(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00019901

fig|270374.3.peg.4211   Marinobacter sp. ELB17               GALVPVSDADTET−−−−−−−LRRFRLRVGQLVVAS−−IDRP−−RHPEGLRLLHSFAQLIS−−−−−−−QNVEGFEHHTAHQVIKKLQAQSGVGCTMISTSLRDFWRTLLPSISDAL−−−−APGAVNGFEEISDMVNAGAGD−−−−−−−RMITGYQPKSLSAATMDDSEFQEIFDGL                                 
fig|543728.3.peg.2462   Variovorax paradoxus S110     KAMLIRTEKGLRGATQGDHDAYSKFKRRLE−−TMKPGKWLRLE−−WATP−−RNGPQHRKLMALLQLVAENS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ETYPTVEKALPAVKLAAGYFDPAVDPRTGEVYPQLHSISFDKMEQDDFERFYSAAIDGVLQVILPQM−−−−−−−−DRDTADRLLE   
fig|360910.3.peg.1322   Bordetella avium 197N               GKLAGLTPFDDRAYSRFKKKLG−−LLRPGDTISFE−−HRFP−−RSPKFHRLHFALLGAIFDNQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DQFVSPEDLRKWVEVGAGHCRFVPGPKGRLVALPLSISYESLDDAEF                                        
fig|228400.4.peg.932   Haemophilus somnus 2336     KYQMMKLAGGVFSPLNDTEAER−−−−−−−LK−−SFQNNEQYEIE−−IKRQ−−RNPAFHRKVFAFFNFCFEHWCGEHSD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WKFQDEIAQFDTFRKHLTVLAGFYVKTWNLKGEVRIDAQSLSYANMEQEEFEKVYQALINAALKHVFGHT−−−−−−−QDENIINQLYSFF 
fig|205914.5.peg.1456   Haemophilus somnus 129PT     KYQMMKLAGGVFSPLDDNEAER−−−−−−−LK−−SFQNNEQYEIE−−IKRQ−−RNPAFHRKVFAFFKFCFEHWCGEHSD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WKFQDEIAQFDTFRKHLTVLAGFYVKTWNLKGEVRIDAQSLSYANMEQEEFEKVYQALINAALKHVFGHT−−−−−−−QDENIINQLYSFF 
fig|669261.3.peg.1657   Mannheimia haemolytica serotype A2 str. OVINE     KYQMMKLPGGILSPLNDEEAER−−−−−−−LK−−SFQNGEQYEIE−−IKRQ−−RNPAFHRKVFAFFNFCFDCWSGSHSD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WEFQDPTAQFDTFRKHLTVMAGFYVQTWNLKGQVRIEAKSLSYANMEQDEFEQAYKALINAAIKHVFNNT−−−−−−−KDENTINQLYSFF 
fig|281310.3.peg.900   Haemophilus influenzae 86-028NP     KIQMIKLQGGVLAPLDELESEE−−−−−−−LK−−SLKNGEQYEIE−−IIRT−−RNPAFHRKVFAFFKFCFNHWAADKTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WEHFDERKQFDTFRKHLTVLAGFYESTYNIKGDLRIEAQSLSYGNMEQAEFESCYKALISAAIKHIFNDT−−−−−−−TDENTLNQLYAFFG
fig|272629.3.peg.2152   Mannheimia haemolytica PHL213     KIQMIKMQGGVLVPLNEREAEA−−−−−−−LV−−SLKNGEQYEIE−−VIRT−−RNPAFHRKVFAFLNFCFEYWSADKTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WEFFDERKQFDTFRKNLTVLAGFKEITYTLDGRMRVEAQSLSYGNMEQDEFEQVYKALINAAIKHVFNNT−−−−−−−KDENRINQLYSFF 
fig|537457.7.peg.494   Actinobacillus pleuropneumoniae serovar 7 str. AP76        MIKTAGGALVPLDDEQAEA−−−−−−−LK−−KFRNGEQYEIE−−IKLS−−RNPQFHRKVFAFFKFCFDHWSADKTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WRYFDERTQFDVFRKNLTVLAGFKDVSYTIDGRMRVEAKSLAYGNMEQDEFERCYQALITAAIKNIFQGC−−−−−−−−DRQTEEQLYAFF 
fig|228399.4.peg.1594   Actinobacillus pleuropneumoniae serovar 1 str. 4074        MIKSAGGAFVPLDDEQAET−−−−−−−LK−−KFRNGEQYEIE−−IKLS−−RNPQFHRKVFAFFKFCFDHWSADKTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WRYFDEHTQFDVFRKNLTVLAGFKDVSYTIDGRMRVEAKSLSYGNMEQDEFERCYNALINAAMKHIFKGC−−−−−−−DGPQILDRLYAFF 
fig|228399.1.peg.1468   Actinobacillus pleuropneumoniae serovar 1 str. 4074     KVQMIKSAGGAFVPLDDEQAET−−−−−−−LK−−KFRNGEQYEIE−−IKLS−−RNPQFHRKVFAFFKFCFDHWSADKTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WRYFDEHTQFDVFRKNLTVLAGFKDVSYTIDGRMRVEAKSLSYGNMEQDEFERCYNALINAAMKHIFKGC−−−−−−−DGPQILDRLYAFF 
fig|291112.3.peg.3514   Photorhabdus asymbiotica     QIEMIKNAGGVFAPVFERDLPR−−−−−−−LT−−KFKNGEQYTAE−−FKLT−−RNPAFHRKMFAFFNFCFEHWAADKAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LENMDEHSQFDRFRKDLTILAGFYEQTVRLNGEIRTEAKSLAYASMDQDEFERCYNAMINAALKHIFKSA−−−−−−−−DKLTENRLLSFF 
fig|291112.3.peg.4010   Photorhabdus asymbiotica     QIEMIKNAGGVFAPVFERDLPR−−−−−−−LT−−KFKNGEQYTAE−−FKLT−−RNPAFHRKMFAFFNFCFEHWAADKAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LENMDEHSQFDRFRKDLTILAGFYEQTVRLNGEIRTEAKSLAYASMDQDEFERCYNAMINAALKHIFKSA−−−−−−−−DKLTENRLLSFF 
fig|1048265.3.peg.5141   Escherichia coli O104:H4 str. 04-8351     EIEMIKAANGVFVPAYERDLPR−−−−−−−LA−−KFKNGELYTLE−−AKLT−−RNPSFHRKMFAFLNFCFQYWCAEHAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YEFSDEATQFDEFRKNLTILAGFYDVVTTIRGEVRYRAKSLSYANMDQDEFERCYNAMINAALKHVFGRS−−−−−−−NNPELNNRLLSFF 
fig|670904.4.peg.3907   Escherichia coli OK1180     EIEMIKAANGVFVPAYERDLPR−−−−−−−LA−−KFKNGELYTLE−−AKLT−−RNPSFHRKMFAFLNFCFQYWCAEHAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YEFSDEATQFDEFRKNLTILAGFYDVVTTIRGEVRYRAKSLSYANMDQDEFERCYNAMINAALKHVFGRS−−−−−−−NNPELNNRLLSFF 
