(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020298

fig|1028799.3.peg.153   Staphylococcus aureus subsp. aureus VC40                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|1112349.3.peg.1089   Staphylococcus aureus subsp. aureus NN50                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|93061.3.peg.183   Staphylococcus aureus subsp. aureus NCTC 8325                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|1158539.3.peg.151   Staphylococcus aureus M0633                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|1305598.3.peg.208   Staphylococcus aureus M1                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|367830.3.peg.1664   Staphylococcus aureus subsp. aureus USA300                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|426430.6.peg.147   Staphylococcus aureus subsp. aureus str. Newman                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|455227.3.peg.219   Staphylococcus aureus D30                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|553590.4.peg.1208   Staphylococcus aureus A9754                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|553594.3.peg.867   Staphylococcus aureus A9765                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|904753.3.peg.2111   Staphylococcus aureus subsp. aureus 21282                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|904754.3.peg.2102   Staphylococcus aureus subsp. aureus 21283                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|904778.3.peg.144   Staphylococcus aureus subsp. aureus IS-88                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|93062.19.peg.188   Staphylococcus aureus subsp. aureus COL                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|93062.4.peg.655   Staphylococcus aureus subsp. aureus COL                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|931433.3.peg.763   Staphylococcus aureus subsp. aureus CIG1114                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|931442.3.peg.806   Staphylococcus aureus subsp. aureus CIG547                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDKKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|1158485.3.peg.306   Staphylococcus aureus M1311                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQNGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPQNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|1213730.3.peg.320   Staphylococcus aureus M0877                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQNGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPQNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|553583.3.peg.1841   Staphylococcus aureus A9635                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQNGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPQNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|904730.3.peg.1513   Staphylococcus aureus subsp. aureus 21200                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQNGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPQNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|931454.3.peg.710   Staphylococcus aureus subsp. aureus CIG1524                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQNGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPQNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|548474.3.peg.2278   Staphylococcus aureus subsp. aureus TCH130                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESITYN         
fig|1231383.3.peg.1390   Staphylococcus aureus KT/314250                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|196620.1.peg.186   Staphylococcus aureus subsp. aureus MW2                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|282459.1.peg.175   Staphylococcus aureus subsp. aureus MSSA476                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|282459.5.peg.197   Staphylococcus aureus subsp. aureus MSSA476                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|450394.6.peg.1961   Staphylococcus aureus subsp. aureus USA300_TCH959                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|762962.3.peg.1615   Staphylococcus aureus subsp. aureus ATCC 51811                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|931441.3.peg.426   Staphylococcus aureus subsp. aureus CIG1835                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|931459.3.peg.711   Staphylococcus aureus subsp. aureus CIGC128                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKDQIIYKESLTYN         
fig|158878.1.peg.210   Staphylococcus aureus subsp. aureus Mu50                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN         
fig|158878.14.peg.212   Staphylococcus aureus subsp. aureus Mu50                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN         
fig|1116224.3.peg.219   Staphylococcus aureus subsp. aureus VRS11a                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN         
fig|1157030.3.peg.151   Staphylococcus aureus M0450                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN         
fig|1158480.3.peg.1034   Staphylococcus aureus M1253                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN         
fig|1158486.3.peg.2421   Staphylococcus aureus M1320                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN         
