GPEKATEKTPEPN                                     
fig|370554.4.peg.1862   Streptococcus pyogenes MGAS10750                                                                RNNTSSTDQPTTADNDTD−−−−−−−−−−−−−−−−−−−−−−−−−−DESETPQKDK−−−−−−−−−KSKETASQHDTQKD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HKSSHTHPTPPSNDTKQTD−−−−−QASSEATDKPNKDKNNTK−−−−−−QPNSSDQSTPS−−−−−−−−−−−−−−PKDQSSQKE−−−−−SQNKDGRPTP−−SPDQQKDQTPDKTPEKSADKAPEK−−−−−−−−−−−−−−−−−−−−GPEKAVEKTPEPN                                     
fig|4896.1.peg.4721   Schizosaccharomyces pombe                                                            HTGQANFPTDQEDPR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NPQLDSQYEAFITQGESQTDKKKTSTVQEEELQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NAGKKLETVQENPQAYSKVTQ−−−−−−−−−−−QEPQAGQKAVPQ−−−−−−EPQANQQETSS−−−−−−−−−−−−−−NQEESSFDR−−−−−QETQDDKQKP−−KTTQQEHYNLRNRNQATITNSNSKPQTR                                                                  
fig|60480.16.peg.3624   Shewanella sp. MR-4                                                    HSSGSGQHFTSQYAKSREHQDARYNRDNKG−−−−−−−−−−−−−−−−−−−−−−−−−−YDKRQDKDRGNNLSRDNHYSRERTPSFQNTQAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKERRVAPTNSAQTKREGYQ−−−−−KERNDNFRQDNQVRQAQ−−−−−−AKATREQTKDS−−−−−−−−−−−−−−PQRQYQTRE−−−−−QQPRSFEPRT−−QPQRQEARPEVRRAEPQRMEQPRQAPPRQR−−−−−−−−−−−−−−EENRVRQNDSRQN                                     
fig|60481.10.peg.3663   Shewanella sp. MR-7                                                    HSSGSGQHFTSQYAKSREHQDARNNRDNKG−−−−−−−−−−−−−−−−−−−−−−−−−−YDKRQDKDRGNNLSRDNHYSRERTPSFQNTQAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKERRVAPTNSAQTKREGYQ−−−−−KERNDNFRQDNQVRQAQ−−−−−−AKATREQTKDS−−−−−−−−−−−−−−PQRQYQTRE−−−−−QQPRSFEPRT−−QPQRQEARPEVRRAEPQRMEQPRQAPPRQR−−−−−−−−−−−−−−EENRVRQNDSRQN                                     
fig|66692.6.peg.3304   Bacillus clausii KSM-K16                                                          VPHSDEANDQTVEEDDHVADENEQ−−−−−−−−−−−−−−−−−−−−−−−−−−ASETTDTENDAENEESNLPASEEAPSEENDSTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ESSLEEPQEPETDPSTDEQEPE−−−−−TDASADEQEPETDANTDE−−−−−−QEPETDASTDE−−−−−−−−−−−−−−−−−−QEPET−−−−−DASADEQEPK−−TDASTDEQEPETDASTDEQEPETDASADE−−−−−−−−−−−−−−−QEPETDANTDEQE                                     
fig|655813.3.peg.1404   Streptococcus oralis ATCC 35037                                                                       TEKKMIYGIRSLKNGTGSVLIGASIILLSAAMPTISANENLPQTQENTSAVTKAPTETETSQTQKETPIS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EQKNANASLDSKKEAPAG−−−−−ETTTAPETPKTEDATTSQ−−−−−−ANSKEEKVDNS−−−−−−−−−−−−−−−−−−−−−−T−−−−−ATPTSEQKPQ−−ADTSSEEPIADNHFRIHVKKLPEENKDSQGLWTWDDVEKPSENWPNGAKSFKDAKQDDYGYYLDVKLKNEQA                      