fig|502346.5.peg.4093   Escherichia coli O157:H7 str. TW14588     EIEMIKAANGVFELAYERDLPR−−−−−−−LA−−KFKNGEQYTLE−−AKLT−−RNPSFHRKMFAFLNFCFQYWCAEHAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YEFSDEATQFDEFRKNLTILAGFYDVVTTIRGEVRYRAKSLSYANMDQDEFERCYNSMINAALKHVFGRS−−−−−−−NSPELNNRLLSFF 
fig|1005519.3.peg.3144   Escherichia coli TW09098     EIEMIKAANGVFVPAYERDLPR−−−−−−−LA−−KFKNGELYTLE−−AKLT−−RNPSFHRKMFAFLNFCFQYWCAEHAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YEFSDEATQFDEFRKNLTILAGFYDVVTTIRGEVRYRAKSLSYANMDQDEFERCYNSMINAALKHVFGRS−−−−−−−NSPELNNRLLSFF 
fig|556269.4.peg.1486   Oxalobacter formigenes OXCC13     DIYLTKTPTGALVPADSDSADY−−−−−−−LK−−KHKVGQGFKAK−−ITRA−−RNVMFLRKFFALLNYGFDTWKPLEAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YHGQIAEKNFKQFREDITILAGYFETFVRMDGSVQLRAKSISFANMDEDEFESLYSAVIDVLLKRIFINQ−−−−TRGDVENVVNNILAFS 
fig|580332.5.peg.1903   Sideroxydans lithotrophicus ES-1                                           GEISFLE−−FIIP−−RNGKFHRKFFAMLDVGFDAWEPNRVRKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YKGRAMEKNREQFREDIIILAGFYEQTFDLKGRMRIRAKSIAFANMDDTEFEQLYSAVATVLLREVLKTY−−−KDRAELDAVVDRMMGF  
fig|269482.4.peg.29   Burkholderia vietnamiensis strain G4     EILLTKAADGTLRPLDEAQADL−−−−−−−LK−−RYATDTLIRCE−−VKQV−−RNPRFHRKFFALLTLGFESWEPPILE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YKGFEVQKDFEHFREDVTIAAGFYVVTTNLHGSVRLRAQSISFASMKQDEFERLYNAVANVLLQKVLTRY−−−−TRADLDQVINRVLGF  
fig|1216965.3.peg.875   Edwardsiella tarda NBRC 105688     EALGVLLPGGGICYATDHDRDV−−−−−−−MR−−AVPVGTPIALQPVGDR−−RNLKHHRKFFKLLELGMQYWIPRWDFVSRSENWVAHTVARRIAEAAADPSLYDNVTRQIAQGVLACLAEKRRGLFDAEAIKTDEAYLNHVMTQAGFCDVKPAPDGGTFRQRWSIAFANMDQATFDRIYRGVAGVIWNETLSQH−−FASEAEMELALNQLMAF  
fig|500638.3.peg.886   Edwardsiella tarda ATCC 23685     EALGVLLPGGGICYATDHDRDV−−−−−−−MR−−AVPVGTPIALQPVGDR−−RNLKHHRKFFKLLELGMQYWIPRWDFVSRSENWVAHTVARRIAEAAADPSLYDNVTRQIAQGVLACLAEKRRGLFDAEAIKTDEAYLNHVMTQAGFCDVKPAPDGGTFRQRWSIAFANMDQATFDRIYRGVAGVIWNETLSQH−−FASEAEMELALNQLMAF  
fig|1027360.4.peg.1019   Edwardsiella ictaluri ATCC 33202     EALGVLLPGGGIRYATDHDRDV−−−−−−−MR−−AVPVGTPIALQPVGDR−−RNLKHHRKFFKLLALGMQYWVPRWDFVSRSESWVAHAVARRIAEAAADPALYDNVTRQIAQGVLARLAEKRRGLFDAEALKTEEAYLNHVMTRAGFCDVKPAPDGGTYRQRWSIAFANMDQATFDRIYRGVAGVIWNETLSQH−−FASEAEMALAVDQLMAF  
fig|273123.1.peg.1908   Yersinia pseudotuberculosis IP 32953     EVLGVLLPGGGIKYATDHDRET−−−−−−−MK−−GVPAGTPISMSPIGDR−−RNLKHHRKFWKLLELGFSYWVPDWTFVSAPEEWIAHEVAKAVGSAAGDPELYEKVTKSIAQAVLDRVIRQRQKRFDGEAVKTDSAYFNHVMIKAGFYDLMPNPEGGTLKQRWSIAFVNMDQGVFDRIYKGVAGVIWNETLGQH−−FDDEYEMEQAVNRLLEY  
fig|561230.3.peg.2323   Pectobacterium carotovorum subsp. carotovorum PC1     EALGVLLPGSGIKYCTDHDRDV−−−−−−−MK−−GVPIGTPILLTPIGDR−−RNIKHHRKFWKLLELGFAYWEPEWAFVSKSEAWIAQEVAKELAQEAGDLSLYDNVTKGIAVRVLERIAAQRRQRFDPEAVKTKDAYLNHVMVKAGFYDLALNPDGGTLKQRWSIAFVNMGQEKFDKVYRGVFGVIWNETLSQY−−FADQYEMEQAVSQLMNF  
fig|339671.7.peg.1293   Actinobacillus succinogenes 130Z      IHAVKYANGAVVAETDYDRNL−−−−−−−LK−−SLPVGSAVKIMPLSNN−−RNYQHHKKFFALLDAGFEYWQPEFSVLTQAEEWIAQAVAHEIAIVANDEHLYQNVTKPIADRVLAKVRSNRESKLDYEGMKTLEAYLDHVMKKAGFYDIKPSQDGGTTKERWSISFANMSQEKFNSVYRAVFGVIWNETLCNI−−YESEWELDNKINQLIGF  
fig|634176.4.peg.458   Aggregatibacter aphrophilus NJ8700      IHAVKYANGAVVAETDYDRNL−−−−−−−LK−−SLPVGSAVKITPIGNN−−RNYHHHKKFFALLDAGFEYWQPEFSVLTQAEEWIAQAVAREIAVAANDENLYQNVTKPIADSVLAKVRSNRESKLDYEGMKTLEAYLDHVMKKAGFYDIKPGQDGGTLKERWSISFGNMSQEKFNDVYKGVFGVIWNETLCNV−−YENEWELESKINQLIGFVG
fig|641147.3.peg.2397   Simonsiella muelleri ATCC 29453     ELMMTKTPNGELIPLSEYDSEF−−−−−−−SG−−SLKVNQPYKVV−−IKQVSSRNLKYHRLFFGGLIPFAFQYWQPSGGMIGENERDTVQWVIRRMAEQSGAN−−−−VAILQDYANHALEELALKRAEKFGQPETSLESFRRWLIIAAGRFKIIETPHGIVKEPESISFANMPHQEDFEKLYKDCADVVWNLLCKHQ−−FKSQEEMHNAINEFLE   
fig|412966.3.peg.126   Vibrio cholerae 1587      LSLVRSKTGGLAPLSPEDEEV−−−−−−−LR−−RYAIGEVIEFPKLPSKV−−RNPQFHKKYMALLKLGFDYWEPKGGTVCPNEDRLLKNFVAYLSKELGHG−−−−−DVLSEYESEFLYQMQAKRSAYAVEKSFLAYRRWVAVEAGFYTVIILPNGAIRKEPKSISFAKMDDHEFQELYRASFNVIWQQIVRPGGYLGSEQEMEKIVNQMMGYV 
fig|412966.10.peg.145   Vibrio cholerae 1587         MRSKTGGLAPLSPEDEEV−−−−−−−LR−−RYAIGEVIEFPKLPSKV−−RNPQFHKKYMALLKLGFDYWEPKGGTVCPNEDRLLKNFVAYLSKELGHG−−−−−DVLSEYESEFLYQMQAKRSAYAVEKSFLAYRRWVAVEAGFYTVIILPNGAIRKEPKSISFAKMDDHEFQELYRASFNVIWQQIVRPGGYLGSEQEMEKIVNQMMGYV 