fig|1158685.3.peg.976   Staphylococcus aureus M0539                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN         
fig|1158687.3.peg.156   Staphylococcus aureus M0565                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN         
fig|1169274.3.peg.158   Staphylococcus aureus M1309                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN         
fig|359786.3.peg.1086   Staphylococcus aureus subsp. aureus JH9                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN         
fig|505321.3.peg.918   Staphylococcus aureus subsp. aureus str. CF-Marseille                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN         
fig|553565.3.peg.2530   Staphylococcus aureus A5937                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN         
fig|553571.3.peg.2114   Staphylococcus aureus A6300                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN         
fig|553581.3.peg.2139   Staphylococcus aureus A9299                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN         
fig|553588.3.peg.1524   Staphylococcus aureus A9719                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN         
fig|553596.3.peg.847   Staphylococcus aureus A9781                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN         
fig|681288.4.peg.182   Staphylococcus aureus subsp. aureus ED98                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN         
fig|703339.3.peg.214   Staphylococcus aureus 04-02981                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN         
fig|889933.4.peg.169   Staphylococcus aureus subsp. aureus ECT-R 2                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN         
fig|904731.3.peg.1776   Staphylococcus aureus subsp. aureus 21201                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN         
fig|904750.3.peg.860   Staphylococcus aureus subsp. aureus 21272                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN         
fig|904783.3.peg.1783   Staphylococcus aureus subsp. aureus IS-122                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN         
fig|931446.3.peg.744   Staphylococcus aureus subsp. aureus CIG1213                                                     KWEQIHLKDGLKKVLSTYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTT−−−−−−−−−−−NDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGKNQIIYKESLTYN         
fig|525378.3.peg.1283   Staphylococcus epidermidis M23864:W1                                                      KKERQLVKDLDKTIFNVYPIKNLEDFYNIEGYKDENFDKQDKGTWYLNSAMNIQRKGEDLKSEGMLLKINRNTKTAKGYYYISSYF−−−−−−−−−TDKRGSQDSSEKRYPVKMVNNKFIITKPVHDNKVKNKIKNFKFFVQYGDFKDLKTNQYSKLGYNPNVPSYTLEYNLNNEENNVKKLREIYNIPTNKKPKLLIEGQSSLDHARVGYKSIEFSFIKRTDETISFTDNVNLQPS       
fig|359786.3.peg.859   Staphylococcus aureus subsp. aureus JH9      MEYIKKIALYMSVLLLIIFIGGCGNMKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|158878.1.peg.445   Staphylococcus aureus subsp. aureus Mu50     MMEYIKKIALYMSVLLLIIFIGGCGNMKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|158878.14.peg.450   Staphylococcus aureus subsp. aureus Mu50     MMEYIKKIALYMSVLLLIIFIGGCGNMKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|450394.6.peg.2225   Staphylococcus aureus subsp. aureus USA300_TCH959     MMEYIKKIALYMSVLLLIIFIGGCGNMKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|553565.3.peg.2745   Staphylococcus aureus A5937     MMEYIKKIALYMSVLLLIIFIGGCGNMKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|553588.3.peg.1739   Staphylococcus aureus A9719     MMEYIKKIALYMSVLLLIIFIGGCGNMKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|553592.3.peg.1773   Staphylococcus aureus A9763     MMEYIKKIALYMSVLLLIIFIGGCGNMKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|553596.3.peg.2358   Staphylococcus aureus A9781     MMEYIKKIALYMSVLLLIIFIGGCGNMKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|681288.4.peg.397   Staphylococcus aureus subsp. aureus ED98     MMEYIKKIALYMSVLLLIIFIGGCGNMKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|703339.3.peg.427   Staphylococcus aureus 04-02981     MMEYIKKIALYMSVLLLIIFIGGCGNMKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|505321.3.peg.509   Staphylococcus aureus subsp. aureus str. CF-Marseille     MMEYIKKIALYMSVLLLIIFIGGCGNMKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKSYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|553581.3.peg.1268   Staphylococcus aureus A9299     MMEYIKKIALYMSVLLLIIFIGGCGNMKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQQAKVDEDE 