fig|698737.3.peg.464   Staphylococcus lugdunensis HKU09-01                                                                               NRHNNYSIRKFTIGTASILVGTTLIFGLSNEAHAQSNSS−−−−−−−−−AKVSDKVATEQSAS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSQEADSSQQTAASNAQNVQ−−−−−−−−−−−TAPEQDKATPTT−−−−−−EVNSNNNQTDS−−−−−−−−−−−−−−KHVAPQKEQ−−−−−NQTATQTESK−−KETAQTQAKTEEKAASDSKKASEDSDDKA−−−−−−−−−−−−−−−TSKETDENKTDDS                                     
fig|596319.3.peg.1514   Staphylococcus warneri L37603                                                             SQQNEQQSSKEDNKKMPKSTQ−−−−−−−−−−−−−−−−−−−−−−−−−−AEQVEKQEQP−−−−−−−−−ASNQTPNHSSKEPS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−INNQQSHNKQQPSDDKIPNT−−−−−EPEKIEKVDNHKRIQDQ−−−−−−YQDKNKKVDNK−−−−−−−−−−−−−−−−−−QSNNS−−−−−QLNQKENPDS−−SNNKQQKQRLDVKPQNDNQQLQSRNDVKEKLDNQ−−−−−−−−−−PIEQTDTKQQSNN                                     
fig|565653.4.peg.1032   Enterococcus gallinarum EG2                                                       AKPTPANQKPANQPEKQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKKFKTQRNNPNFQNRHNNQGQRNTT−−NSRPN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GQGQPNRPTSQNNGSTNQGSNRPNNQGSQNRVNNQENRNNQ−−−−−−GQQNRPTNQNR−−−−−−−−−−−TQGQQNRPSGQG−−−−−QQNRPNQGNQ−−SQNRPAQGQQSRPNQGASSQGTQSR−−−−−−−−−−−−−−−−−−PAGDNQNRGGNQ                                      
fig|565654.4.peg.229   Enterococcus casseliflavus EC10                                                        NSNPANQKPANQPEKQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKKFKTQRNNPNFQNRHNNQSQQRTTQSNNRPA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GQGQVERTNS−−−−−−−QGSNRPNNQGSHNRVNNQENRNNQ−−−−−−GQQNRPTNQGQ−−−−−−QNRPNNQGQQNRPNNQG−−−−−QQNRPNNQGQ−−−QNRPNNQGQQNRPN−−−−NQGQQNRPNNQGQQNRPNNQGQQNRPNNQGQQNRPNNQ                                     
fig|565655.4.peg.412   Enterococcus casseliflavus EC20                                                        NSNPANQKPANQPEKQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKKFKTQRNNPNFQNRHNNQSQQRTTQSNNRPA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GQGQVERTNS−−−−−−−QGSNRPNNQGSHNRVNNQENRNNQ−−−−−−GQQIRPTNQGQ−−−−−−QNRPNNQGQQNRPNNQG−−−−−QQNRPNNQGQ−−−QNRPNNQGQQNRPN−−−−NQGQQNRPNNQGQQNRPNNQGQQNRPNNQGQQNRPNNQ                                     
fig|979221.3.peg.485   Staphylococcus epidermidis NIH05001                                                                    NKKNSYSIRKLSVGASSIIVASMLFIGGGSVHAAESNHLENQEQSEVSASHSIEMQHKNQETQQTENKDNKTNHSETIDKTPTIHNNGYSYHETPSTDVKSNEDKQIDSQSNQPQTSMPNNDQQNPK−−−−−KVAEHTTKSINAKKEET−−−−−−RKNENAKSLVQ−−−−−−−−−−−−−−PQQDDKTTS−−−−−EQTKMKESRE−−QEITNEQKQLQSKDVKNAQQENQNIDQ−−−−−−−−−−−−−−−−−EKSQEKIKVQQSN                                     
fig|176279.3.peg.1940   Staphylococcus epidermidis RP62A                                                                    NKKNSYSIRKLSVGASSIIVASMLFIGGGSVHAAESNHLENQEQSEVSVSHSIEMQHKNQETQQPENKDNKTNHSETIDKTPTIHNNGYSYHETPSTDVKSNEDKQIDSQSNQPQTSMPNNDQQNPK−−−−−KVAEHTTKSINAKKEET−−−−−−RKNENAKSLVQ−−−−−−−−−−−−−−PQQDDKTTS−−−−−EQTKIKESRE−−QEITNEQKQLQSKDIKNAQQENQNIDQ−−−−−−−−−−−−−−−−−EKSQEKIKVQQSN                                     
fig|406562.5.peg.2161   Streptococcus pneumoniae SP19-BS75                                                            ESNQPENNDSKNE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NSEKTREEVPVNPNEGTVEGTSNQETENPVQPA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EESTTNSEKVSPDTSSENTG−−−−−EVSNK−−PSDSKPPVEES−−−−−−NQPEKNGTATK−−−−−−−−−−−−−−PENSGNTTS−−−−−ENGQTEPEPS−−NGNSTEDVSTKSNTSNSNGNEEIKQEN−−−−−−−−−−−−−−−−−ELDPDKKVEDPEK                                     
fig|314280.5.peg.27   Photobacterium profundum 3TCK                                                             SDKNNADKNKSEQKDQQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SDSKQDKSDD−−−−−−−−−SNNQQSPSEQSDSQ−−−−−−−−−−−−−−−−QDNDQK−−−−−−−−−−−−QESSDQQKNGQPNKDQQNAD−−−−−QEKQQKGKDQQSSADGE−−−−−−KNDPQQNQPQD−−−−−−−−−−−−−−SQQQNEKQS−−−−−DQDASANNSP−−SQNQQANETDSNEPSDEDKIAQQQA−−−−−−−−−−−−−−−−−−−SPQDNKKNDADKK                                     
fig|458233.11.peg.618   Macrococcus caseolyticus JCSC5402                                                            SDEQKSDGNSKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EDPKEDKSDT−−−−−−−−−TEEPKSTEEDTTEE−−−−−−−−−−−−−−−−PKTDDK−−−−−−−−−−−−KSSEDSKEADADQLKNPSEE−−−−−QKSDKDSIKEQPKADDK−−−−−−NSSKEDAKTDE−−−−−−−−−−−−−NSTNEDSNEN−−−−−KKDTTEKPKS−−TEEDTIEEPSTEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PLNNNNQSDNVGN                                     
fig|338966.9.peg.89   Pelobacter propionicus DSM 2379                                                                                                            KEGTAESKEMAIALCKLLEDEAKKKEQEQQDPT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SQDNQQDDSQGSPEDKQNKE−−−−−DDNPEKQNQDEEQSGSN−−−−−−DKSSESNNNNG−−−−−−−−−−−−−−DQDENNPSG−−−−−DQSSDNRDNP−−SQDNHTDQGGQDEDSEQNGSGKNPS−−−−−−−−−−−−−−−−−−−KSDTDDEEGDGND                                     
fig|431895.3.peg.2915   Monosiga brevicollis MX1                                                                                                             KQTEKQAETLAKKQAETLAKKQAETLAETQAE−−−−−−−−−−−−−−−−KQAEKQARRKAKKQAKAVAKAAQASGKGIPAEARTDNK−−−−−VDAEAEKDADAIASAKPT−−−−−−HKSRGSTQGTA−−−−−TRDVDSLPTEAQSKTKAQ−−−−−PEEQGSLQVE−−ITAQISDHREINAESKKNPKAESQAAD−−−−−−−−−−−−−−−−−SQREAQSNETAQN                                     
fig|626369.3.peg.434   Granulicatella elegans ATCC 700633                                                                                                            KEAAQPKKET−−−−−−−−−AKKEAVKKAEHKSA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HSPKQQEKNHQPNQNQNKHG−−−−−HKKESMQKQETVANKGPK−−−−−−HQSRDEESYSN−−−−−−−−−−−−−−HRESKKNND−−−−−FKRGNQKRGG−−ERNQQENFNKKNRHQKNNRKQQKNAEQKPAVP                                                              
fig|383407.3.peg.3507   Xanthomonas oryzae pv. oryzicola BLS256                                                                                                   DAAIDAYDRALKQHPNQQDAIANRAAVDAARKRQQQKNK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DGKGQTKDQKQSVQDGKGQ−−−−−QQSGQDQHNPQAGQDGQ−−−−−−NQQDGKNQPSD−−−−−−−−−−−−−−−AQTPQDGT−−−−−SQDAQSKNAE−−DAQRKQDTPPQSADAKAQQQADEAQRRKMQQAMAQ−−−−−−−−−AGDKQADASGKQQ                                     
fig|427081.3.peg.3392   Xanthomonas fuscans subsp. aurantifolii str. ICPB 11122                                                                                                   DAAIAAYDRVLKQHPNQQDAIANRAAVDAARKRQQQNNKDGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GQDGKGQSKDQKPSGQDGKGQ−−−−−QQAGQNQQAKPSGQDGQ−−−−−−NQQGSENQPSD−−−−−−−−−−−−−−−AQPPQDGK−−−−−SQDAQSKNGQ−−GEQRKQDTPPQSADAKAQQQADEAQRRKMQQAMAQ−−−−−−−−−AGDKQADAS                                         
fig|269801.5.peg.1160   Bacillus cereus G9241                                                                 MSNIRQKYRDVRRGSKTVGRGVAVAGAVGLASAAVAGKVGKSGYSKFKQLKENYADRKEKVADGKRKEKEQMQAEK−−−−−−−−−−−−−−−−EKNINQMKKEENLGVRDRKGNQEQERVKEEVAATKENP−−−−−ELAVRGQHQDNTPEMQQ−−−−−−AELKDKEEDVK−−−−−−−−−−−−−−ADVQPVAQS−−−−−NGELNNKED−−VKAQVRPVANQNSSGLENKQENVKAEAKPGATIKT−−−−−−−−−PTGQTKPVTTPLQSN                                   
fig|288681.12.peg.5696   Bacillus cereus E33L                                                                 MSNIRQKYRDVRRGSKTVGRGVAVAGAAGLASATVAGKVGKSGYSKFKQLKENYADRKEKVADGKRKEKEQMQAEK−−−−−−−−−−−−−−−−EKNINQMKKEENLGVRDRKGNQEQERVKEEVAATKENP−−−−−ELAVRGNHQDNDPEIPQ−−−−−−AELKDKEEDVK−−−−−−−−−−−−−−ADVKPVAPL−−−−−NEELGNKEED−−VKTQIKPAAPQNNGGLENKQEDIKAEVKPVAAIKT−−−−−−−−−PTGQTKSTDDK                                       
fig|526984.3.peg.5959   Bacillus cereus Rock3-29                                                                                                       VGKSGYSKFKQLKENYADRKEKVADGKRKEKEQMQAEK−−−−−−−−−−−−−−−−EKNINQMKKEENLGVRDRKGNQEQERVKEEVAATKENP−−−−−ELAVRGKHEDNNPEMQQ−−−−−−AELKGKEEDVK−−−−−−−−−−−−−−ADVK−−−−−−−−−−−−−−−−−−−−−−−−−−−−PVASQNNGGLENKQGDVKAEAKPGATIKT−−−−−−−−−PNGQTKPVTTPQSGTTPLQSNPMESKPITTPQSGTTPLQSN         
fig|714359.3.peg.5539   Bacillus thuringiensis BMB171                                                                 MSNIRQKYRDVKRGSKTVGRGVA−−−−−−−TGAAVASNAGKSGYSKFKQMKANYANRKEKVGEGKRKEKEQMQAEK−−−−−−−−−−−−−−−−EKNINQMKKEENLGVRDRKGNQEQERVKEEVAATKENP−−−−−ELAVRGNHEGNDSEMQQ−−−−−−AELKGKEEDVK−−−−−−−−−−−−−−ADVKPVAQS−−−−−NEELNSKEED−−VKAQVRPVASQNNGGLENKKEDVKAEAKPAATIKT−−−−−−−−−PTGQTKPVTTPQSGPTPSPANPVESKQITTPQSGPTPSPANPVESKQITT
fig|203124.6.peg.481   Trichodesmium erythraeum IMS101                                                                                                            QKRENSQLQD−−−−−−−−−NNSSETQKETELQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKSPLQPDSTADSSSNKDNQASVVTQTKSSNSKEENQTSVVTQ−−−−−−QELVEPSDNIK−−−−−−−−−−−−−−IDQVEKTQS−−−−−SIEENNKPSL−−NTNQEVQTVSQEPVSIEENNQPSLSTN−−−−−−−−−−−−−−−−−QKVQTVEKNNQPSLNTNQ                                
fig|203124.1.peg.2439   Trichodesmium erythraeum IMS101                                                                                                            QKRENSQLQD−−−−−−−−−NNSSETQKETELQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKSPLQPDSTADSSSNKDNQASVVTQTKSSNSKEENQTSVVTQ−−−−−−QELVEPSDNIK−−−−−−−−−−−−−−IDQVEKTQS−−−−−SIEENNKPSL−−NTNQEVQTVSQEPVSIEENNQPSLSTN−−−−−−−−−−−−−−−−−QKVQTVEKNNQPSLNTNQ                                
fig|314230.3.peg.3111   Blastopirellula marina DSM 3645               GAGAVLIAVVLIFTALLPRPHAEYEVARIPGVGDLLNRASSSFAVGKEGTQDDDQKG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QTESNDRQQA−−−−−−−−−GAKQSQSGDGEKGA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KSQDQKKSGDGEKSSSSGKK−−−−−SDQGKGKSSDDQQQQNQS−−−−−−GEQQSDSSDKS−−−−−−−−−−−PANDSQQKSDQN−−−−−KSPPDSQSKS−−DKSNGEMGKDVSSEAKSNDEQKS−−−−−−−−−−−−−−−−−−−−−PDDDSPSPKEKSD                                     
fig|525258.3.peg.1235   Clostridium difficile NAP07                                                                             RKGNKKALLISLIMILSMVMSTIYPTVSYALELGENSQIQS−−−−−−−−−GSTNSSTGEEKESD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKKPEQTPEEEKQTDNKKPE−−−−−QMPEKEKPTDNKNPEQT−−−−−−PEKEKPTDNKN−−−−−−−−−−−−−−PEQTPVGEKPIDSKNPEHTQEDKS−−TDNKKSEQSLEDEKTLDNKNPEK                                                                       
fig|527024.3.peg.509   Bacillus thuringiensis serovar tochigiensis BGSC 4Y1                                                             NETDNSEQQPN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NQEDDNKKQTRSMKHNKDSNGEQKKEEHKEASR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKQQNKSNQNQQQSAKQD−−−−−ESSQEQQQHSKQDNSEQN−−−−−−QQQHSKQDNSE−−−−−−−−−−−−−−QDQQQHSKQ−−−−−NNSDQGQQQH−−SKQDISEQDQQQHSKQDNSEQDQQQHSK−−−−−−−−−−−−−−−−−−QDNSEQDQQQHSKQNNSDQ                             
fig|405534.9.peg.5048   Bacillus cereus AH187                                                             NETDNSEQKPN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NQEDDNKEQTRSTKHNKGNNSEQKKEEHKESSQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DNQQNQSNQNQQQSAKQD−−−−−ESSQEQQKHSKQNNSDQG−−−−−−QQQHSKQDDSN−−−−−−−−−−−−−−QEQQKHSKQ−−−−−NDSDQGQQQH−−SKQDDSNQGQQKHSKQNDSDQGQQQHSK−−−−−−−−−−−−−−−−−−QDNSNQDKQQNSKGNS                                
fig|451708.10.peg.4444   Bacillus cereus H3081.97                                                             NETDNSEQKPN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NQEDDNKEQTRSTKHNKGNNSEQKKEEHKESSQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DNQQNQSNQNQQQSAKQD−−−−−ESSQEQQKHSKQNNSDQG−−−−−−QQQHSKQDDSN−−−−−−−−−−−−−−QEQQKHSKQ−−−−−NDSDQGQQQH−−SKQDDSNQGQQKHSKQNDSDQGQQQHSK−−−−−−−−−−−−−−−−−−QDNSNQDKQQNSKGNS                                
fig|526973.3.peg.592   Bacillus cereus m1293                                                             NETDNSEQKPN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NQEDDNKEQTRSTKHNKGNNSEQKKEEHKESSQ