fig|675817.3.peg.3620   Photobacterium damselae subsp. damselae CIP 102761     KIALVKTLGGTLVPLTDDDKAI−−−−−−−IE−−KKRVGTVIECD−−FKTI−−RNPMFHRKYFALLNLGFDYWEPKGGTVSPAERGLLMRFVKMLAQYGGEL−−−−−QTLQDIASGYLEHLSEHRAQLEIEKSFEAYRKWVIIESGFYDVVVLPNGTTRREAKSISFAKMDDVEFNELYNSSFNVLWNHILNGY−−FDNRILTEIAVKRLLGY  
fig|220664.5.peg.3869   Pseudomonas fluorescens Pf-5     ELALIRTAQGLVPATEADRET−−−−−−−IQ−−CWKAGQVIHGK−−FTKM−−RNARFHGKFFAMLDLAWEYWEPVGGLIPRQEMRGIRGLAKFFEAQNGRP−−−−−GQLSNAVDAYIAGLEQARAERFPSVDKSREAFREWVTIEAGHFHLVRTPDGVRKEAKSISWANMDDTQFEPLYRDVFNACWRLVLSAH−−FETEEAALAAADQIGSFA 
fig|1163393.3.peg.3853   Pseudomonas aeruginosa ATCC 25324     ELALIRTAQGLVPATEADRET−−−−−−−VQ−−KWKAGQVVHGK−−FTRM−−RNAKFHGKFFAMLDLAWEYWEPKGGLVPRQEMRGIRGLAKYFEDLNGRP−−−−−GQLQNAVAAYIAKLEADRAGRFPAVEKSREAFREWITIEAGHFHLIHTPDGVRKEAKSISWASMDDTAFEPLYRDVFAACWRLVLSSH−−FETE               
fig|557722.4.peg.2609   Pseudomonas aeruginosa LESB58     ELALIRTAQGLVPATEADRET−−−−−−−VQ−−KWKAGQVVHGK−−FTRM−−RNAKFHGKFFAMLDLAWEYWEPKGGLVPRQEMRGIRGLAKYFEDLNGRP−−−−−GQLQNAVAAYIAKLEADRAGRFPAVEKSREAFREWITIEAGHFHLIHTPDGVRKEAKSISWASMDDTAFEPLYRDVFAACWRLVLSSH−−FETE               
fig|349747.3.peg.302   Yersinia pseudotuberculosis IP 31758     QYSFTKSAGGILVPATPDAESF−−−−−−−VK−−NTRLGTIVTGE−−FKRV−−RNAPFHRKFFSLLNLGFEYWEPSGGAISPFELQFLRGYINRLMAYVGNK−−−−−GVLHEIADDYLALVAGKRAANLSTVKSFHAFRRWVTVEAGHYDLFELPDGSTLREPRSISFSAMDELEFNDLYKSTLNVLWTFILSKS−−FNNPFEVENAASQLMSYAA
fig|349747.9.peg.2644   Yersinia pseudotuberculosis IP 31758     QYSFTKSAGGILVPATPDAESF−−−−−−−VK−−NTRLGTIVTGE−−FKRV−−RNAPFHRKFFSLLNLGFEYWEPSGGAISPFELQFLRGYINRLMAYVGNK−−−−−GVLHEIADDYLALVAGKRAANLSTVKSFHAFRRWVTVEAGHYDLFELPDGSTLREPRSISFSAMDELEFNDLYKSTLNVLWTFILSKS−−FNNPFEVENAASQLMSYAA
fig|349966.5.peg.4325   Yersinia frederiksenii ATCC 33641                 MVPATPDAEDF−−−−−−−VK−−NTKLGTIVTGE−−FKRV−−RNAPFHRKFFSLLNLGFEYWEPRGGAISPFELKFLRGYVSQLISYVGNE−−−−−GVLHEIADDYLALVAGKRTANLSTAKSFHAFRRWVTVESGHYDLYELPDGSTLREPRSISFSKMDELEFNDLYKAVLNVLWTFILSKS−−FSHPSEAENAASQLMSYAA
fig|349966.3.peg.4163   Yersinia frederiksenii ATCC 33641     QYSFTKSTGGILVPATPDAEDF−−−−−−−VK−−NTKLGTIVTGE−−FKRV−−RNAPFHRKFFSLLNLGFEYWEPRGGAISPFELKFLRGYVSQLISYVGNE−−−−−GVLHEIADDYLALVAGKRTANLSTAKSFHAFRRWVTVESGHYDLYELPDGSTLREPRSISFSKMDELEFNDLYKAVLNVLWTFILSKS−−FSHPSEAENAASQLMSYAA
fig|409438.11.peg.2387   Escherichia coli SE11     QHSFIRVSGGSLIPATPDTQRW−−−−−−−LTERVKPGAVVYAD−−FKQA−−RNPAFHRKFFSLLNLGFDYWHPSGGAISPAERELVHGYVKLLAYYGGHG−−−−−DVMAELADQYLLDESEKRAGNISAVKSFEAFRAWAIMEAGFYDVHQMPDGSLMRVPRSISFAAMDDLEFGQLYSAVLDVLWNYILFRT−−FASQEAAENAAAQLLDY  
fig|796732.3.peg.3085   Salmonella enterica subsp. enterica serovar Newport str. CVM 22513     QYSFVKSAGGVLIPATPDAREF−−−−−−−IDKKFRLGAVLYAD−−FKQA−−RNAAFHRKFFALLNLGFDYWQPSGGAISPADKKLVRGYVQLVAHYAGHE−−−−−ETLQELADQYLHEEAEKRASNISSVKSFEAFRAWVTIESGFYTEYQMPDGTSRKEPKSISFAKMDDIEFSQLYKSVLDVLWNYILYRT−−FPTQQAAENAAAQLFSYAA
fig|667127.3.peg.525   Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884     QYSFIKAAGDVLIPASPDAREF−−−−−−−VK−−KIRLGAVLCSD−−FKQA−−RNPAFHRKFFALLNLGFDYWQPSGGAISPADKKLVRGYVQLVAHYAGHG−−−−−DTLQELADQYLRDEAEKRAGNISAVKSFEAFRAWVTIEAGFYNEYQMPDGTIRKEPKSISFAKMDDLEFSQLYKSVLDVLWNFILFRT−−FPTQQAAENAASQLFSYAA
fig|243265.1.peg.3309   Photorhabdus luminescens subsp. laumondii TTO1     QHSFIKISNDTLRPATPAAREY−−−−−−−LHSKVKWGDVLYAD−−FKKA−−RNPRFHRKYFALLNLGYEYWEPAGGTISPEEKALVRGYVQFLAHFAGSE−−−−−DVLQSAADEYLAGISKNRAQNITATKSFDAFRRWATVESGHYDIYEMPNGSLYREPRSVSFAKMEEMEFQELYKDTLNVLWNFILYRN−−FPTRNAAEHAASQLSDF  
fig|406818.4.peg.2613   Xenorhabdus bovienii SS-2004     QHSFIKISNDTLRPATPATREY−−−−−−−LHSKIKCSDVLQAD−−FKKV−−RNPRFHRKYFALLNLGFEYWEPVGGTISPEEKAIVRGYVQFLAHFAGRE−−−−−DALQSAEDEYLAGLSKNRAHNITATKYFDAFRRWIIVESGHYDTYEMPDGRLYRELRSVSFAKMDELEFQSLYQSTLNVLWNFILYRN−−FPTKDAAENAAAQLFDFV 
fig|471874.6.peg.1329   Providencia stuartii ATCC 25827                                                                                              RVYVKFLAYYTDND−−−−−DALQSATDVYLDGVAQKRAHNIPATKSFDAF−−−−−−−−−−−−−−EMPDGSLRRVAKSISFAKMDDLAFGELYKSTLDVLWNFILFRK−−FPTQQAAENAAGQLLDF  
fig|471881.3.peg.558   Proteus penneri ATCC 35198     QHSFIKMSNDTLVPANPVTRDF−−−−−−−LHSKIKCGDVLSAN−−FKKA−−RNPRFHRKYFALLNLGYEYWEPIGGTISPEEKELVRGYVKFLAYYTDNA−−−−−DALLSASDIYLEEVAQNRAQNISATKSFDAFRYWVVEQAGYYDTFEMPDGSLRRVAKSISFANMDDLAFSELYKATLDVLWNFILRKQ−−FPTQKAVENAVSQLLSF  
fig|520999.6.peg.3634   Providencia alcalifaciens DSM 30120        FIKMSNDTLVPANPAARDF−−−−−−−LHSKIKCGDVLYAD−−FKKA−−RNPRFHRKYFALLNLGYEYWEPTGGTISPEEKELVRGYVKFLAYYTDND−−−−−DALQSAADVYLDDIAQKRAHNISAAKSFDAFRYWVVEQSGHYETFEMPDGSIRRVAKSISFAKMDDLAFGELYKATLDVLWNFILFRK−−FPT                
fig|500637.6.peg.2366   Providencia rustigianii DSM 4541        FIKMSNDTLVPANPAARDF−−−−−−−LHSKIKCGDVLYAD−−FKKA−−RNPRFHRKYFALLNLGYEYWEPTGGTISPEEKELVRGYVKFLAYYTDND−−−−−DALQSTADVYLDDIAKKRARNISAAKSFDAFRYWVVEQSGHYETFEMPDGSLRRVAKSISFAKMDDLAFGELYKATLDVLWNFILFRK−−FPTQKAAENAAAQLLDF  
fig|500637.6.peg.6000   Providencia rustigianii DSM 4541        FIKMSNDTLVPANPAARDF−−−−−−−LHSKIKCGDVLYAD−−FKKA−−RNPRFHRKYFALLNLGYEYWEPTGGTISPEEKELVRGYVKFLAYYTDND−−−−−DALQSTADVYLDDIAKKRARNISAAKSFDAFRYWVVEQSGHYETFEMPDGSLRRVAKSISFAKMDDLAFGELYKATLDVLWNFILFRK−−FPTQKAAENAAAQLLDF  
fig|349966.3.peg.4231   Yersinia frederiksenii ATCC 33641     QLSFIKSGNETLTPATPDVRDF−−−−−−−LHYKVKLGAILTAD−−FKQV−−RNPKFHRKYFSLLNLGFDYWIPSGGTISPEEKKLVRGYVNYLAEYAGHS−−−−−DTLEELARQYLDTLAEQRADRVTLLKSFDAFRRWTTIQAGYYAIIQMPDGSQFKEPKSISFASMDDTEFAELYKATLDVLWQFILNKT−−FSTPAAAENAASQLLSYA 
fig|349966.5.peg.4418   Yersinia frederiksenii ATCC 33641     QLSFIKSGNETLTPATPDVRDF−−−−−−−LHYKVKLGAILTAD−−FKQV−−RNPKFHRKYFSLLNLGFDYWIPSGGTISPEEKKLVRGYVNYLAEYAGHS−−−−−DTLEELARQYLDTLAEQRADRVTLLKSFDAFRRWTTIQAGYYAIIQMPDGSQFKEPKSISFASMDDTEFAELYKATLDVLWQFILNKT−−FSTPAAAENAASQLLSYA 
fig|218493.5.peg.966   Salmonella bongori NCTC 12419     ELQLIKQSSGILIPATPETSDI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGAISANERKLVNGYAKFLAAYGGNE−−−−−SALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQVYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSFAG
fig|476213.4.peg.2803   Salmonella enterica subsp. enterica serovar Paratyphi C strain     ELQLIKQSSGILIPATPETSEI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGAISANERKLVNGYAKFLAAYGGNE−−−−−SALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQVYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSFAG
fig|1218145.3.peg.927   Salmonella enterica subsp. enterica serovar Typhimurium str. STm3     ELQLIKQSSGILIPATPETSEI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGTISANERKLVNGYAKFLAAYGGNE−−−−−SALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSFAG
fig|465518.5.peg.3732   Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537     ELQLIKQSSGILIPATPETSEI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGTISANERKLVNGYAKFLAAYGGNE−−−−−SALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSFAG
fig|568708.3.peg.1067   Salmonella enterica subsp. enterica serovar Typhimurium str. D23580     ELQLIKQSSGILIPATPETSEI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGTISANERKLVNGYAKFLAAYGGNE−−−−−SALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSFAG
fig|588858.6.peg.1157   Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S     ELQLIKQSSGILIPATPETSEI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGTISANERKLVNGYAKFLAAYGGNE−−−−−SALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSFAG
fig|796732.3.peg.3000   Salmonella enterica subsp. enterica serovar Newport str. CVM 22513     ELQLIKQSSGILIPATPETSEI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGTISANERKLVNGYAKFLAAYGGNE−−−−−SALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSFAG
fig|99287.12.peg.1078   Salmonella enterica subsp. enterica serovar Typhimurium str. LT2     ELQLIKQSSGILIPATPETSEI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGTISANERKLVNGYAKFLAAYGGNE−−−−−SALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSFAG
fig|573395.3.peg.2641   Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191     ELQLIKQSSGILIPATPETSEI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGAISANERKLVNGYAKFLAAYGGNE−−−−−SALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSFAG
fig|904139.4.peg.3470   Salmonella enterica subsp. enterica serovar Choleraesuis str. A50     ELQLIKQSSGILIPATPETSEI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGAISANERKLVNGYAKFLAAYGGNE−−−−−SALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSFAG
fig|272994.5.peg.1823   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7     ELQLIKQSSGILIPATPETSDI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGAISANERKLVNGYAKFLAAYGGNE−−−−−SALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−FRTQYEAENAAAQLMSFAG
fig|1176487.3.peg.3533   Salmonella enterica subsp. enterica serovar Typhi str. ST0208     ELQLIKQSSGILIPATPETSDI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGAISANERKLVNGYAKFLAAYGGNE−−−−−SALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSFAG
fig|220341.7.peg.1042   Salmonella enterica subsp. enterica serovar Typhi str. CT18     ELQLIKQSSGILIPATPETSDI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGAISANERKLVNGYAKFLAAYGGNE−−−−−SALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSFAG
fig|272994.5.peg.846   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7     ELQLIKQSSGILIPATPETSDI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGAISANERKLVNGYAKFLAAYGGNE−−−−−SALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSFAG
fig|454168.5.peg.4734   Salmonella enterica subsp. enterica serovar Newport str. SL317     ELQLIKQSSGILIPATPETSDI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGAISANERKLVNGYAKFLAAYGGNE−−−−−SALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSFAG
fig|476213.4.peg.1078   Salmonella enterica subsp. enterica serovar Paratyphi C strain     ELQLIKQSSGILIPATPETSDI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPVFHRRSFALLNLGFEYWEPTGGAISANERKLVNGYAKFLAAYGGNE−−−−−SALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSFAG
fig|904139.4.peg.1368   Salmonella enterica subsp. enterica serovar Choleraesuis str. A50     ELQLIKQSSGILIPATPETSDI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPVFHRRFFALLNLGFEYWEPTGGAISANERKLVNGYAKFLAAYGGNE−−−−−SALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSFAG
fig|568708.3.peg.2800   Salmonella enterica subsp. enterica serovar Typhimurium str. D23580     ELQLIKQSSGILIPATPETSDI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGAISANERKLVNGYAKFLAAYGGNE−−−−−SALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−LRTQREAENAAAQLMSWAG
fig|99287.12.peg.2769   Salmonella enterica subsp. enterica serovar Typhimurium str. LT2     ELQLIKQSSGILIPATPETSEI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGAISANERKLVNGYAKFLAAYGGNE−−−−−SALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSWAG
fig|1218145.3.peg.2661   Salmonella enterica subsp. enterica serovar Typhimurium str. STm3     ELQLIKQSSGILIPATPETSDI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGAISANERKLVNGYAKFLAAYGGNE−−−−−SALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSWAG
fig|454168.5.peg.4662   Salmonella enterica subsp. enterica serovar Newport str. SL317     ELQLIKQSSGILIPATPETSDI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGAISANERKLVNGYAKFLAAYGGNE−−−−−SALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSWAG
fig|465518.5.peg.3181   Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537     ELQLIKQSSGILIPATPETSDI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGAISANERKLVNGYAKFLAAYGGNE−−−−−SALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSWAG
fig|588858.6.peg.2981   Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S     ELQLIKQSSGILIPATPETSDI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGAISANERKLVNGYAKFLAAYGGNE−−−−−SALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSWAG
fig|796732.3.peg.4707   Salmonella enterica subsp. enterica serovar Newport str. CVM 22513     ELQLIKQSSGILIPATPETSDI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGAISANERKLVNGYAKFLAAYGGNE−−−−−SALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSWAG
fig|1212559.4.peg.2282   Salmonella enterica subsp. enterica serovar Hadar str. 2011K-0112     ELQLIKQSSGILIPATPETSDI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGAISANERKLVNGYAKFLAAYGGNE−−−−−GALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSFAG
fig|789645.3.peg.2583   Salmonella enterica subsp. enterica serovar Newport str. CVM 33953     ELQLIKQSSGILIPATPETSDI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGAISANERKLVNGYAKFLAAYGGNE−−−−−GALLDAAEQYLEQIANRRVTNGISLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSFAG
fig|340185.3.peg.3225   Escherichia coli E22     ELQLIKQSSGILIPATPETSDI−−−−−−−LQSKIKLGAVLVAE−−FRQV−−RNPAFHRRFFALLNLGFEYWEPTGGAISSNERKLVNGYAKFLAAFGGNE−−−−−GALLDAAEQYLDRIADKRAGSISICKSYDAYRAWVIVESGHYDAIQLPDGTLRKHPRSIAFANMDETEFQDLYKSALDVLWRWILSRT−−FNSREEAENAAAQLMSFAG
fig|290338.6.peg.1587   Citrobacter koseri ATCC BAA-895     QLQLIKQSTGILIPATPETSDF−−−−−−−LQSKCKLGSVLVAD−−FKLV−−RNPAFHRRFFALLNLGFEYWEPTGGAISSNERKLVNGYARFLASYGGNE−−−−−SALLDAAEQYLEQIASRRITNGISLCKSFDAYRAWVTVEAGHFDAIQLPDGTLRKHPRSIAFASMDETEFQHLYKAALDVLWRWILSRT−−FNSREEAENAAAQLMSFAG
fig|272620.3.peg.1413   Klebsiella pneumoniae MGH 78578     QLHLIKQSQGLLIPATQETSEF−−−−−−−LQSKCKLGAVLEAD−−FKLV−−RNPAFHRRYFALLNLGFEYWEPTGGAISSNERRLITGYAKFLAAYGGSE−−−−−SALLDAAGQYLDRIAEKRSGYISICKSFDAYRAWVIVEAGHYDAIQLPDGTLKKHPRSISFASMDECEFQELYKASLDVLWRWILSRS−−FNSLQEAENAANQLLSFSG
fig|507522.6.peg.2919   Klebsiella pneumoniae 342     QLHLIKQSQGLLIPATQETSDF−−−−−−−LQSKCKLGAVLEAD−−FKLV−−RNPAFHRRYFALLNLGFEYWEPTGGAISSNERRLITGYAKYLAAYGGSE−−−−−SALLDAAGQYLDRIAEKRSGYISICKSFDAYRAWVIVEAGHYDAIQLPDGTLKKHPRSISFASMDECEFQELYKASLDVLWRWILSRS−−FNSLQDAENAANQLLSFAG
fig|272994.5.peg.1885   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7      LQLVKQTSSGLLLPATPESGDF−−−−−−−LR−−SVKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPTGGTVTSREQKLISGFVNFLCDSAGQE−−−YTPALNEAAEQYLHNVATLRTGDVALLKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFSSMDEVEFQQLYKSALDVLWRWILSRT−−FRTQREAENAAAQLMSFAG
fig|667129.3.peg.3276   Serratia odorifera DSM 4582      IQLVKSAPTILTPATIEASEF−−−−−−−LQ−−RVKLGEWIQAE−−FRRV−−RNYQFHKRFFKLLQFGFDYWTPTGGTLTQPERQLINGFVEYLIDMSGQH−−−−GEVISAVADEYLFQVGKQRAQDIVLLKSFEPYRGWATVEAGYYDEVILPNGLRQRIPKSISFAKMDEDSFQSLYKSVFNVLWHFILSRS−−FRSRQEAENVALQLLKYS 
fig|1328327.3.peg.2871   Salmonella enterica subsp. enterica serovar Bareilly str. 07-0873      LQLVKQTSSGLLLPATPESGDF−−−−−−−LR−−SVKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPTGGTVTSREQKLISGFVNFLCDSAGQE−−−YTPALNEAAEQYLHNVATLRTGDVALLKSFDAFREWVTVQAGFYTEHFYPDGSRGRRAKSIAFASMDETEFQQVYKAVLNVLWNWILFRK−−FSSPEEVENVAAHLLEFA 
fig|454168.5.peg.4119   Salmonella enterica subsp. enterica serovar Newport str. SL317      LQLVKQTSSGLLLPATPESGDF−−−−−−−LR−−SVKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPTGGTVTSREQKLISGFVNFLCDSAGQE−−−YTPALNEAAEQYLHNVATLRTGDVALLKSFDAFREWVTVQAGFYTEHFYPDGSRGRRAKSIAFASMDETEFQQVYKAVLNVLWNWILFRK−−FSSPEEVENVAAHLLEFA 
fig|439842.10.peg.1618   Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188      LQLVKQTSSGLLLPATPESGDF−−−−−−−LR−−SVKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTLKGGTVTSREQKLISGFVNFLCDSAGQE−−−YIPALNEAAEQYLHNVATLRTGDVALLKSFDAFREWVTVQAGFYTEHFYPDGSRGRRAKSIAFASMDETEFQQVYKAVLNVLWNWILFHK−−FSSPEEVENVAAHLLEFA 
fig|1090945.3.peg.4565   Salmonella enterica subsp. enterica serovar Enteritidis str. 50-3079      LQLVKQTSSGLLLPATPESGDF−−−−−−−LR−−SVKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWMPTGGTVTSREQKLISGFVNFLCDSAGQE−−−YTPALNEAAEQYLHNVATLRTGDVALLKSFDAFREWVTVQAGFYTEHFYPDGSRGRRAKSIAFASMDETEFQQVYKAVLNVLWNWILFRK−−FSSLEEVENVAAHLLEFA 
fig|887064.3.peg.2383   Salmonella enterica subsp. enterica serovar Enteritidis str. 622731-39      LQLVKQTSSGLLLPATPESGDF−−−−−−−LR−−SVKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWMPTGGTVTSREQKLISGFVNFLCDSAGQE−−−YTPALNEAAEQYLHNVATLRTGDVALLKSFDAFREWVTVQAGFYTEHFYPDGSRGRRAKSIAFASMDETEFQQVYKAVLNVLWNWILFRK−−FSSLEEVENVAAHLLEFA 
fig|984223.3.peg.2364   Salmonella enterica subsp. enterica serovar Enteritidis str. 648901 1-17      LQLVKQTSSGLLLPATPESGDF−−−−−−−LR−−SVKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWMPTGGTVTSREQKLISGFVNFLCDSAGQE−−−YTPALNEAAEQYLHNVATLRTGDVALLKSFDAFREWVTVQAGFYTEHFYPDGSRGRRAKSIAFASMDETEFQQVYKAVLNVLWNWILFRK−−FSSLEEVENVAAHLLEFA 
fig|465518.5.peg.2556   Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537      LQLVKQTSSGLLLPATPESGDF−−−−−−−LR−−SVKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPTGGTVTSREQKLISGFVNFLCDSAGQE−−−YTPALNEAAEQYLHNVATLRTGDVALLKSFDAFREWVTVQAGFYTGHFYPDGSCGRRAKSIAFASMDETEFQQVYKAVLNVLWNWILFRK−−FSSPEEVENVAAHLLEFA 
fig|588858.6.peg.1408   Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S     ELQLIKQSSGILIPATPESGDF−−−−−−−LR−−SVKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPTGGTVTSREQKLISGFVNFLCGSAGQE−−−YTPALNEAAEQYLHNVATLRTGDVALLKSFDAFREWVTVQAGFYTEHFYPDGSRGRRAKSIAFASMDETEFQQVYKAVLNVLWNWILFRK−−FSSPEEVENVAAHLLEFA 
fig|1090945.3.peg.2657   Salmonella enterica subsp. enterica serovar Enteritidis str. 50-3079      LQLVKQTSSGLLLPATPESEDF−−−−−−−LR−−SVKIGAWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPIGGAILPQEQELITGFVDFLCESAAQG−−−HSPALSDAAEQYLHKVAVNRTLDVALLKSFDAFREWVTIQAGFYTEHYYPDGSRGRRAKSIAFANMDETEFQQVYKAVLNVLWNWILFRK−−FSSPEEVENVAAQLLEFA 
fig|887064.3.peg.2655   Salmonella enterica subsp. enterica serovar Enteritidis str. 622731-39      LQLVKQTSSGLLLPATPESEDF−−−−−−−LR−−SVKIGAWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPIGGAILPQEQELITGFVDFLCESAAQG−−−HSPALSDAAEQYLHKVAVNRTLDVALLKSFDAFREWVTIQAGFYTEHYYPDGSRGRRAKSIAFANMDETEFQQVYKAVLNVLWNWILFRK−−FSSPEEVENVAAQLLEFA 
fig|984223.3.peg.663   Salmonella enterica subsp. enterica serovar Enteritidis str. 648901 1-17      LQLVKQTSSGLLLPATPESEDF−−−−−−−LR−−SVKIGAWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPIGGAILPQEQELITGFVDFLCESAAQG−−−HSPALSDAAEQYLHKVAVNRTLDVALLKSFDAFREWVTIQAGFYTEHYYPDGSRGRRAKSIAFANMDETEFQQVYKAVLNVLWNWILFRK−−FSSPEEVENVAAQLLEFA 
fig|1125636.3.peg.1859   Escherichia coli 2854350      IQLVKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPVGGAITPRERKLVSGFVDYLCESVGRE−−−HTPALSDAAEQYLNTVATCRTRDTALLKSFDAFREWVTIQAGFYTEHIYPDGSRGRRAKSIAFANMDETEFQQVYKSVLNVLWNWILFRK−−FSSPEEVENVAAQLLEFA 
fig|198214.1.peg.1290   Shigella flexneri 2a str. 301      IQLVKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPVGGAITPRERKLVSGFVDYLCESVGRE−−−HTPALSDAAEQYLNTVATCRTRDTALLKSFDAFREWVTIQAGFYTEHIYPDGSRGRRAKSIAFANMDETEFQQVYKSVLNVLWNWILFRK−−FSSPEEVENVAAQLLEFA 
fig|766159.3.peg.1630   Shigella flexneri 2930-71                                       QIKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPVGGAITPRERKLVSGFVDYLCESVGRE−−−HTPALSDAAEQYLNTVATCRTRDTALLKSFDAFREWVTIQAGFYTEHIYPDGSRGRRAKSIAFANMDETEFQQVYKSVLNVLWNWILFRK−−FSSPEEVENVAAQLLEFA 
fig|766161.3.peg.1644   Shigella flexneri 6603-63                                       QIKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPVGGAITPRERKLVSGFVDYLCESVGRE−−−HTPALSDAAEQYLNTVATCRTRDTALLKSFDAFREWVTIQAGFYTEHIYPDGSRGRRAKSIAFANMDETEFQQVYKSVLNVLWNWILFRK−−FSSPEEVENVAAQLLEFA 
fig|373384.11.peg.1570   Shigella flexneri 5 str. 8401      IQLVKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPVGGAITPRERKLVSGFVDYLCESVGRE−−−HTPALSDAAEQYLNTVATCRTRDTALLKSFDAFREWVTIQAGFYTEHIYPDGSRGRRAKSIAFANMDETEFQQVYKSVLNVLWNWILFRK−−FSSPEQVENVAAQLLEFA 
fig|1005559.3.peg.2803   Escherichia coli CB7326      IQLVKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPNGGAITPRERELVSGFVDFLCESVGRE−−−HTPALSDAAEQYLNTVTTCRTRDTALLKSFDAFREWVTIQAGFYTEHFYPDGSRGRRAKSIAFANMDETEFQQVYKSVLNVLWNWILFRK−−FSSPEEVENVAAQLLEFA 
fig|926026.3.peg.4634   Escherichia coli O157:H7 str. G5101      IQLVKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPNGGAITPRERELVSGFVDFLCESVGRE−−−HTPALSDAAEQYLNTVTTCRTRDTALLKSFDAFREWVTIQAGFYTEHFYPDGSRGRRAKSIAFANMDETEFQQVYKSVLNVLWNWILFRK−−FSSPEEVENVAAQLLEFA 
fig|1176487.3.peg.3312   Salmonella enterica subsp. enterica serovar Typhi str. ST0208      IQLVKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPNGGAITPRERELVSGFVDFLCESVGRE−−−HTPALSDAAEQYLNTVATCRTRDTALLKSFDAFREWVTIQAGFYTEHIYPDGSRGRRAKSIAFANMDETEFQQVYKSVLNVLWNWILFRK−−FSSPEEVENVAAQLLEFA 
fig|220341.7.peg.2068   Salmonella enterica subsp. enterica serovar Typhi str. CT18      IQLVKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPNGGAITPRERELVSGFVDFLCESVGRE−−−HTPALSDAAEQYLNTVATCRTRDTALLKSFDAFREWVTIQAGFYTEHIYPDGSRGRRAKSIAFANMDETEFQQVYKSVLNVLWNWILFRK−−FSSPEEVENVAAQLLEFA 
fig|1181726.3.peg.2121   Escherichia coli KTE178      IQLVKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPVGGAITPREREMVFGFVDYLCESVGRE−−−HTPALSDAAEQYLNTVATRRTRDMALLKSFDAFREWVTIQAGFYTEHFYPDGSRGRRAKSIAFANMDETEFQQVYKSVLNVLWNWILFRK−−FSSPEQVENVAAQLLEFA 
fig|550676.3.peg.920   Escherichia coli B185      IQLVKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPVGGAITPREREMVFGFVDYLCESVGRE−−−HTPALSDAAEQYLNTVATRRTRDMALLKSFDAFREWVTIQAGFYTEHFYPDGSRGRRAKSIAFANMDETEFQQVYKSVLNVLWNWILFRK−−FSSPEQVENVTAQLLEFA 
fig|409438.11.peg.1561   Escherichia coli SE11      IQLVKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPVGGAITPRERELLSGFVDYLCESVGRE−−−HTPALSDAAEQYLNTVATRRTRDTALLKSFEAFREWVTIQAGFYTEHIYPDGSRGRRAKSIAFANMDEVEFQQVYKSVLNVLWNWILFRK−−FSSQEEVENVAAQLLEFA 
fig|502346.5.peg.5417   Escherichia coli O157:H7 str. TW14588      IQLVKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPVGGAITPRERELLSGFVDYLCESVGRE−−−HTPALSDAAEQYLNTVATRRTRDTALLKSFEAFREWVTIQAGFYTEHIYPDGSRGRRAKSIAFANMDEVEFQQVYKSVLNVLWNWILFRK−−FSSQEEVENVAAQLLEFA 
fig|670904.4.peg.1359   Escherichia coli OK1180      IQLVKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPVGGAITPRERELLSGFVDYLCESVGRE−−−HTPALSDAAEQYLNTVATRRTRDTALLKSFEAFREWVTIQAGFYTEHIYPDGSRGRRAKSIAFANMDEVEFQQVYKSVLNVLWNWILFRK−−FSSQEEVENVAAQLLEFA 
fig|340185.3.peg.975   Escherichia coli E22      IQLVKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPVGGAITPRERELLSGFVDYLCESVGRE−−−HTPALSDAAEQYLNTVATRRTRDTALLKSFEAFREWVTIQAGFYTEHFYPDGSHGRRAKSIAFANMDETEFQQVYKSVLNVLWNWILFRK−−FSSPEQVENVAAQLLEFA 
fig|216599.1.peg.1325   Shigella sonnei 53G      IQLIKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKTGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPVGGAITPRERELLSGFVDYLCESVGRE−−−HTPALSEAAEQYLNTVATRRTRDTALLKSFEAFREWVTIQAGFYTEHFYPDGSRGRRAKSIAFANMDETEFQQVYKSVLNVLWNWILFRK−−FSSPEQVENVAAQLLEFA 
fig|766163.3.peg.1940   Shigella sonnei 3233-85      IQLIKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKTGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPVGGAITPRERELLSGFVDYLCESVGRE−−−HTPALSEAAEQYLNTVATRRTRDTALLKSFEAFREWVTIQAGFYTEHFYPDGSRGRRAKSIAFANMDETEFQQVYKSVLNVLWNWILFRK−−FSSPEQVENVAAQLLEFA 
fig|373384.11.peg.828   Shigella flexneri 5 str. 8401      IQLVKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPVGGAITPRERKLVSGFVDYLCESVGRE−−−HTPALSEAAEQYLNTVATRRTRDTALLKSFEAFREWVAIQAGFYTEHFYPDGSRGCRAKSIAFANMDETEFQQVYKSVLNVLWNWILFRK−−FSSPEQVENVAAQLLEFA 
fig|766138.3.peg.1063   Shigella boydii 965-58      IQLVKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPVGGAITPRERKLVSGFVDYLCESVGRE−−−HTPALSEAAEQYLNTVATRRTRDTALLKSFEAFREWVAIQAGFYTEHFYPDGSRGCRAKSIAFANMDETEFQQVYKSVLNVLWNWILFRK−−FSSPEQVENVAAQLLEFA 
fig|216599.1.peg.4746   Shigella sonnei 53G                                                           NYAFHKRFSNSCNWVSITGLRSVGAITPRERKLVSGFVDYLCESVGRE−−−HTPALSEAAEQYLNTVATRRTSDTALLKSFEAFREWVAIQAGFYTEHFYPDGSRGCRAKSIAFANMDETEFQQVYKSVLNVLWNWILFRK−−FSSPEQVENVAAQLLEFA 
fig|198214.1.peg.833   Shigella flexneri 2a str. 301      IQLVKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPVGGAITPRERKLVSGFVDYLCESVGRE−−−HTPALSEAAEQYLNTVATRRTRDTALLKSFEA                                                                                 
fig|766159.3.peg.4947   Shigella flexneri 2930-71      IQLVKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPVGGAITPRERKLVSGFVDYLCESVGRE−−−HTPALSEAAEQYLNTVATRRTRDTALLKSFEA                                                                                 
fig|766161.3.peg.1077   Shigella flexneri 6603-63      IQLVKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPVGGAITPRERKLVSGFVDYLCESVGRE−−−HTPALSEAAEQYLNTVATRRTRDTALLKSFEA                                                                                 
fig|926027.3.peg.4723   Escherichia coli O157:H- str. 493-89      IQLVKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPVGGAITPRERKLVSGFVDYLCESVGRE−−−HTPALSEAAEQYLNTVATRRTRDTALLKSFEAFREWVTIQAGFYTEHIYPDGSRGRRAKSISFANMDETEFQQVYKSVLNVLWNWILFRK−−FSSPEQVENVAAQLLEFA 
fig|216598.1.peg.1353   Shigella dysenteriae M131649      IQLVKQTSSGLLLPA−−−SCDF−−−−−−−LH−−QIKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPVGGAITPRERKLVSGFVDYLCESVGRE−−−HTPALSEAAEQYLNTVATRRTRDTALL−−−−AFREWVTIQAGFYTEHIYPDGSRGGRAKSIAFANMDETEFQQVYKSVLNVLWNWSLFRK−−FSSPEEVENVAAQLLEF  
fig|754093.3.peg.3006   Shigella dysenteriae 1617      IQLVKQTSSGLLLPA−−−SCDF−−−−−−−LH−−QIKIGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPVGGAITPRERKLVSGFVDYLCESVGRE−−−HTPALSEAAEQYLNTVATRRTRDTALL−−−−AFREWVTIQAGFYTEHIYPDGSRGGRAKSIAFANMDETEFQQVYKSVLNVLWNWSLFRK−−FSSPEEVENVAAQLLEF  
fig|344610.3.peg.4175   Escherichia coli 53638      LQLVKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKTGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPVGGAITPSEQKLVSGFVEYLCESVGRE−−−HTPALSEAAEQYLNTVATRRTRDTALLKSFEAFREWVTIQAGFYTEHIYPDGSRGRRAKSIAFANMDETEFQQVYKSVLNVLWNWILFRK−−FSSPEEVENVAAQLLEFA 
fig|344610.3.peg.5091   Escherichia coli 53638      IQLVKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKTGEWIHAD−−FKRV−−RNYAFHKRFFRLLQLGFDYWTPIGGAITPRERELVSGFVEYLCESVGRE−−−HTPALSEAAEQYLNTVATRRTRDTALLKSFEAFREWVTIQAGFYTEHIYPDGSRGRRAKSIAFANMDETEFQQVYKSVLNVLWNWILFRK−−FSSPEEVENVAAQLLEFA 
fig|766155.3.peg.3139   Shigella flexneri 1485-80      IQLVKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKTGEWIHAD−−FKRV−−RNYAFHKRFFRLLQLGFDYWTPIGGAITPRERELVSGFVEYLCESVGRE−−−HTPALSEAAEQYLNTVATRRTRDTALLKSFEAFREWVTIQAGFYTEHIYPDGSRGRRAKSIAFANMDETEFQQVYKSVLNVLWNWILFRK−−FSSPEEVENVAAQLLEFA 
fig|344609.3.peg.857   Shigella boydii BS512      IQLIKQTSSGLLLPATPESCDF−−−−−−−LH−−QIKTGEWIHAD−−FKRV−−RNYAFHKRFFKLLQLGFDYWTPIGGAITPRERELVSGFVEYLCESVGRE−−−HTPALSEAAEQYLNTVATRRTRDTALLKSFEAFREWVTIQAGFYTEHIYPDGSRGRRAKSISFANMDETEFQQVYKSVLNVLLNWILFRK−−FSSPEQVENVAAQLLEFA