fig|1116224.3.peg.429   Staphylococcus aureus subsp. aureus VRS11a                               MKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|1157030.3.peg.356   Staphylococcus aureus M0450                               MKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|1158480.3.peg.1244   Staphylococcus aureus M1253                               MKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|1158486.3.peg.2631   Staphylococcus aureus M1320                               MKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|1158685.3.peg.1199   Staphylococcus aureus M0539                               MKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|1158687.3.peg.365   Staphylococcus aureus M0565                               MKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|1169274.3.peg.368   Staphylococcus aureus M1309                               MKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|548474.3.peg.1831   Staphylococcus aureus subsp. aureus TCH130                               MKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|553571.3.peg.643   Staphylococcus aureus A6300                               MKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|889933.4.peg.378   Staphylococcus aureus subsp. aureus ECT-R 2                               MKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|904731.3.peg.1567   Staphylococcus aureus subsp. aureus 21201                               MKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|904750.3.peg.1070   Staphylococcus aureus subsp. aureus 21272                               MKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|904783.3.peg.343   Staphylococcus aureus subsp. aureus IS-122                               MKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|931446.3.peg.968   Staphylococcus aureus subsp. aureus CIG1213                               MKEEQKKEANTNKT−−−−−−−−DSKEEKIKKSFAKTLDMYPIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFY−−−−−−−−−−−RKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKRENSHLSVIDSLDYQPAKVDEDE 
fig|1231383.3.peg.2011   Staphylococcus aureus KT/314250                               MKDEQKKEEQTNKT−−−−−−−−DSKEEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKADELSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDEDE 
fig|196620.1.peg.401   Staphylococcus aureus subsp. aureus MW2                               MKDEQKKEEQTNKT−−−−−−−−DSKEEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKADELSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDEDE 
fig|282459.5.peg.423   Staphylococcus aureus subsp. aureus MSSA476                               MKDEQKKEEQTNKT−−−−−−−−DSKEEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKADELSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDEDE 
fig|762962.3.peg.1386   Staphylococcus aureus subsp. aureus ATCC 51811                               MKDEQKKEEQTNKT−−−−−−−−DSKEEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKADELSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDEDE 
fig|931441.3.peg.639   Staphylococcus aureus subsp. aureus CIG1835                               MKDEQKKEEQTNKT−−−−−−−−DSKEEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKADELSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDEDE 
fig|931459.3.peg.925   Staphylococcus aureus subsp. aureus CIGC128                               MKDEQKKEEQTNKT−−−−−−−−DSKEEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKADELSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDEDE 
fig|282459.1.peg.396   Staphylococcus aureus subsp. aureus MSSA476     MMEYIKKIALYMSVLLLIIFIGGCGNMKDEQKKEEQTNKT−−−−−−−−DSKEEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKADELSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−EKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDEDE 
fig|546343.3.peg.965   Staphylococcus aureus subsp. aureus str. JKD6009                                                                      MYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDEDD 
fig|1112349.3.peg.268   Staphylococcus aureus subsp. aureus NN50                               MKDEQKKEEQTNKT−−−−−−−−DSKEEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDEDD 
fig|553567.3.peg.1958   Staphylococcus aureus A5948                               MKDEQKKEEQTNKT−−−−−−−−DSKEEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDEDD 
fig|553590.4.peg.2513   Staphylococcus aureus A9754                               MKDEQKKEEQTNKT−−−−−−−−DSKEEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDEDD 
fig|904778.3.peg.1011   Staphylococcus aureus subsp. aureus IS-88                               MKDEQKKEEQTNKT−−−−−−−−DSKEEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDEDD 
fig|931433.3.peg.1024   Staphylococcus aureus subsp. aureus CIG1114                               MKDEQKKEEQTNKT−−−−−−−−DSKEEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDEDD 
fig|931442.3.peg.1107   Staphylococcus aureus subsp. aureus CIG547                               MKDEQKKEEQTNKT−−−−−−−−DSKEEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDEDD 
fig|1158539.3.peg.379   Staphylococcus aureus M0633     MMGYIKRMALYMSVFLLIIFIVGCRNMKDEQKKEEQTNKT−−−−−−−−DSKEEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDEDD 
fig|367830.3.peg.2455   Staphylococcus aureus subsp. aureus USA300     MMGYIKRMALYMSVFLLIIFIVGCRNMKDEQKKEEQTNKT−−−−−−−−DSKEEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDEDD 
fig|426430.6.peg.409   Staphylococcus aureus subsp. aureus str. Newman     MMGYIKRMALYMSVFLLIIFIVGCRNMKDEQKKEEQTNKT−−−−−−−−DSKEEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDEDD 
fig|452948.4.peg.1088   Staphylococcus aureus 930918-3     MMGYIKRMALYMSVFLLIIFIVGCRNMKDEQKKEEQTNKT−−−−−−−−DSKEEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDEDD 
fig|455227.3.peg.1756   Staphylococcus aureus D30     MMGYIKRMALYMSVFLLIIFIVGCRNMKDEQKKEEQTNKT−−−−−−−−DSKEEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDEDD 
fig|93062.19.peg.473   Staphylococcus aureus subsp. aureus COL     MMGYIKRMALYMSVFLLIIFIVGCRNMKDEQKKEEQTNKT−−−−−−−−DSKEEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFY−−−−−−−−−−−NKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSV