(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00018825

fig|1156996.3.peg.47   Staphylococcus aureus HI049B                                                                   YLSLKSQITVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVQMGINYS−−−IYMDADTIPVSKNDVEFNVTIG−−NTTTKTTAN−−−−−IQYPDY−−−−−−−−−VVNEKNSIGSAFTETVSHVGNKE−−−−−−−−−−−−−−−NPGYYKQTIYVN−−−−−−−PSENSLTN−−−AKLKVQ−−−−AYHSSYPNNIGQINKDVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−DIKIYQVPKGYTLNKGYD−−−−−VNTKELTDVTNQ−−−−−−−YLQKIT−−−−−−−−−−YGDNNSAVIDF−−−GNAD−−SAYVVMVNTKFQYTNSESPTLVQMATLSST−−−−GN−−−−−−−−−−−KSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|451515.3.peg.610   Staphylococcus aureus subsp. aureus USA300_FPR3757                                                                   YLSLKSQITVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVQMGINYS−−−IYMDADTIPVSKNDVEFNVTIG−−NTTTKTTAN−−−−−IQYPDY−−−−−−−−−VVNEKNSIGSAFTETVSHVGNKE−−−−−−−−−−−−−−−NPGYYKQTIYVN−−−−−−−PSENSLTN−−−AKLKVQ−−−−AYHSSYPNNIGQINKDVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−DIKIYQVPKGYTLNKGYD−−−−−VNTKELTDVTNQ−−−−−−−YLQKIT−−−−−−−−−−YGDNNSAVIDF−−−GNAD−−SAYVVMVNTKFQYTNSESPTLVQMATLSST−−−−GN−−−−−−−−−−−KSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|553567.3.peg.2201   Staphylococcus aureus A5948                                                                   YLSLKSQITVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVQMGINYS−−−IYMDADTIPVSKNDVEFNVTIG−−NTTTKTTAN−−−−−IQYPDY−−−−−−−−−VVNEKNSIGSAFTETVSHVGNKE−−−−−−−−−−−−−−−NPGYYKQTIYVN−−−−−−−PSENSLTN−−−AKLKVQ−−−−AYHSSYPNNIGQINKDVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−DIKIYQVPKGYTLNKGYD−−−−−VNTKELTDVTNQ−−−−−−−YLQKIT−−−−−−−−−−YGDNNSAVIDF−−−GNAD−−SAYVVMVNTKFQYTNSESPTLVQMATLSST−−−−GN−−−−−−−−−−−KSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|553594.3.peg.2801   Staphylococcus aureus A9765                                                                   YLSLKSQITVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVQMGINYS−−−IYMDADTIPVSKNDVEFNVTIG−−NTTTKTTAN−−−−−IQYPDY−−−−−−−−−VVNEKNSIGSAFTETVSHVGNKE−−−−−−−−−−−−−−−NPGYYKQTIYVN−−−−−−−PSENSLTN−−−AKLKVQ−−−−AYHSSYPNNIGQINKDVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−DIKIYQVPKGYTLNKGYD−−−−−VNTKELTDVTNQ−−−−−−−YLQKIT−−−−−−−−−−YGDNNSAVIDF−−−GNAD−−SAYVVMVNTKFQYTNSESPTLVQMATLSST−−−−GN−−−−−−−−−−−KSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|452948.4.peg.2680   Staphylococcus aureus 930918-3                                                                   YLSLKSQITVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVQMGINYS−−−IYMDADTIPVSKNDVEFNVTIG−−NTTTKTTAN−−−−−IQYPDY−−−−−−−−−VVNEKNSIGSAFTETVSHVGNKE−−−−−−−−−−−−−−−NPGYYKQTIYVN−−−−−−−PSENSLTN−−−AKLKVQ−−−−AYHSSYPNNIGQINKDVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−DIKIYQVPKGYTLNKGYD−−−−−VNTKELTDVTNQ−−−−−−−YLQKIT−−−−−−−−−−YGDNNSAVIDF−−−GNAD−−SAYVVMVNTKFQYTNSESPTLVQMATLSST−−−−GN−−−−−−−−−−−KSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|644279.4.peg.635   Staphylococcus aureus subsp. aureus 132                                                                   YLSLKSQITVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVQMGINYS−−−IYMDADTIPVSKNDVEFNVTIG−−NTTTKTTAN−−−−−IQYPDY−−−−−−−−−VVNEKNSIGSAFTETVSHVGNKE−−−−−−−−−−−−−−−NPGYYKQTIYVN−−−−−−−PSENSLTN−−−AKLKVQ−−−−AYHSSYPNNIGQINKDVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−DIKIYQVPKGYTLNKGYD−−−−−VNTKELTDVTNQ−−−−−−−YLQKIT−−−−−−−−−−YGDNNSAVIDF−−−GNAD−−SAYVVMVNTKFQYTNSESPTLVQMATLSST−−−−GN−−−−−−−−−−−KSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|553590.4.peg.1800   Staphylococcus aureus A9754                                                                   YLSLKSQITVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVQMGINYS−−−IYMDADTIPVSKNDVEFNVTIG−−NTTTKTTAN−−−−−IQYPDY−−−−−−−−−VVNEKNSIGSAFTETVSHVGNKE−−−−−−−−−−−−−−−NPGYYKQTIYVN−−−−−−−PSENSLTN−−−AKLKVQ−−−−AYHSSYPNNIGQINKDVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−DIKIYQVPKGYTLNKGYD−−−−−VNTKELTDVTNQ−−−−−−−YLQKIT−−−−−−−−−−YGDNNSAVIDF−−−GNAD−−SAYVVMVNTKFQYTNSESPTLVQMATLSST−−−−GN−−−−−−−−−−−KSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|93062.19.peg.592   Staphylococcus aureus subsp. aureus COL                                                                   YLSLKSQITVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVQMGINYS−−−IYMDADTIPVSKNDVEFNVTIG−−NTTTKTTAN−−−−−IQYPDY−−−−−−−−−VVNEKNSIGSAFTETVSHVGNKE−−−−−−−−−−−−−−−NPGYYKQTIYVN−−−−−−−PSENSLTN−−−AKLKVQ−−−−AYHSSYPNNIGQINKDVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−DIKIYQVPKGYTLNKGYD−−−−−VNTKELTDVTNQ−−−−−−−YLQKIT−−−−−−−−−−YGDNNSAVIDF−−−GNAD−−SAYVVMVNTKFQYTNSESPTLVQMATLSST−−−−GN−−−−−−−−−−−KSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|1028799.3.peg.480   Staphylococcus aureus subsp. aureus VC40                                                                   YLSLKSQITVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVQMGINYS−−−IYMDADTIPVSKNDVEFNVTIG−−NTTTKTTAN−−−−−IQYPDY−−−−−−−−−VVNEKNSIGSAFTETVSHVGNKE−−−−−−−−−−−−−−−NPGYYKQTIYVN−−−−−−−PSENSLTN−−−AKLKVQ−−−−AYHSSYPNNIGQINKDVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−DIKIYQVPKGYTLNKGYD−−−−−VNTKELTDVTNQ−−−−−−−YLQKIT−−−−−−−−−−YGDNNSAVIDF−−−GNAD−−SAYVVMVNTKFQYTNSESPTLVQMATLSST−−−−GN−−−−−−−−−−−KSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|93061.3.peg.531   Staphylococcus aureus subsp. aureus NCTC 8325                                                                   YLSLKSQITVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVQMGINYS−−−IYMDADTIPVSKNDVEFNVTIG−−NTTTKTTAN−−−−−IQYPDY−−−−−−−−−VVNEKNSIGSAFTETVSHVGNKE−−−−−−−−−−−−−−−NPGYYKQTIYVN−−−−−−−PSENSLTN−−−AKLKVQ−−−−AYHSSYPNNIGQINKDVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−DIKIYQVPKGYTLNKGYD−−−−−VNTKELTDVTNQ−−−−−−−YLQKIT−−−−−−−−−−YGDNNSAVIDF−−−GNAD−−SAYVVMVNTKFQYTNSESPTLVQMATLSST−−−−GN−−−−−−−−−−−KSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|904754.3.peg.336   Staphylococcus aureus subsp. aureus 21283                                                                   YLSLKSQITVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVQMGINYS−−−IYMDADTIPVSKNDVEFNVTIG−−NTTTKTTAN−−−−−IQYPDY−−−−−−−−−VVNEKNSIGSAFTETVSHVGNKE−−−−−−−−−−−−−−−NPGYYKQTIYVN−−−−−−−PSENSLTN−−−AKLKVQ−−−−AYHSSYPNNIGQINKDVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−DIKIYQVPKGYTLNKGYD−−−−−VNTKELTDVTNQ−−−−−−−YLQKIT−−−−−−−−−−YGDNNSAVIDF−−−GNAD−−SAYVVMVNTKFQYTNSESPTLVQMATLSST−−−−GN−−−−−−−−−−−KSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|282459.5.peg.542   Staphylococcus aureus subsp. aureus MSSA476                                                                         QIKVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVQMGINYS−−−IYMDADTIPVSKNDVEFNVTIG−−NTTTKTTAN−−−−−IQYPDY−−−−−−−−−VVNEKNSIGSAFTETVSHVGNKE−−−−−−−−−−−−−−−NPGYYKQTIYVN−−−−−−−PSENSLTN−−−AKLKVQ−−−−AYHSSYPNNIGQINKEVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−DIKIYQVPKGYTLNKGYD−−−−−VNTKELTDVTNQ−−−−−−−YLQKIT−−−−−−−−−−YGDNNSAVIDF−−−GNAD−−SAYVVMVNTKFQYTTSESPTLVQMVTLSSN−−−−NS−−−−−−−−−−−KSASMGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|196620.5.peg.546   Staphylococcus aureus subsp. aureus MW2                                                                         QIKVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVQMGINYS−−−IYMDADTIPVSKNDVEFNVTIG−−NTTTKTTAN−−−−−IQYPDY−−−−−−−−−VVNEKNSIGSAFTETVSHVGNKE−−−−−−−−−−−−−−−NPGYYKQTIYIN−−−−−−−PSENSLTN−−−AKLKVQ−−−−AYHSSYPNNIGQINKEVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−DIKIYQVPKGYTLNKGYD−−−−−VNTKELTDVTNQ−−−−−−−YLQKIT−−−−−−−−−−YGDNNSAVIDF−−−GNAD−−SAYVVMVNTKFQYTTSESPTLVQMVTLSSD−−−−NS−−−−−−−−−−−KSASMGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|1231383.3.peg.1476   Staphylococcus aureus KT/314250                                                                         QIKVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVQMGINYS−−−IYMDADTIPVSKNDVEFNVTIG−−NTTTKTTAN−−−−−IQYPDY−−−−−−−−−VVNEKNSIGSAFTETVSHVGNKE−−−−−−−−−−−−−−−NPGYYKQTIYVN−−−−−−−PSENSLTN−−−AKLKVQ−−−−AYHSSYPNNIGQINKEVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−DIKIYQVPKGYTLNKGYD−−−−−VNTKELTDVTNQ−−−−−−−YLQKIT−−−−−−−−−−YGDNNSAVIDF−−−GNAD−−SAYVVMVNTKFQYTTSESPTLVQMVTLSSD−−−−NS−−−−−−−−−−−KSASMGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|553583.3.peg.312   Staphylococcus aureus A9635                                                                   YLALKSQIKVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVQMGINYS−−−IYMDADTIPVSKNDVEFNVTIG−−NDTTKTTAN−−−−−IQYPDY−−−−−−−−−VVNEKNSIGSAFTETVSHVGNKE−−−−−−−−−−−−−−−NPGYYKQTIYVN−−−−−−−PSENSLTN−−−AKLKVQ−−−−AYHSSYPNNIGQINKEVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−DIKIYQVPKGYTLNKGYD−−−−−VNTKELTDVTNQ−−−−−−−YLQKIT−−−−−−−−−−YGDNNSAVIDF−−−GNAD−−SAYVVMVNTKFQYTTSESPTLVQMVTLSSD−−−−NS−−−−−−−−−−−KSASMGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPQGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−VS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPLGYT                                                                                                                                                       
fig|681288.4.peg.515   Staphylococcus aureus subsp. aureus ED98                                                TTLTVVDADNSKTIVPAQDYLSLKSQITVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVKMGINYS−−−IYMDADTIPVDKKDVPFSVTIG−−NQITTTTAD−−−−−ITYPAY−−−−−−−−−KEADNNSIGSAFTETVSHVGNVE−−−−−−−−−−−−−−−DPGYYNQVVYVN−−−−−−−PMDKDLKG−−−AKLKVE−−−−AYHPKYPTNIGQINQNVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−NIKIYRVPEGYTLNKGYD−−−−−VNTNDLVDVTDE−−−−−−−FKNKMT−−−−−−−−−−YGSNQSVNLDF−−−GDIT−−SAYVVMVNTKFQYTNSESPTLVQMATLSST−−−−GN−−−−−−−−−−−KSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKN−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|1158701.3.peg.1550   Staphylococcus aureus M0934                                                TTLTVVDADNSKTIVPAQDYLSLKSQITVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVKMGINYS−−−IYMDADTIPVDKKDVPFSVTIG−−NQITTTTAD−−−−−ITYPAY−−−−−−−−−KEADNNSIGSAFTETVSHVGNVE−−−−−−−−−−−−−−−DPGYYNQVVYVN−−−−−−−PMDKDLKG−−−AKLKVE−−−−AYHPKYPTNIGQINQNVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−NIKIYRVPEGYTLNKGYD−−−−−VNTNDLVDVTDE−−−−−−−FKNKMT−−−−−−−−−−YGSNQSVNLDF−−−GDIT−−SAYVVMVNTKFQYTNSESPTLVQMATLSST−−−−GN−−−−−−−−−−−KSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|1169260.3.peg.494   Staphylococcus aureus M1044                                                TTLTVVDADNSKTIVPAQDYLSLKSQITVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVKMGINYS−−−IYMDADTIPVDKKDVPFSVTIG−−NQITTTTAD−−−−−ITYPAY−−−−−−−−−KEADNNSIGSAFTETVSHVGNVE−−−−−−−−−−−−−−−DPGYYNQVVYVN−−−−−−−PMDKDLKG−−−AKLKVE−−−−AYHPKYPTNIGQINQNVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−NIKIYRVPEGYTLNKGYD−−−−−VNTNDLVDVTDE−−−−−−−FKNKMT−−−−−−−−−−YGSNQSVNLDF−−−GDIT−−SAYVVMVNTKFQYTNSESPTLVQMATLSST−−−−GN−−−−−−−−−−−KSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|553577.3.peg.2153   Staphylococcus aureus A8796                                                TTLTVVDADNSKTIVPAQDYLSLKSQITVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVKMGINYS−−−IYMDADTIPVDKKDVPFSVTIG−−NQITTTTAD−−−−−ITYPAY−−−−−−−−−KEADNNSIGSAFTETVSHVGNVE−−−−−−−−−−−−−−−DPGYYNQVVYVN−−−−−−−PMDKDLKG−−−AKLKVE−−−−AYHPKYPTNIGQINQNVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−NIKIYRVPEGYTLNKGYD−−−−−VNTNDLVDVTDE−−−−−−−FKNKMT−−−−−−−−−−YGSNQSVNLDF−−−GDIT−−SAYVVMVNTKFQYTNSESPTLVQMATLSST−−−−GN−−−−−−−−−−−KSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|889933.4.peg.496   Staphylococcus aureus subsp. aureus ECT-R 2                                                TTLTVVDADNSKTIVPAQDYLSLKSQITVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVKMGINYS−−−IYMDADTIPVDKKDVPFSVTIG−−NQITTTTAD−−−−−ITYPAY−−−−−−−−−KEADNNSIGSAFTETVSHVGNVE−−−−−−−−−−−−−−−DPGYYNQVVYVN−−−−−−−PMDKDLKG−−−AKLKVE−−−−AYHPKYPTNIGQINQNVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−NIKIYRVPEGYTLNKGYD−−−−−VNTNDLVDVTDE−−−−−−−FKNKMT−−−−−−−−−−YGSNQSVNLDF−−−GDIT−−SAYVVMVNTKFQYTNSESPTLVQMATLSST−−−−GN−−−−−−−−−−−KSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|904780.3.peg.1925   Staphylococcus aureus subsp. aureus IS-99                                                TTLTVVDADNSKTIVPAQDYLSLKSQITVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVKMGINYS−−−IYMDADTIPVDKKDVPFSVTIG−−NQITTTTAD−−−−−ITYPAY−−−−−−−−−KEADNNSIGSAFTETVSHVGNVE−−−−−−−−−−−−−−−DPGYYNQVVYVN−−−−−−−PMDKDLKG−−−AKLKVE−−−−AYHPKYPTNIGQINQNVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−NIKIYRVPEGYTLNKGYD−−−−−VNTNDLVDVTDE−−−−−−−FKNKMT−−−−−−−−−−YGSNQSVNLDF−−−GDIT−−SAYVVMVNTKFQYTNSESPTLVQMATLSST−−−−GN−−−−−−−−−−−KSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|418127.6.peg.565   Staphylococcus aureus subsp. aureus Mu3                                                TTLTVVDADNSKTIVPAQDYLSLKSQITVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVKMGINYS−−−IYMDADTIPVDKKDVPFSVTIG−−NQITTTTAD−−−−−ITYPAY−−−−−−−−−KEADNNSIGSAFTETVSHVGNVE−−−−−−−−−−−−−−−DPGYYNQVVYVN−−−−−−−PMDKDLKG−−−AKLKVE−−−−AYHPKYPTNIGQINQNVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−NIKIYRVPEGYTLNKGYD−−−−−VNTNDLVDVTDE−−−−−−−FKNKMT−−−−−−−−−−YGSNQSVNLDF−−−GDIT−−SAYVVMVNTKFQYTNSESPTLVQMATLSST−−−−GN−−−−−−−−−−−KSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|553596.3.peg.2265   Staphylococcus aureus A9781                                                TTLTVVDADNSKTIVPAQDYLSLKSQITVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVKMGINYS−−−IYMDADTIPVDKKDVPFSVTIG−−NQITTTTAD−−−−−ITYPAY−−−−−−−−−KEADNNSIGSAFTETVSHVGNVE−−−−−−−−−−−−−−−DPGYYNQVVYVN−−−−−−−PMDKDLKG−−−AKLKVE−−−−AYHPKYPTNIGQINQNVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−NIKIYRVPEGYTLNKGYD−−−−−VNTNDLVDVTDE−−−−−−−FKNKMT−−−−−−−−−−YGSNQSVNLDF−−−GDIT−−SAYVVMVNTKFQYTNSESPTLVQMATLSST−−−−GN−−−−−−−−−−−KSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|553573.3.peg.189   Staphylococcus aureus A8115                                                TTLTVVDADNSKTIVPAQDYLSLKSQITVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVKMGINYS−−−IYMDADTIPVDKKDVPFSVTIG−−NQITTTTAD−−−−−ITYPAY−−−−−−−−−KEADNNSIGSAFTETVSHVGNVE−−−−−−−−−−−−−−−DPGYYNQVVYVN−−−−−−−PMDKDLKG−−−AKLKVE−−−−AYHPKYPTNIGQINQNVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−NIKIYRVPEGYTLNKGYD−−−−−VNTNDLVDVTDE−−−−−−−FKNKMT−−−−−−−−−−YGSNQSVNLDF−−−GDIT−−SAYVVMVNTKFQYTNSESPTLVQMATLSST−−−−GN−−−−−−−−−−−KSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|359787.11.peg.627   Staphylococcus aureus subsp. aureus JH1                                                TTLTVVDADNSKTIVPAQDYLSLKSQITVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVKMGINYS−−−IYMDADTIPVDKKDVPFSVTIG−−NQITTTTAD−−−−−ITYPAY−−−−−−−−−KEADNNSIGSAFTETVSHVGNVE−−−−−−−−−−−−−−−DPGYYNQVVYVN−−−−−−−PMDKDLKG−−−AKLKVE−−−−AYHPKYPTNIGQINQNVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−NIKIYRVPEGYTLNKGYD−−−−−VNTNDLVDVTDE−−−−−−−FKNKMT−−−−−−−−−−YGSNQSVNLDF−−−GDIT−−SAYVVMVNTKFQYTNSESPTLVQMATLSST−−−−GN−−−−−−−−−−−KSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|1158694.3.peg.1173   Staphylococcus aureus M0719                                                TTLTVVDADNSKTIVPAQDYLSLKSQITVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVKMGINYS−−−IYMDADTIPVDKKDVPFSVTIG−−NQITTTTAD−−−−−ITYPAY−−−−−−−−−KEADNNSIGSAFTETVSHVGNVE−−−−−−−−−−−−−−−DPGYYNQVVYVN−−−−−−−PMDKDLKG−−−AKLKVE−−−−AYHPKYPTNIGQINQNVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−NIKIYRVPEGYTLNKGYD−−−−−VNTNDLVDVTDE−−−−−−−FKNKMT−−−−−−−−−−YGSNQSVNLDF−−−GDIT−−SAYVVMVNTKFQYTNSESPTLVQMATLSST−−−−GN−−−−−−−−−−−KSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|158879.1.peg.534   Staphylococcus aureus subsp. aureus N315                                                TTLTVVDADNSKTIVPAQDYLSLKSQITVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVKMGINYS−−−IYMDADTIPVDKKDVPFSVTIG−−NQITTTTAD−−−−−ITYPAY−−−−−−−−−KEADNNSIGSAFTETVSHVGNVE−−−−−−−−−−−−−−−DPGYYNQVVYVN−−−−−−−PMDKDLKG−−−AKLKVE−−−−AYHPKYPTNIGQINQNVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−NIKIYRVPEGYTLNKGYD−−−−−VNTNDLVDVTDE−−−−−−−FKNKMT−−−−−−−−−−YGSNQSVNLDF−−−GDIT−−SAYVVMVNTKFQYTNSESPTLVQMATLSST−−−−GN−−−−−−−−−−−KSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|904750.3.peg.96   Staphylococcus aureus subsp. aureus 21272                                                TTLTVVDADNSKTIVPAQDYLSLKSQITVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVKMGINYS−−−IYMDADTIPVDKKDVPFSVTIG−−NQITTTTAD−−−−−ITYPAY−−−−−−−−−KEADNNSIGSAFTETVSHVGNVE−−−−−−−−−−−−−−−DPGYYNQVVYVN−−−−−−−PMDKDLKG−−−AKLKVE−−−−AYHPKYPTNIGQINQNVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−NIKIYRVPEGYTLNKGYD−−−−−VNTNDLVDVTDE−−−−−−−FKNKMT−−−−−−−−−−YGSNQSVNLDF−−−GDIT−−SAYVVMVNTKFQYTNSESPTLVQMATLSST−−−−GN−−−−−−−−−−−KSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−ELG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGVGNVTVT−−−VFDNN−−−−−−−−−−−−−TNTKVGEAVTKEDGSYLIPN−−−LP−−−−−NGDYRVEFSNLPKGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−LS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|585148.3.peg.88   Staphylococcus aureus subsp. aureus Btn1260                                                                   YLALKSQIKVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVQMGINYS−−−IYMDADTIPVSKNDVEFNVTIG−−NDTTKTTAN−−−−−IQYPDY−−−−−−−−−VSRDNNSIGSAFTETVSHAGNAE−−−−−−−−−−−−−−−DPGYYKQTVYVN−−−−−−−PSEKSLTN−−−AKLKVE−−−−AYHKDYPDNVGQINKDVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−KIKIYQAPKDYVLNKGYD−−−−−VNTNQLIDVTEQ−−−−−−−FKDKIT−−−−−−−−−−YGANDSVNVDF−−−GSIN−−NSYVVMVDTKFEYTTSESPTLVQMATLTSD−−−−GN−−−−−−−−−−−RSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−DLG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EVGVKGVTVV−−−AYDNK−−−−−−−−−−−−−TNKEVGRTITDDKGGYLIPN−−−LP−−−−−NGDYRVEFSNLPQGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−VS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|585154.3.peg.524   Staphylococcus aureus subsp. aureus EMRSA16                                                                   YLALKSQIKVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVQMGINYS−−−IYMDADTIPVSKNDVEFNVTIG−−NDTTKTTAN−−−−−IQYPDY−−−−−−−−−VSRDNNSIGSAFTETVSHAGNAE−−−−−−−−−−−−−−−DPGYYKQTVYVN−−−−−−−PSEKSLTN−−−AKLKVE−−−−AYHKDYPDNVGQINKDVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−KIKIYQAPKDYVLNKGYD−−−−−VNTNQLIDVTEQ−−−−−−−FKDKIT−−−−−−−−−−YGANDSVNVDF−−−GSIN−−NSYVVMVDTKFEYTTSESPTLVQMATLTSD−−−−GN−−−−−−−−−−−RSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−DLG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EVGVKGVTVV−−−AYDNK−−−−−−−−−−−−−TNKEVGRTITDDKGGYLIPN−−−LP−−−−−NGDYRVEFSNLPQGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−VS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|585159.3.peg.678   Staphylococcus aureus subsp. aureus M899                                                                   YLALKSQIKVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVQMGINYS−−−IYMDADTIPVSKNDVEFNVTIG−−NDTTKTTAN−−−−−IQYPDY−−−−−−−−−VSRDNNSIGSAFTETVSHAGNAE−−−−−−−−−−−−−−−DPGYYKQTVYVN−−−−−−−PSEKSLTN−−−AKLKVE−−−−AYHKDYPDNVGQINKDVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−KIKIYQAPKDYVLNKGYD−−−−−VNTNQLIDVTEQ−−−−−−−FKDKIT−−−−−−−−−−YGANDSVNVDF−−−GSIN−−NSYVVMVDTKFEYTTSESPTLVQMATLTSD−−−−GN−−−−−−−−−−−RSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−DLG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EVGVKGVTVV−−−AYDNK−−−−−−−−−−−−−TNKEVGRTITDDKGGYLIPN−−−LP−−−−−NGDYRVEFSNLPQGYEV−−−−TPSKQGNNEELDSN−−−−−−−−−−−−−G−−−−−−−−VS−−−−SVITVNGKD−−−−−NLSADLGIYKPKYNLGDYVWEDTNKNGIQDQ−−−−−−−−−−−−DEKGISGVTVTLKDE−−−−−NGNVLKTVTTDA−−−−−−−−−−−−−−−−−−−−DGKYKFTDLDNGN−−−−−−−−YKVEFTTPE−−−−−−−−−−−−−−−GYTPTTVTSG−−S−−−−−−−DIEKDSN−−−GL−−−T−−TTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKD−−GKQDSTEKGISGVTV−−−TLKNENGEVL−−−−−−QTT−−−−−−−−−−−−−−−KT−−−DKDGKYQFTGL−−−−−−−−−−−−ENGTYKVEFETPSGYT                                                                                                                                                       
fig|585144.3.peg.1434   Staphylococcus aureus subsp. aureus 58-424                                                                   YLALKSQIKVDDK−−−VKSGDYFTIKYSDTVQVYGLN−−−−−−−PEDIKNIGDIKDPNNGETIATAKH−−−−−−−−DTANNL−−ITYTF−−−TDY−−VDRFNSVQMGINYS−−−IYMDADTIPVSKNDVEFNVTIG−−NDTTKTTAN−−−−−IQYPDY−−−−−−−−−VSRDNNSIGSAFTETVSHAGNAE−−−−−−−−−−−−−−−DPGYYKQTVYVN−−−−−−−PSEKSLTN−−−AKLKVE−−−−AYHKDYPDNVGQINKDVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−KIKIYQAPKDYVLNKGYD−−−−−VNTNQLIDVTEQ−−−−−−−FKDKIT−−−−−−−−−−YGANDSVNVDF−−−GSIN−−NSYVVMVDTKFEYTTSESPTLVQMATLTSD−−−−GN−−−−−−−−−−−RSVSTGNALGFTN−−−−−−−−−NQSGGAGQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYKIGNYVWE−−−DTNKNGVQ−−DLG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EVGVKGVTVV−−−AYDNK−−−−−−−−−−−−−TNKEVGRTITDDKGGYLIPN−−−LP−−−−−NGDYRVEFSNLPQGYEV−−−−TPSKQGNNEELD