(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00018670

fig|1158657.3.peg.2801   Enterococcus faecalis Ned10          FTEKEFAAFEVAGLDERMAVIRAQIQPIFQELDTYFAEQLAPELGTELFVHIAQHRRRTVYPPENTWSALSPNKRGYKMQPHFQLGIWGDYVFMWLSFIDNPK−−NEKQIAQAFLENQQLFQALPEDTYVSLDHTVPQITPLPET−−−DLEKALTRFRDV−−−KKGEFEIGRIIPKDSALWQNPEKARAYMLETYQQLLPLYQLAV 
fig|565640.5.peg.152   Enterococcus faecalis T11          FTEKEFAAFEVAGLDERMAVIRAQIQPIFQELDTYFAEQLAPELGTELFVHIAQHRRRTVYPPENTWSALSPNKRGYKMQPHFQLGIWGDYVFMWLSFIDNPK−−NEKQIAQAFLENQQLFQALPEDTYVSLDHTVPQITPLTET−−−DLEKALTRFRDV−−−KKGEFEIGRIIPKDSALWQNPEKARAYMLSTYQQLLPLYQLAV 
fig|565651.6.peg.1255   Enterococcus faecalis AR01/DG          FTEKEFAAFEVAGLDERMAVIRAQIQPIFQELDTYFAEQLAPELGTELFVHIAQHRRRTVYPPKNTWSALSPNKRGYKMQPHFQLGIWGDYVFMWLSFIDNPK−−NEKQIAQAFLENQQLFQALPEDTYVSLDHTVPQITPLPET−−−DLEKALTRFRDV−−−KKGEFEIGRIIPKDSALWQNPEKARAYMLATYQQLLPLYQLAV 
fig|1151202.3.peg.1655   Enterococcus faecalis 7330259-5          FTEKEFAAFEVAGLDERMAVIRAQIQPIFQELDTYFAEQLAPELGTELFVHIAQHRRRTVYPPENTWSALSPNKRGYKMQPHFQLGIWGDYVFMWLSFIDNPK−−NEKQIAQAFLENQQLFQALPEDTYVSLDHTVPQITPLPET−−−DLEKALTRFRDV−−−KKGEFEIGRIIPKDSALWQTPEKARAYMLATYQQLLPLYQLAV 
fig|1134799.3.peg.1974   Enterococcus faecalis ERV85          FTEKEFAAFEVAGLDERMAVIRAQIQPIFQELDTYFAEQLAPELGTELFVHIAQHRRRTVYPPENTWSALSPNKRGYKMQPHFQLGIWGDYVFMWLSFIDNPK−−NEKQIAQAFLENQPLFQALPEDTYVSLDHTVPQITPLPDT−−−DLEKALTRFRDV−−−KKGEFEIGRIIPKDSALWQSPEKARAYMLATYQQLLPLYQLAV 
fig|565647.5.peg.208   Enterococcus faecalis E1Sol          FTEKEFAAFEVAGLDERMAVIRAQIQPIFQELDTYFAEQLAPELGTELFVHIAQHRRRTVYPPENTWSALSPNKRGYKMQPHFQLGIWGDYVFMWLSFIDNPK−−NEKQIAQAFLENQQLFQALPEDTYVSLDHTVPQITPLPDT−−−DLEKALTRFRDV−−−KKGEFEIGRIIPKDSDLWQNPEKARAYMLATYQQLLPLYQLAV 
fig|1169249.3.peg.2646   Enterococcus faecalis Merz204          FTEKEFAAFEVAGLDERMAVIRAQIQPIFQELDTYFAEQLAPELGTELFVHIAQHRRRTVYPPENTWSALSPNKRGYKMQPHFQLGIWGDYVFMWLSFIDNPK−−NEKQIAQAFLENQQLFQALPEDTYVSLDHTVPQITPLPET−−−DLEKALTRFRDV−−−KKGEFEIGRIIPKDSDLWQNPEKARAYMLATYQQLLPLYQLAV 
fig|1169289.3.peg.2409   Enterococcus faecalis RMC5          FTEKEFAAFEVAGLDERMAVIRAQIQPIFQELDTYFAEQLAPELGTELFVHIAQHRRRTVYPPENTWSALSPNKRGYKMQPHFQLGIWGDYVFMWLSFIDNPK−−NEKQIAQAFLENQQLFQALPEDTYVSLDHTVSQITPLPET−−−DLEKALTRFRDV−−−KKGEFEIGRIIPKDSDLWQNPEKARAYMLATYQQLLPLYQLAI 
fig|565638.4.peg.188   Enterococcus faecalis T3          FTEKEFAAFEVAGLDERMAVIRAQIQPIFQELDTYFAEQLAPELGTELFVHIAQHRRRTVYPPENTWSALSPNKRGYKMQPHFQLGIWGDYVFMWLSFIDNPK−−NEKQIAQAFLDNQQLFQALPEDTYVSLDHTVPQITPLPET−−−DLEKALTRFRDV−−−KKGEFEIGRIIPKDSDLWQNPEKARAYMLATYQQLLPLYQLAV 
fig|936153.3.peg.152   Enterococcus faecalis 62          FTEKEFAAFEVAGLDERMAVIRAQIQPIFQELDTYFAEQLAPELGTELFVHIAQHRRRTVYPPENTWSALSPNKRGYKMQPHFQLGIWGDYVFMWLSFIDNPK−−NEKQIAQAFLENQQLFQALPEDTYVSLDHTVPQITPLMET−−−DLEKALTRFRDV−−−KKGEFEIGRIIPKDSDLWQNPEKARAYMLATYQQLLPLYQLAV 
fig|1027372.3.peg.1450   Enterococcus faecalis OG1X          FTEKEFAAFEVAGLDERMAVIRAQIQPIFKELDTYFAEQLAPELGTALFVHIAQHRRRTVYPPENTWSALSPNKRGYKMQPHFQLGIWGDYVFMWLSFIDNPK−−NEKQIAQAFLENQQLFQALPEDTYVSLDHTVPQITPLMET−−−DLEKALTRFRDV−−−KKGEFEIGRIIPKDSVLWQNPEKARAYMLATYQQLLPLYQLAV 
fig|565641.4.peg.175   Enterococcus faecalis X98          FTEKEFAAFEVAGLDERMAVIRAQIQPIFKELGTYFAEQLAPELGTALFVHIAQHRRRTVYPPENTWSALSPNKRGYKMQPHFQLGIWGDYVFMWLSFIDNPK−−NEKQIAQAFLENQQLFQALPEDTYVSLDHTVPQITPLMET−−−DLEKALTRFRDV−−−KKGEFEIGRIIPKDSVLWQNPEKARAYMLETYQQLLPLYQLAV 
fig|565655.4.peg.1863   Enterococcus casseliflavus EC20          FTKQSFDAFSLETLDERMEKIRAEIQPIFQTIGEAAIPLIEESCQEPFYLHIAQHRRRTVYPPAETWAGIGPNKRGYKMDAHFQIGINQAYVFVWLSVIDQPK−−NQATIAESWLAQKELFDQLPADFTLSPDHTKYDHYPIA−−−−−MWPTYLERLKKV−−−KKSELQIGKIFPKEMIEDVE−−−−MADILAVYQTLLPLYHARM 
fig|565652.4.peg.2840   Enterococcus casseliflavus EC30          FTKQSFDAFSLETLDERMEKIRAEIQPIFQTIGEAAIPLIEESCQEPFYLHIAQHRRRTVYPPAETWAGIGPNKRGYKMDAHFQIGINQAYVFVWLSVIDQPK−−NQATIAESWLAQKELFDQLPADFTLSPDHTKYDHHPIA−−−−−MWPTYLERLKKV−−−KKSELQIGKIFLKEMIEDVE−−−−MADILAVYQTLLPLYHARM 
fig|565653.4.peg.1392   Enterococcus gallinarum EG2          FTNKSFHVFQASSLEERMQEIRKEIQPIFQQIGEKVCPFFTEKLDTPFYLHIAQHRRRSVYPPEETWAAFGPNKRGYKMDAHFQIGITREYAFVWLSVIDQPK−−NQQQIARCWSEKPALFETLPQDFVLSLDHTQYGYQPIR−−−−−EWPAALERLTTV−−−KKSELQIGKVYLKDQISTLT−−−−MEQLLADYRLLLPLYR    
fig|272623.7.peg.1880   Lactococcus lactis subsp. lactis Il1403          FTQKSFEIFKIEGLEPRMTEIRSEIQPVFSEIGQKLLTELSVKIPNQEFYFHIAQHRRRTANAPENTWSAISTKVRGYKMEAHFQLGIWEDYVFIYLSMIDQPK−−KQKEYANLLTSLSVEKLLTEDFVISKDHTKAETYPLS−−−−−AFREAAERLGKV−−−KKSELEIGRVWPKERFNSKEDSIILAEMIETIDQLLPIYQKLME
fig|684738.3.peg.1936   Lactococcus lactis subsp. lactis KF147          FTQKSFEIFKIEGLEPRMTEIRSEIQPVFSEIGQKLLTELSVKIPNQEFYFHIAQHRRRTANAPENTWSAISTKARGYKMEAHFQLGIWEDYVFIYLSMIDQPK−−KQKEYANLLTNLSVEKLLTEDFVISKDHTKAETYPLS−−−−−AFREAAERLGKV−−−KKSELEIGRLWPKERFNGKEDSIILAEMIETIDQLLPIYQKLME
fig|416870.7.peg.1939   Lactococcus lactis subsp. cremoris MG1363          FTQKSFEIFSIDGLEARMAEIRSEIQPVFSEIGQKLLTELSAKISNQEFYFHIAQHRRRTANAPENTWSAISTKARGYKMEAHFQLGIWEDYVFIYLSMIDQPK−−KQKEYAELLTNLSVEKMLTEDFIISKDHTKAEVFPLS−−−−−AFSEAAERLGKV−−−KKSELEIGRLWPKERFDGKEDSKILAEMLETIDQLLPIYQKLME
fig|416870.9.peg.1985   Lactococcus lactis subsp. cremoris MG1363                           MAEIRSEIQPVFSEIGQKLLTELSAKISNQEFYFHIAQHRRRTANAPENTWSAISTKARGYKMEAHFQLGIWEDYVFIYLSMIDQPK−−KQKEYAELLTNLSVEKMLTEDFIISKDHTKAEVFPLS−−−−−AFSEAAERLGKV−−−KKSELEIGRLWPKERFDGKEDSKILAEMLETIDQLLPIYQKLME
fig|272622.8.peg.2065   Lactococcus lactis subsp. cremoris SK11          FTQNHFEIFSIDGLEARMAEIRSEIQPVFSEIGQKLLTKLSAKISNQEFYFHIAQHRRRTANAPENTWSAISTKARGYKMEAHFQLGIWEDYVFIYLSMIDQPK−−KQKEYAELLTNLSVEKMLTEDFIISKDHTKAEVFPLS−−−−−AFSEAAERLGKV−−−KKSELEIGRLWSKERFDGKEDSKILAEMLETIDQLLPIYQKLME
fig|333990.5.peg.1848   Carnobacterium sp. AT7     MKNCTFTKEDFAVFAIEGLEPRMSAIRKQIQPKFRILGQEFAKALAIELNKDSLPVHIAQHIRRTKNAPKDTWMAIGGDSRGYKKYPHFQLGIYETHLFIWLAFIDNPL−−HEEKMALQIIEDPSLLAKVPDDYVVSWDHTKESVVPVREA−−−NLLNGLIRWQTV−−−KKGEFLIGRQILANDPLLLDPEMTQRYILDTFMQLVPLYKQAY 
fig|314315.12.peg.815   Lactobacillus sakei subsp. sakei 23K          FTRADFEIFDDPTLKGRLNKIYTELDPKFEVFGAQLQNELAVATNREFTLHIAKHLRRFKNPPMNTWMALSESSRGYKMMPHFEVGFGDDRIFVWFALMAEMP−−DKTDYAPLLASQSEKLLSDFTDYDLSYDHMTKQKFPMSPD−−−NLQLIQDKFAKT−−−KKGEWLLGKVYLKDNPLFDHPEELMADIQTTLLKMVPLYEL   
fig|203120.7.peg.496   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293          FRNSDFDIFEDKTLNGRMEKIRTIIDPKFEEFASIALPILNTNGQEWYAHVAKHLRRTTYAPDNTWVAFAPNKRGYKMLPHFELGIWEDNVYFYLAVEENMKPDQTNVITQKLREVSPLVRELPDSYRLSQDHMVNKTYSLL−−−−−QYDDSIERYESV−−−KHSEVLIGVEIKRGDKLWDGDGIVDTLVLAMKNLLPIYE    
fig|762051.3.peg.1495   Leuconostoc kimchii IMSNU11154          FQDDDFNIFSVETLDERMQLIREKIGPKFEQSAAAILPVLNESGQQWYAHIAKHLRRTTNAPDNTWVAFAPNKRGYKMMPHFELGIWADRIYFYLAVEENMKPNDTQSIVTKMNAARDLIRSLPSDFVLSADHMINMSQSSNIQ−−−AYDDMVTRYHQV−−−KHSEVLIG                                     
fig|349519.10.peg.1502   Leuconostoc citreum KM20          FKQEDFKVFDEQTLDGRMQGIRSVIDPKFEQLAKVILPLLSEDGQAWYAHIAKHLRRTTNPPENTWVAFAPNKRGYKMMPHYEVGMWDDHVYIYLAVEENMKPVSTQKIVAQMTKARELVARLPATFTLSQDHMVNKTEPLTLT−−−HYDLAVQKFAET−−−KHSEVLIGLQIMKSDYETLSFEDTNHIMATFKALRAIYEI   
fig|644042.3.peg.1961   Lactobacillus plantarum JDM1          FTNQDFEIFNDQTLAGRMHLIKTVIDPKFEQVAPTIIASLQTPSEPPFYAHVAKHLRRFKNPPVDTWVAFSQNKRSYKAWPHFELGLWPDRLFIYFDILDECK−−PAVQAKMQLADLTPLLKALPAGYVISNNHGVPATQLATPA−−−NITQAIKKFDQY−−−KHSELVVGRAVLVGDPLFEDADTLNKLIITTFKQLLSIYQPVM 
fig|220668.9.peg.1971   Lactobacillus plantarum WCFS1          FTNQDFEIFNDQTLAGRMHLIKTVIDPKFEQVAPTIITSLQTPGEPPFYAHVAKHLRRFKNPPVDTWVAFSQNKRSYKAWPHFELGLWPDRLFIYFDILDECK−−PAVQAKMQLADLTPLLKALPAGYVISNNHGVPATQLATPA−−−NITQAIKKFNQY−−−KHSELVVGRAVLVGDPLFENADTLNKLIIATFKQLLSIYQPVM 
fig|1001583.3.peg.796   Lactobacillus brevis KB290          YQDQDFQVFEDQTLAGRLGKIQKQIDPKFLITAGDLEPVLAELSVPIYQHVSQHRRRTKNPPTDTWIAFSTSKRGYKMLPHLEIGFWDDRFFIWLAVLQEAK−−NRQGLLGQV−−QLADVLNLPSTFECGNDHADKNCGRPLTL−−−TNYQALMREQVN−−−RHAEWQLGRNFMRGSDLFTTTPDDQAAIIRDTVAALLPIYRQLI 
fig|387344.13.peg.1193   Lactobacillus brevis ATCC 367          YQDQDFQVFEDQTLAGRLGKIQKQIDPKFLITAGDLEPVLAELSVPIYQHVSQHRRRTKNPPTDTWIAFSTSKRGYKMLPHLEIGFWDDRFFIWLAVLQEAK−−NRQGLLGQV−−QLADVLNLPSTFECGNDHADKNCGRPLTL−−−TNYQALMREQVN−−−RHAEWQLGRNFMRGSDLFTTTPDDQAAIIRDTVAALLPIYRQLI 
fig|568703.9.peg.1137   Lactobacillus rhamnosus GG          FTSDDFAVFAAPTLSARMALIRQQLDPKFTQAAQSIVPLLQTPNQPIFAHIAQHRRRHKNPPPNTWVAFSTSRRGYKMLPHLALGFWDDRLFLWLSCLRESK−−PVLN−−−DFSGITGVISTLPDSWLLASEHTAKATVPLTAA−−−SLAQTIERFETV−−−KSAEFLVGWVYLASDPLLQTPDKLWLDIQQRVRTLAPVFARLVQ
fig|486408.6.peg.689   Lactobacillus rhamnosus HN001          FTSNDFAVFAAPTLSARMALIRQQLDPKFTQAAQSIVPVLQTPNQPIFAHIAQHRRRHKNPPPNTWVAFSTSRRGYKMLPHLALGFWDDRLFLWLSCLRESK−−PVPN−−−GFSGITDVISTLPDSWLLASEHTAKATVPLTAA−−−SLAQTIERFETV−−−KSAEFLVGWVYLASDPLWQTPDKLWLDIQQRVRTLAPVFARLVQ
fig|1078018.5.peg.307   Lactobacillus rhamnosus CASL          FTSDDFAVFAAPTLSARMALIRQQLDPKFTQAAQSIVPLLQTPNQPIFAHIAQHRRRHKNPPPNTWVAFSTSRRGYKMLPHLALGFWDDRLFLWLSCLRESK−−PVPN−−−DFSGITDVISTLPDSWLLASEHTSKATVPLTAA−−−SLAQTIERFETV−−−KSAEFLVGWVYLASDPLWQIPDKLWLDIQQRVRTLAPVFARLVQ
fig|537973.8.peg.298   Lactobacillus paracasei subsp. paracasei 8700:2          FTLEDFAVFKATTLATRMHLIREQLDPKFAEAATVIVPLLQTDQQAIYSHIAKHQRRYRNPPPNTWVAFSTSSRGYKMVPHLALGFWDDRLFLWLSVLRESK−−PASR−−−VLTGITAMATTLPGKWQVAGEHTDKAMLPLTSA−−−NLATVRARFQTI−−−KKAEFLLGKVYLADDPIWADPVRLWQDIQQRVVALKPMFDQLVQ
fig|1256213.3.peg.2680   Lactobacillus paracasei subsp. paracasei Lpp49          FTLEDFAVFKATTLATRMHLIREQLDPKFAEAATVIVPLLQTDQQAIYSHIAKHQRRYRNPPPNTWVAFSTSSRGYKMVPHLALGFWDDRLFLWLSVLRESK−−PASR−−−VLTGITAMATTLPGKWQVAGEHTDKAMLPLTSA−−−NLATVGARFQTI−−−KKAEFLLGKVYLADDPIWADPVRLWQDIQQRVVALKPMFDQLVQ
fig|1051659.3.peg.1285   Lactobacillus casei UCD174          FTLEDFAVFKATTLATRMHLIREQLDPKFAEAATVIVPLLQTDQQQAIYSHIAKHQRRYRNPPPNTWVAFSTSSRGYKMVPHLALGFWDDRLFLWLSVLRESK−−PASR−−−VLTGITAMATTLPGKWQVAGEHTDKAMLPLTSA−−−NLATVGARFQTI−−−KKAEFLLGKVYLADDPIWADPVRLWQDIQQRVVALKPMFDQLVQ
fig|262543.4.peg.2530   Exiguobacterium sibiricum 255-15        THFTKEAFDTFEIEGLEQRMDAIRERIQPVFKQIGQEVSPDLTVNLAEDMYVHIAQHARRKVNPPKDTWMAFSPNKRGYKKHPHFQVGLFDDHLFIWLAYIYELP−−NKSQYATKLLNHQELLHALPSDFVVSYDHMKKEAQQIDET−−−GLEQGLVRFRDV−−−KKAEFLVGRHVSAEEVSAMSHEDLVKLIRNTYEQLVPIYK    
fig|262543.8.peg.2564   Exiguobacterium sibiricum 255-15     MTTHFTKEAFDTFEIEGLEQRMDAIRERIQPVFKQIGQEVSPDLTVNLAEDMYVHIAQHARRKVNPPKDTWMAFSPNKRGYKKHPHFQVGLFDDHLFIWLAYIYELP−−NKSQYATKLLNHQELLHALPSDFVVSYDHMKKEAQQIDET−−−GLEQGLVRFRDV−−−KKAEFLVGRHVSAEEVSAMSHEDLVKLIRNTYEQLVPIYK    
fig|360911.3.peg.602   Exiguobacterium sp. AT1b          FTTKQFNVFKQDGLDERMSGIRSDIQPLFHRIYDEVGPELEADVGIPLYLHVAKHARRTVNPPKDTWMAICHDKRGYKKHPHLQVGLFDDRVFIWLAFIYEMP−−NKDAIAKHLQQIDLKSTFPDFHIAGDHMKKEALLVEDTSTEDIQSLLERFGTV−−−KKADFLIGRQLPADASILQNEDAFLALVEDTFGRLTPLYRDLV 
fig|649639.3.peg.719   Bacillus cellulosilyticus DSM 2522     MSFTGFSQKDFDTFQIDGLDERMSAIQERIQPKFKAISEEIINDLSDMVGHEMFLHVAKHARRKVNPPKDTWSAYCHNKRGYKKHPHFQIGVFDDHMFIWLAYIYELP−−NKAEIATALLDNIDSIIENIPNDYVLSLDHMEKKAESLQTI−−−DLTGALERFRDV−−−KKGEFLIGRHISANDPLLQDGDKLIAYIRDTFQTLTPIYKISMR
fig|439292.5.peg.1715   Bacillus selenitireducens MLS10     MAFTGFNETDFETFSIEGLDERMTAIQERIQPKFKALSDSIIPELESITGSDMHLHVARHARRKVNPPQDTWSAYCHNKRGYKKHPHFQIGLFDDHVFIWLAHIYELP−−HKEDIADRFIENKSSILETLPGDFDISMDHMKKPSQKVSEI−−−DLDDTLKRFKEV−−−KKGEFLVGRKIDSADPLLKDSEAFIKTVIDTFQTVAPLYKIAMR
fig|221109.4.peg.1447   Oceanobacillus iheyensis HTE831        NGFTNKDFETFNINGLDERMEAIQTRIQPKFQQIGESLAEDLSKKTNNELYLHIAKHARRTVNPPNDTWLAIADNKRGYKKHPHFQVGVFDDHVFIWLALIYELP−−NKSKIASAYINHFDEVKNLPTSYVVSLDHTKKDAISLTDLNK−−−−SHLERFRDV−−−KKAEFLIGKHIEKGDPILANGDELYQFIMDVFEQLLPLYQLAI 
fig|324057.4.peg.3794   Paenibacillus sp. JDR-2      AFTGFEQMDFDTFLIEGLEQRMAAIEERIRPKFRYLGEKLAGDIAVQAGDEMFLHIAKHARRTVNPPKDTWLAICNNKRGYKAHPHFQLGLFDDHLFLWFALIYEAP−−NKSKIASIYLDHLDEVIAAVPSDYALSLDHMKKESKSVSEMNKQDWINALTRLRDV−−−QKAELLIGRHLPAGDPLLHDGDALYKLAQDTYETLMPLYRLAAQ
fig|66692.6.peg.2565   Bacillus clausii KSM-K16     MPLPGFTKSDFETFLIDGLEERMAAIRSNIQPKFQVIGAELRDELSTLLGNEMFLHIAQHARRTTNPPNDTWLAVAGNKRGYKKHPHFQVGLFDDHLFIWLAFIYELP−−EKGNIAKTFLENKPLIEEVVPSDYVVSIDHTKKEANPLSEL−−−DLTQSLERFRDV−−−KKAEWLVGRHFAKGSETVENGEQLMEAIRQTVKTLLPLYQLSL 
fig|525367.9.peg.66   Listeria grayi DSM 20601     MTFKGFTNDDFKAMQLPGLDNRMEAIRQNIQPKFQTLGDELTSFLEKELAVPMYLHIAKHARRSVNPPDSTWLAIGHDKRGYKKHPHFQVGLYDEYLFVWLAFIYENE−−ERTFIADNYLKSEADFLALPADFSISPDHTERKTFPLEQA−−−ALEKTLRRFRDV−−−KKGEFLIGKIYQPTDKKIHSGSACTEEIKSVLTKLLPFYKDAFQ
fig|683837.3.peg.955   Listeria seeligeri serovar 1/2b str. SLCC3954     MTFTGFTKQDFKTMQIPGLEARMAGIQNDIQPKFRAVGAELTTYLSTKLGDEMFLHIARHQRRSVNPPESTWLAICHDKRGYKKHPHFQVGLFDNYLFIWLAFIYENE−−QSAKIANRFLKEKKLFADLPDSFAISPDHTEEKTYPVHNG−−−ELVPTLERFRDV−−−KKGEFLVGKIFLPDDTALTSGKSFLKEAETVLDELIPFYKASLQ
fig|393123.3.peg.563   Listeria monocytogenes FSL N1-017     MTFKGFSKKDFKTMQIPGLEARMSGIQTDIQPKFRAIGEELTTYLSAKLGDEMFLHIARHQRRSVNPPESTWLAICHDKRGYKKHPHFQVGLFDNYLFIWLAFIYENE−−ESKKIANRFLKEKKLLAALPDNFAISPDHTEEKTYPVHDG−−−QLKATLERFRDV−−−KKGEFLVGKIYLPDDSHLSPGKDFIKEAEMVLDELIPLYKASLQ
fig|1030009.3.peg.1080   Listeria monocytogenes M7     MTFKGFSKKDFKTMQIPGLEARMSGIQTDIQPKFRAVGEELTTYLSAKLGDEMFLHIARHQRRSVNPPESTWLAICHDKRGYKKHPHFQVGLFDNYLFIWLAFIYENE−−ESKKIANRFLKEKKLLADLPDSFAISPDHTEEKTYPVHDG−−−QLKATLERFRDV−−−KKGEFLVGKIYLPDDSHLSPGKDFIKEAEMVLDELIPLYKASLQ
fig|393118.7.peg.1232   Listeria monocytogenes FSL J1-175     MTFKGFSKKDFKTMQIPGLEARMSGIQTDIQPKFRAVGEELTTYLSAKLGDEMFLHIARHQRRSVNPPESTWLAICHDKRGYKKHPHFQVGLFDNYLFIWLAFIYENE−−ESAKIANRFLKEKKLLADLPDNFAISPDHTEEKTYPVHDG−−−QLKATLERFRDV−−−KKGEFLVGKIYLPDDSHLSPGKDFIKEAEMVLDELIPLYKASLQ
fig|879089.3.peg.1064   Listeria monocytogenes SLCC2540     MTFKGFSKKDFKTMQIPGLEARMSGIQTDIQPKFRAVGEELTTYLSAKLGDEMFLHIARHQRRSVNPPESTWLAICHDKRGYKKHPHFQVGLFDNYLFIWLAFIYENE−−ESAKIANRFLKEKKLLADLPDNFAISPDHTEEKTYPVHDG−−−QLKATLERFRDV−−−KKGEFLVGKIYLPDDSHLSPGKDFIKEAEMVLDELIPLYKASLQ
fig|1230340.3.peg.1078   Listeria monocytogenes serotype 4b str. LL195     MTFKGFSKKDFKTMQIPGLEARMNGIQTDIQPKFRAVGEELTTYLSAKLGDEMFLHIARHQRRSVNPPESTWLAICHDKRGYKKHPHFQVGLFDNYLFIWLAFIYENE−−ESAKIANRFLKEKKLLADLPDNFAISPDHTEEKTYPVHDG−−−QLKATLERFRDV−−−KKGEFLVGKIYLPDDSHLSPGKDFIKEAEMVLDELIPLYKASLQ
fig|393121.7.peg.2567   Listeria monocytogenes FSL J2-071     MTFKGFSKKDFKTMQIPGLEARMNGIQTDIQPKFRAVGEELTTYLSAKLGDEMFLHIARHQRRSVNPPESTWLAICHDKRGYKKHPHFQVGLFDNYLFIWLAFIYENE−−ESAKIANRFLKEKKLLADLPDNFAISPDHTEEKTYPVHDG−−−QLKATLERFRDV−−−KKGEFLVGKIYLPDDSHLSPGKDFIKEAEMVLDELIPLYKASLQ
fig|882094.3.peg.1076   Listeria monocytogenes L312     MTFKGFSKKDFKTMQIPGLEARMNGIQTDIQPKFRAVGEELTTYLSAKLGDEMFLHIARHQRRSVNPPESTWLAICHDKRGYKKHPHFQVGLFDNYLFIWLAFIYENE−−ESAKIANRFLKEKKLLADLPDNFAISPDHTEEKTYPVHDG−−−QLKATLERFRDV−−−KKGEFLVGKIYLPDDSHLSPGKDFIKEAEMVLDELIPLYKASLQ
fig|393125.3.peg.1139   Listeria monocytogenes FSL R2-503     MTFKGFSKKDFKTMQIPGLEARMNGIQTDIQPKFRAVGEELTTYLSAKLGDEMFLHIARHQRRSVNPPESTWLAICHDKRGYKKHPHFQVGLFDNYLFIWLAFIYENE−−ESAKIANRFLKEKKLLADLPDNFAISPDHTEEKTYPVHDG−−−QLKATLERFRDV−−−KKGEFLVGKIYLPDDSHLSPGKDFIKEAEMVLDELIPLYKASLQ
fig|272626.9.peg.1080   Listeria innocua Clip11262     MTFKGFSKKDFKTMQIPGLDARMAGIQNDIQPKFKAVGEELTTYLSAKLGDEMFLHIARHQRRSVNPPESTWLAICHDKRGYKKHPHFQVGLFDNYLFIWLAFIYENE−−ESTKIANRFLKEKKLLAELPDTFAISPDHTEEKTYPVHGG−−−QLDATLKRFRDV−−−KKGEFLVGKIYLPDDNHLSPGKDFIKEAEMVLDELIPLYKAALQ
fig|386043.9.peg.1047   Listeria welshimeri serovar 6b str. SLCC5334     MTFKGFSKKDFQTMQIPGLEARMAGIQNDIQPKFKAVGEELTTYLSAKLGDEMFLHIARHQRRSVNPPESTWLAICHDKRGYKKHPHFQVGLFDNYLFIWLAFIYENE−−ESAKIANRFLKEKKLLAELPDTFAISPDHTEEKTFPVHDG−−−HLETTLERFRDV−−−KKGEFLVGKIYLPDDSHLSPGKDFIKEAEMVLDKLIPLYKAALQ
fig|932920.3.peg.1144   Listeria monocytogenes serotype 1/2c str. SLCC2372     MTFKGFSKKDFKTMQISGLEARMTGIQNDIQPKFRAVGEELTTYLSAKLGDEMFLHIARHQRRSVNPPDSTWLAICHDKRGYKKHPHFQVGLFDKYLFIWLAFIYENE−−ESLKIANRFLKEKKLLADLPDNFAISPDHTEEKTYPVHDG−−−QLEATLERFRDV−−−KKGEFLVGKIYLPDDNHLSPAKDFIKEAEMVLDELIPLYKAALQ
fig|637381.3.peg.1113   Listeria monocytogenes 08-5923     MTFKGFSKKDFKTMQIPGLEARMTGIQNDIQPKFRAVGEELTTYLSAKLGDEMFLHIARHQRRSVNPPDSTWLAICHDKRGYKKHPHFQVGLFDKYLFIWLAFIYENE−−ESLKIANRFLKEKKLLADLPDNFAISPDHTEEKTYPVHDG−−−QLEATLERFRDV−−−KKGEFLVGKIYLPDDNHLSPAKDFIKEAEMVLDELIPLYKAALQ
fig|393131.3.peg.796   Listeria monocytogenes J2818     MTFKGFSKKDFKTMQIPGLEARMTGIQNDIQPKFRAVGEELTTYLSAKLGDEMFLHIARHQRRSVNPPDSTWLAICHDKRGYKKHPHFQVGLFDKYLFIWLAFIYENE−−ESLKIANRFLKEKKLLADLPDNFAISPDHTEEKTYPVHDG−−−QLEATLERFRDV−−−KKGNF                                        
fig|393124.10.peg.1650   Listeria monocytogenes FSL N3-165     MTFKGFSMKDFKTMQIPGLEARMTGIQNDIQPKFRAVGEELTTYLSAKLGDEMFLHIARHQRRSVNPPDSTWLAICHDKRGYKKHPHFQVGLFDKYLFIWLAFIYENE−−ESLKIANRFLKEKKLLADLPDNFAISPDHTEEKTYPVHHG−−−QLEATLERFRDV−−−KKGEFLVGKIYLPDDNHLSPAKDFIKEAEMVLDELIPLYKAALQ
fig|388400.4.peg.417   Bacillus sp. B14905     MPKIKWTNKDFNVFKIDGLEQRMDALNDHVRPKFHQLADDFAAYFSSQLGEEFFPHVAKHARRTVNPPKDSWVAFAPYKRGYKSLPHFQIGLWHSHLFIVLAIIYEAP−−QKNVMAERLLAHQSLFEQLPGDFIVSVDHMSPEAISLEEAKEDKLEALLLRLRDV−−−KKGEFLIGRHIPKEQAIKLSASEFHQLTEQTFNSLLPFY     
fig|444177.5.peg.1493   Lysinibacillus sphaericus C3-41     MPKIKWTNKDFNVFKIDGLEQRMNALNDHVRPKFHQLGDDFATYFSSKLGEEFFPHVAKHARRTVNPPQDSWVAFAPYKRGYKSLPHFQIGLWHSHLFIVLAIIYEAP−−QKNVMAERLLAHPSLFEQLSDDFIVSGDHMSPEAISLEEAKEDKLKELLLRLRDV−−−KKGEFLIGRHIPKDQATKLTASEFHQLTEQTFNSLLPFY     
fig|543302.3.peg.2164   Alicyclobacillus acidocaldarius LAA1       FAGWTAEDFDAMTEPGLAPRMERIRAQIQPKFIQLAEHFEPWLAEKLGVPIHTHVAKHARRTVNPPESTWVAFSSDSRGYKKHPHFQIGLFSTHVFAVFGYIDEGI−−DKAAFGARVAAESDVIFAMLPGDFAVIEDHTSPDFKLVRDLGADGLRRVGERLAAV−−−KKAEMLVGRTIVRDEAVRMTGEAFVRLVEETFAPVCALYEIA  
fig|521098.4.peg.1525   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446       FAGWTAEDFDAMTEPGLAPRMERIRARIQPKFIQLAEHFEPWLAEKLGVPMHTHVAKHARRTVHPPESTWVAFSSDSRGYKKHPHFQIGLFSTHVFAVFGYIDEGI−−DKAAFGARVAAESEDMFAMLPGDFAVIEDHTSPDFKLVRDLGADGLRRVGERLAAV−−−KKAEMLVGRTIVRDEAVRMTGEAFVRWVEETFAPGCALYEIA  
fig|655816.3.peg.1534   Bacillus subtilis subsp. spizizenii str. W23     MTQMRFTEEDFNTFTIEGLDARMEVLKETVRPKLTALGEHFAPTLSALTGDEMFPHVAKHARRSVNPPADSWVAFANSKRGYKKLPHFQIGLWETHVFVWFAIIYESP−−IKEEYGKLLEANQETITKNIPDSFVWSADHTKPGVHKQSEMDKEQLKTLFERLQTV−−−KKAELLCGIQLQKEEVLNMNNQEFLQRIDDAFKQLAFLYR    
fig|1148.72.peg.3423   Bacillus subtilis BEST7613     MTQMRFTEEDFNTFTIEGLDARMEVLKETVRPKLTALGEHFAPTLSALTGDEMFPHVAKHARRSVNPPADSWVAFANSKRGYKKLPHFQIGLWESHVFVWFAIIYESP−−IKEEYGKLLEVNQETITKNIPDSFVWSADHTKPGVHKQSEMDKEQLKTLFERLQTV−−−KKAELLCGIQLQKEEVLNMNNQEFLQRIDDAFKQLAFLYRL   
fig|1126211.3.peg.1492   Bacillus amyloliquefaciens Y2     MTQMRFTKEDFDTFTIEGLDPRMEVLKEQVRPKLTLLGEHFAPTLSALTGDEMFPHVAKHARRSVNPPADSWVAFANSKRGYKKLPHFQIGLWDTHMFVWFAIIYESP−−IKEEYGRLLEAKQEDITKQIPGHFVWSPDHTKPGAYKQSDMDQEQLKTLFERLQTV−−−KKAELLCGIQLQKEDVINMNNNEFLQTIEDAFRKLSFLY     
fig|1206104.4.peg.2406   Paenibacillus polymyxa ATCC 12321     MTQMRFTKEDFDTFTIEGLDPRMEVLKEQVRPKLTLLGEHFAPTLSALTGDEMFPHVAKHARRSVNPPADSWVAFANSKRGYKKLPHFQIGLWDTHMFVWFAIIYESP−−IKEEYGRLLEAKQEDITKQIPGHFVWSPDHTKPGAYKQSDMDQEQLKTLFERLQTV−−−KKAELLCGIQLQKEDVINMNNNEFLQTIEDAFRKLSFLY     
fig|279010.12.peg.1684   Bacillus licheniformis ATCC 14580     MSSLRFTEEDFRTFTIEGLDARMSVLKDTVRPKLQGLGDHFAPVLSALTGDEMFVHVAKHARRSVNPPDDSWVAFANNKRGYKKLPHFQIGLWETHVFVWFALIYESP−−LKQEYGQLFKKHLPDIESSIPSRFFWSADHTKPDAKRQSEMNEKDLENLFERLVNV−−−KKAEALCGIQLSKDEVLHMSEEAFLSEIEAAFEKLAFLYRL   
fig|315750.8.peg.1375   Bacillus pumilus SAFR-032     MSEMRFRDEDFETFTVDGLDERMTVLKERVRPKLEALGEHFAPLLSSITGDEMFVHVAKHARRSVNPPNDTWVAFANSKRGYKKLPHFQIGLWKTHVFVWFALIYESP−−VKGEYGQLFEKELDTIQKKIPQDFVWSKDHMKPDVMRHSELDAEQLKTLFERVQTV−−−KKAELLCGIQLPREEVVQMNNEEFLSKIEDAFRTVTYLYR    
fig|536229.4.peg.462   Bacillus pumilus ATCC 7061     MSEMRFRDEDFETFTVDGLDERMVVLKERVRPKLEALGEHFAPLLSSITGDEMFVHVAKHARRSVNPPNDTWVAFANSKRGYKKLPHFQIGLWKTHVFVWFALIYESP−−VKGEYGQLFEKELDTIQKKIPQDFVWSKDHMKPDVMRHSELDAEQLKTLFERVQTV−−−KKAELLCGIQLPREEVVQMNNEEFLSKIEDAFRTLTYLYR    
fig|161544.4.peg.3692   Bacillus sp. SG-1     MKFNGFTEDDFNIFTINGLDDRMEALIETIRPKLDALGHHFAPTLSTMTGDEMFPHVAKHARRSVNPPDDTWVAFANNKRGYKKHPHFQIGLWETHVFVWFAMIYEAP−−DKEEYGKALEKNIDHIIKIIPRNFVWSGDHTKSEVLPFSEMDKEELSSLFKRLQTV−−−KKAEILCGIQIPREQAVKLSGDETIEIINDAFVKLLPLY     
fig|441769.6.peg.1249   Bacillus coahuilensis m4-4     MSTTTFSQSDFDIFKIDGLEPRMEALVSSIRPKLEALGQEFAPTLSALVGEEIHYHVAKHARRSVNPPADTWVAFAPNKRGYKMHPHFQIGLWESHVFIWFAVIYEVQ−−NKEEFGRTLQDNLSNIQSIIPSDFVWSGDHTKPDSVRMDNMSSNDLSTLFERLQTV−−−KKAEILCGYRIFRDEFIKLTEQQWHDIIHNVFVKTVPLYKMA  
fig|1245026.4.peg.3577   Bacillus coagulans XZL9     MGITAFTGQDFDVFRIEGLDQRMEQLKSTVRPKLEVLGEYFSPVLSVLTGEEIFYHVAKHARRTVNPPKDTWVAFSPGKRGYKMLPHFQIGLWEDRLFIVTAVMNECP−−QKASIGKKLEKKIDPILENIPGHYIWSDDHTKPGGIRTDRMNPHTLNTFFRRMQVV−−−KKAEMLCGLEIPREEAAGMSPDELAKTIEDVFVHVLPIYKMA  
fig|345219.8.peg.166   Bacillus coagulans 36D1     MGITAFTGQDFDVFRIEGLDQRMEQLKSTVRPKLEVLGEYFSPVLSVLTGEEIFYHVAKHARRTVNPPKDTWVAFSPGKRGYKMLPHFQIGLWEDRLFIVTAVMNECP−−QKASIGKKLEKKIDPILENIPGHYIWSDDHTKPGGIRTDRMNPHTLNTFFRRMQVV−−−KKAEMLCGLEIPREEAAGMSPDELAKTIEDVFVHVLPIYKMA  
fig|592022.4.peg.1263   Bacillus megaterium DSM319     MAFSGFSQDDFNVFRIEGLDARMEAIKTTIRPKFEQLSNHFAPTLSSLCGDEMFVHIAKHARRTVNPPADTWVAFANSKRGYKKLPHFQIGLWETHVFVWFAVIYESP−−IKEQFGKLLKQNIEEIRQNIPASFVWSKDHTKPDSDKMGDLSSEDLESLFERLETV−−−KKAEILCGITIPKEEAIAINGEEWMARIEQTFHTVTPLYEL   
fig|545693.3.peg.1354   Bacillus megaterium QM B1551     MAFSGFSQDDFNVFRIEGLDARMEAIKTTIRPKFEQLSNHFAPTLSSLCGDEMFVHIAKHARRTVNPPADTWVAFANSKRGYKKLPHFQIGLWETHVFVWFAVIYESP−−IKEQFGKLLKQNIEEIRQNIPASFVWSKDHTKPDSDKMGDLSSEDLESLFERLETV−−−KKAEILCGITIPKEEAIAMNGEEWIARIEQTFHTVTPLYEL   
fig|272558.1.peg.2637   Bacillus halodurans C-125     MSIPGFVQADFDVFTIDGLEPRMEKIKNQIRPKLEAFGTELAPTLSSLTGDEMFVHTAKHARRTVNPPNDTWAAFANSKRGYKKLPHFQVGLWESHLFVWFAIIYESP−−VKGAFAEELLKAPTAIRENIPDSFKWSVDHTKPDTVSESELSDDAFTKMVERLRDV−−−KKAELLCGITLDRKDPLVQDGDKLLHTIEDTFKTLVPLYQLAQQ
fig|398511.4.peg.195   Bacillus pseudofirmus OF4     MAEIEFTQEDFDVFDIEGLDARMEALKTRIRPKFEALGIELAPTLSSMTGDEFFTHVAKHARRKVNPPNDTWVAFAANKRGYKKLPHFQVGLFGTHLFVWFAMIYEAP−−AKGEFAERLLDNPGEWLKKVPKDFVWSIDHMKPEAISQSDVDADEFTSMLTRLRDV−−−KKAELLCGIHIDRQDPILKDGDALLKRIEETYQQLLPLYQEAQK
fig|358681.3.peg.3860   Brevibacillus brevis NBRC 100599      TFPGFRQEDFDVFAIDGLDARMDAIKTNIRPKFEVLSQHFAPFLSVATGDEMFTHIAKHARRTVNPPADTWVAWANDKRGYKKHPHFQIGLWGTHLFVWYAVIYESP−−SKEIISHAFNKHLDEVLAMVPEHFHWSPDHMQPASTSQKELGKAGVKKLVDRLAQV−−−KKAELLCGITIDRHDPILSDGEALVSRLEETFGVLSKLY     
fig|908341.3.peg.398   Paenibacillus sp. HGF5     MTVTGFKDQDFDVFSVPGLEARMEVLIERVRPKLETLGAELAPYVSALVGEEMFVHVAKHARRTVNPPIDTWVAWAASKRGYKALPHFEVGMFGTHLFVIFAIIYESP−−NKTVFAGNLEAKLKKTAKALPKHFYWSMDHMNPAGTPHQDMSEEDFVRLIEKLKQV−−−KKAEVMCGLRIPREEAVKLEGDELVQKVQETFETLLPLYKMAF 
fig|621372.3.peg.2514   Paenibacillus sp. oral taxon 786 str. D14     MAFEGFTTQDFDALTVPGLESRMEAIISHIRPKLETLGAEMAPYLSALCGEEMFPHVAKHARRTVNPPNDTWVAWAASKRGYKALPHFQVGMFSTHLFIIFAVIYESP−−NKAVFANYLDKHAAQIKKTIPDGFYWSLDHMSPDGTPHREADTKQLKAWAEKLKTI−−−KKSEALCGLRLERNDPIVSDGTKLIRTVEEMFQTLLPLYKGAF 
fig|290397.13.peg.577   Anaeromyxobacter dehalogenans 2CP-C     MAGLGLGPPDFALFELGDPDERARALDEELQPKLLALGVQCNSGLARVAGKELFVHPGKLPRRRNAAPEEVLVAFSDSPKGYRGLAFLAVVMTREHLHARVGVRGDSP−−RRAGMQRALEREAANLARKGKPFRKLREFLEWNHEELPELAPAHSAAFWLEMGEALAPGGPGLDLGIAWSQEEARSIA−−−−LGDLLGVFRDLAPLYK    
fig|290397.18.peg.602   Anaeromyxobacter dehalogenans 2CP-C     MAGLGLGPPDFALFELGDPDERARALDEELQPKLLALGVQCNSGLARVAGKELFVHPGKLPRRRNAAPEEVLVAFSDSPKGYRGLAFLAVVMTREHLHARVGVRGDSP−−RRAGMQRALEREAANLARKGKPFRKLREFLEWNHEELPELAPAHSAAFWLEMGEALAPGGPGLDLGIAWSQEEARSIA−−−−LGDLLGVFRDLAPLYK    
fig|455488.5.peg.613   Anaeromyxobacter dehalogenans 2CP-1     MAGLGLGPPDFALFELGDPDERARALEEELQPKLLALGAQCSSGLARVAGKELFVHPGKLPRRRNAAPEEVLVAFSDSPKGYRGLAFLAVVMTREHLHARVGVRGDSP−−RRTGMQRALEREATNLARKGKPFRKLREFLDWNHEELPELAPAHSTAFWLEMGEALAPGGAGLDLGIAWTQEEARSIA−−−−LGDLLGVFRDLAPLYK    
fig|447217.5.peg.625   Anaeromyxobacter sp. K     MAGLGLGPPDFALFELGDPDERARALEEELQPKLLALGAQCSSGLARVAGKELFVHPGKLPRRRNAAPEEVLVAFSDSPKGYRGLAFLAVVMTREHLHARVGVRGDSP−−RRAGMQRALEREATNLARKGKPFRKLREFLDWNHEELPELAPAHSTAFWLEMGEALAPGGAGLDLGIAWTQEEARSIA−−−−LGDLLGVFRDLAPLYK    
fig|404589.4.peg.550   Anaeromyxobacter sp. Fw109-5     MAGLGIGPSDFGLFEIDDPDARSAALEAKLQPKLADIGNHCVAGLSRVAGRGLFVHPGKVARRKGVAQDEALVTFCESPRGYRGLPYLAVVVTRDHLHARVGVKGDSP−−CREAMQRALTREAPALSRKGKPFRKLRSFNDWNFEELPELAPAHTPAFWQELADDLAPGADGLDVGIAWSREEARSLS−−−−LGDLLGVFRDLAPLFKLL  
fig|562970.4.peg.2693   Bacillus tusciae DSM 2912     MVFNGFEAEDFAVFSIPEFEARMEAIRSRVRPKLTALADELAPRLSRETGAPFYPHVAAHARRKVNPPDETWMALSRSPRGYKRYAHFEVGIGAEEVFVRLVIKPEAD−−DKPGAARWLREHGEEAAAILPSSYLWALHRDGASDRPWPRLDGGALQELGVALEK−−−−KAAGLTVGRRFGQQDPVLAERQSFLTLAERVLLELFPLYEA   
fig|904779.3.peg.432   Staphylococcus aureus subsp. aureus IS-91     MTKYTFKPKDFKAFNVEGLDARMEALNEYIRPQLRELGEYFSDFFTSQTGETFYPHVAKHARRSVNPPKDTWVAFATNKRGYKMLPHFQIGMFEDQLFVMFGIMHEAK−−DKATRAKVFERKFKAIQQLPDDYRVCLDHMKPDKPFIKDLTDDDLIEAIQRAINV−−−KKGEFFIARAITPQDKRLKSDKAFIAFLEETFDQFLPFYSA   
fig|644279.4.peg.1113   Staphylococcus aureus subsp. aureus 132     MTKYTFKPKDFKAFNVEGLDARMEALNEYIRPQLRELGEYFSDFFTSQTGETFYPHVAKHARRSVNPPKDTWVAFATNKRGYKMLPHFQIGMFEDQLFVMFEIMHEAK−−DKATRAKVFERKFKAIQQLPDDYRVCLDHMKPDKPFIKDLTDDDLIEAIQRAINV−−−KKGEFFIARAITPQDKRLKSDKAFIAFLEETFDQFLPFYSA   
fig|455227.3.peg.660   Staphylococcus aureus D30     MTKYTFKPKDFKAFNVEGLDARMEALNEYIRPQLRELGEYFNDFFTSQTGETFYPHVAKHARRSVNPPKDTWVAFATNKRGYKMLPHFQIGMFEDQLFVMFGIMHEAK−−DKATRAKVFERKFKAIQQLPDDYRVCLDHMKPDKPFIKDLTDDDLIEAIQRAINV−−−KKGEFFIARAITPQDKRLKSDKAFIAFLEETFDQFLLFYSA   
fig|585155.3.peg.2379   Staphylococcus aureus subsp. aureus H19     MTKYTFKPKDFKAFNVEGLDARMEALNEYIRPQLHELGEYFSDFFTSQTGETFYPHVAKHARRSVNPPKDTWVAFATNKRGYKMLPHFQIGMFEDQLFVMFGIMHEAK−−DKATRAKVFERKFKAIQQLPDDYRVCLDHMKPDKPFIKDLTDDDLKEAIQRAINV−−−KKGEFFIARAITPQDKRLKSDKAFIEFLEETFDQFLPFYSA   
fig|1278071.4.peg.1674   Staphylococcus aureus 3957     MTKYTFKPKDFKAFNVEGLDARMEALNEYIRPQLHELGEYFSDFFTSQTGETFYPHVAKHARRSVNPPKDTWVAFATNKRGYKMLPHFQIGMFEDQLFVMFGIMHEAK−−DKATRAKVFERKFKAIQQLPDDYRVCLDHMKPDKPFIKDLTDDDLKEAIQRAINV−−−KKGEFFIARAITPQDKRLKSDKAFIAFLEETFDQFLPFYSA   
fig|158879.11.peg.1022   Staphylococcus aureus subsp. aureus N315     MTKYTFKPKDFKAFNVEGLDARMEALNEYIRPQLHELGEYFSDFFTSQTGETFYPHVAKHARRSVNAPKDTWVAFATSKRGYKMLPHFQIGMFEDQLFVMFGIMHEAK−−DKATRAKVFERKFKAIQQLPDDYRVCLDHMKPDKPFIKDLTDDDLKEAIQRAINV−−−KKGEFFIARAITPQDKRLKSDKAFIAFLEETFDQFLPFYSA   
fig|1169256.3.peg.998   Staphylococcus aureus M0964     MTKYTFKPKDFKAFNVEGLDARMEALNEYIRPQLHELGEYFSDFFTSQTGETFYPHVAKHARRSVNPPKDTWVAFATSKRGYKMLPHFQIGMFEDQLFVMFGIMHEAK−−DKATRAKVFERKFKAIQQLPDDYRVCLDHMKPDKPFIKDLTDDDLKEAIQRAINV−−−KKGEFFIARAITPQDKRLKSDKAFIAFLEETFDQFLPFYSA   
fig|585146.3.peg.1555   Staphylococcus aureus subsp. aureus 68-397     MTKYTFKPKDFKTFNVEGLDARMEALNEYIRPQLHELGEYFSDFFTSQTGETFYPHVAKHARRSVNPPKDTWVAFATSKRGYKMLPHFQIGMFEDQLFVMFGIMHEAK−−DKATRAKVFERKFKAIQQLPDDYRVCLDHMKPDKPFIKDLTDDDLKEAIQRAINV−−−KKGEFFIARAITPQDKRLKSDKAFIAFLEETFDQFLPFYSA   
fig|1158485.3.peg.2152   Staphylococcus aureus M1311     MTKYTFKPKDFKAFNVEGLDARMEALNEYIRPQLHELGGYFSDFFTSQTGETFYPHVAKHARRSVNPPKDTWVAFATSKRGYKMLPHFQIGMFEDQLFVMFGIMHEAK−−DKATRAKVFERKFKAIQQLPDDYRVCLDHMKPDKPFIKDLTDDDLKEAIQRAINV−−−KKGEFFIARAITPQDKRLKSDKAFIAFLEETFDQFLPFYSA   
fig|904743.3.peg.721   Staphylococcus aureus subsp. aureus 21252     MTKYTFKPKDFKAFNVEGLDARMEALNEYIRPQLHELGGYFSDFFTSQTGETFYPHVAKHARRSVNPPKDTWVAFATSKRGYKMLPHFQIGMFEDQLFVMFGIMHEAK−−DKATRAKVFERKFKAIQQLPDDYRVCLDHMKPDKPFIKDLTDDDLKEAIQRAINV−−−KKGEFFIARAITPQDKRLKSDKAFIAFLEETFDQFLPFYSA   
fig|282458.4.peg.1081   Staphylococcus aureus subsp. aureus MRSA252     MTKYTFKPKDFKAFNVEGLDARMEAVNEYIRPQLHELGEYFSDFFTSQTGETFYPHVAKHARRSVNPPKDTWVAFATSKRGYKMLPHFQIGMFEDQLFVMFGIMHEAK−−DKATRAKVFERKFKAIQQLPDDYRVCLDHMKPDKPFIKDLTDDDLKEAIQRAINV−−−KKGEFFIARAITPQDKRLKSDKAFIAFLEETFDQFLPFYSA   
fig|931441.3.peg.1186   Staphylococcus aureus subsp. aureus CIG1835     MTKYTFKPKDFKAFNVEGLDARMEALNEYIRPQLHELGEYFSDFFTSQTGETFYPHVAKHARRSVNPPKDTWVAFATNKRGYKMLPHFQIGMFEDQLFVMFGIMHEAK−−DKATRAKVFERNFKAIQQLPDDYRVCLDHMKPDKPFIKDLTDDDLKEAIQRAINV−−−KKGEFFIARAITPQDKRLKSDKAFIAFLEETFDQFLPFYSA   
fig|342451.4.peg.1736   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305     MTKYTFKPKNFKAFTVDGLDARMEALNERVRPQLNHLGDYFAQYLETATGEIFYPHVAKHARRSVNPPKDTWVAFATNNRGYKMQPHFQIGLFENQLFVMYGVMHEAK−−DKAQQVQAFVDQFDALRNLPSDYSVSLDHMSQEKTYIHNMTDEDLFKAFRRVKEV−−−KKGEFFVARTLSPNSEHLKNDKAFLSFLEETFEQLLKFYK    
fig|883164.3.peg.764   Staphylococcus lugdunensis ACS-027-V-Sch2     MTKYTFKQKDFKAFDVDGLDPRMEALEAHVRPQLRALGDYFADYFTSQTGETFYSHVAKHARRSVNPPKDTWVAFATNKRGYKMLPHFQIGLFKDHLFIMYGVMHETK−−DKAQRVKTFDKHFDTLTHLPEDYRICLDHMKPDKPLIKDLSVDELHEAIDRVKNV−−−KKGEFFVARTLAPNDKRLKSDRAFLNFVEETFNEFIKFY     
fig|525378.3.peg.234   Staphylococcus epidermidis M23864:W1     MTKYTFAPKDFKAFDVDGLENRMEALNEHVRPQLNQLGDYFADYFSSQTGEEFYPHVAKHARRSVNPPVDTWVAFAPNKRGYKMLPHFQIGLFRDQLFIMFGVMHEAK−−NKAEQMKIFKKHFDKIKALPNDYSLCLDHMKPEKTLIKDMSEDDLKKAIDRAINV−−−KKGEFFVARAIEPSDKRLKSDKAFLQFVEETFDQFLKFYQ    
fig|553212.3.peg.1623   Staphylococcus capitis SK14     MTQYTFAPKDFKAFDVEGLDNRMEALNEYVRPQLNNLGTYFADYFSTQTGEEFYPHVAKHARRSVNPPKDTWVAFAPNKRGYKMLPHFQIGLFRDQLFVMFGVMHEAK−−NKANQMKVFKKHFDKIKDLPEDYSVCLDHMKPEKTLIKDMNDDDLHKAIDRAINV−−−KKGEFFIAREIQPSDQRLKSDKAFLQFIEETFDAFLRFYQ    
fig|596319.3.peg.582   Staphylococcus warneri L37603     MTKYTFSPQNFKAFDVDGLDARMEALNEHVRPQLHELGEYFTEYFTTQTGETFYPHVAKHARRSVNPPKDTWVAFAPNKRGYKMLPHFQIGLFRDQLFIMFGVMHEAK−−DKAERVKIFDKHFDTLRNLPSDYSICLDHMKPEKTLIKDCTDVQLHEAIDRVKNV−−−KKGEFFVARSITPDDQRLKTDKAFIQFVKETFDQFLKFYSA   
fig|279808.8.peg.1821   Staphylococcus haemolyticus JCSC1435     MTQYTFKPKDFKAFEVEGLDARMEALNEYVRPQLNQLGDYFSEYFTSQTGETFYAHVAKHARRSVNPPVDTWVAFAPNKRGYKMLPHFQIGLFKDHLFLMFGVMHEGK−−DKAERVKVFDKHFDVLKQLPEDYQVSLDHMKPEKSYIKDLSDDELHKAIDRVKNV−−−KKGEFFVARSLSPKDAELKSDKAFLSFVKETFDEFLKFYE    
fig|1209359.3.peg.3136   Staphylococcus sp. MDS7B     MTQYTFTPKDFKAFDVEGLDERMEALNKYIRPQLHQLGDYFSEYFTSQTGETFYAHVAKHARRSVNPPIDTWVAFAPNKRGYKMLPHFQIGLFRDQLFIMYGIMHEGK−−NKEERVKVFDKHFNALKQLPNDYQISLNHMKKDKQYIKDLSDTDLHQAIDRVKNV−−−KKGEFFIARTLAPSDERLKSDETFLAFIKETFDEFLKLYE    
fig|1209359.3.peg.1262   Staphylococcus sp. MDS7B     MTQYTFSPKDFKAFEVEGLDQRMEALNDYVRPQLHQLGSYFEEYFTTQTGETFYAHVAKHARRSVNPPIDTWVAFAPNKRGYKMLPHFQIGLFRNQLFIMFGIMHEGR−−NKEEKVKIFDKHFDKLTSLPSDYSVSLDHMKTEKHYIKDMSNEELHAAIDRVKNV−−−KKGEFFVARTLSPTDKRLKSDKSFLKFVEETFDEFLKFYQ    
fig|1000590.6.peg.1817   Staphylococcus epidermidis 14.1.R1.SE     MTQYTFSPKDFKAFEVEGLDQRMEALNDYVRPQLHQLGSYFEEYFTTQTGETFYAHVAKHARRSVNPPIDTWVAFAPNKRGYKMLPHFQIGLFRNQLFIMFGIMHEGR−−NKEEKVKIFDKHFDKLTSLPSDYSVSLDHMKSEKHYINDMSNEELHAAIDRVKNV−−−KKGEFFVARTLSPTDKRLQSDKSFLKFVEETFDEFLKFYQ    
fig|396513.4.peg.734   Staphylococcus carnosus subsp. carnosus TM300     MSKYTFTQKNFKVFEVPGLEGRMSAIESEIQPKLAALGTYFTDFLNTHTPDEFYAHIAKHARRTVNPPKDTWVAFSTNKRGYKMLPHFQIGLYEDQVFVMFGVMHEAK−−NKNHYIEVFEKHFDEIENLPDDYRICTDHVKMEKPLIKDLSTDELKEALHRAHQL−−−KKGEFFIARTLSPKAPELKTDKAFKSYLEDTFDHLLKFY     
fig|458233.11.peg.817   Macrococcus caseolyticus JCSC5402     MTKYHFTSKDFNVFNVEGLEPRMVALIETTRPKLEALGEYFSSYLSQHTDETFYPHVAKHLRRKTNPPNDTWVAFSTNKRGYKMLPHFQIGLFDDHAFVLFGIIYESP−−EKERMAAKWQQQVNDILALDRDFIIKSDHMKKTYETVHSLDEDALKRYIDRLINV−−−KKGELLFGKVFFPDDAALMSDKKFLAAVEDTFFKLLPLY     
fig|315749.4.peg.2724   Bacillus cereus subsp. cytotoxis NVH 391-98     MTLQTFQSADFAVFSVDGLERRMNAIKTHIQPKLETLGERFSHYLSDQTGEPFFYHVAKHARRKVNPPNDTWVAFSTNKRGYKMLPHFQIGLWGTHAFIYFGLIYECP−−QKEVAAHALLEHLNDLKTNIPNDFVWSIDHTKPDVLPHNTLEAKDLQKIIERLATV−−−KKAELLVGIHIAPEEFSSMTNEQFQTKIESTIHSLLPLY     
fig|1151121.3.peg.5125   Bacillus sp. 95MFCvi2.1     MTLQTFKEKDFAVFSVDGLEERMNAIKTNIHPKLEALGEQFSHYLSEQTGETFFYHVAKHARRKVNPPNDTWVAFSTNKRGYKMLPHFQIGLWGTHAFIYFGLIYECP−−QKVEAAHAFLGHLNDLKTNIPNDFVWSIDHTKPGVKPHNMLEANELQKMIERLATI−−−KKAELLVGIHISPEEFSTLTDEQFLTKVEATMQSLLPLYKI   
fig|526999.3.peg.4733   Bacillus mycoides Rock3-17     MTLQTFKEKDFAVFSVDGLEERMNAIKTNIHPKLEALGEQFSHYLSEQTGETFFYHVAKHARRKVNPPNDTWVAFSTNKRGYKMLPHFQIGLWGTHAFIYFGLIYECP−−QKVEAAHAFLGHLNDLKTNIPNDFVWSIDHTKPGVKPHNMLEANELQKMIERLATI−−−KKAELLVGIHISPEEFSTLTDEQFLTKVEATMQSLLPLYKI   
fig|526998.3.peg.1803   Bacillus mycoides Rock1-4     MTLQTFKEKDFAVFSVDGLEERMNAIKTNIHPKLEALGEQFSHYLSEQTGETFFYHVAKHARRKVNPPNDTWVAFSTNKRGYKMLPHFQIGLWGTHAFIYFGLIYECP−−QKVEAAHAFLGHLNDLKTNIPNDFVWSIDHTKPGVKPHNMLEANELQKMIERLATI−−−KKAELLVGIHISPEEFSTLTDEQFLTKVEATMQSLLPLYKI   
fig|526986.3.peg.1897   Bacillus cereus Rock3-44     MTLQTFKSTDFAVFTVDGLEERMNAIKTNIHPKLEALGEQFSHYLSEQTGETFFYHVAKHARRKVNPPNDTWVAFSTNKRGYKMLPHFQIGLWGTHAFIYFGLIYECP−−QKVEAAHAFLEHLNDLKTNIPNDFVWSIDHTKPAVKLHNSLEITDLQKMIERLATI−−−KKAELLAGIHITPEEFSTLTNEQFLTKITTTMNSLLPLYKM   
fig|315730.11.peg.4420   Bacillus weihenstephanensis KBAB4     MTLQTFTSTDFEVFTVDGLEERMSAIKTNIHPKLEALGEQFAEYLSQQTDESFFYHVAKHARRKVNPPNDTWVAFSTNKRGYKMLPHFQIGLWGTHAFIYFGLIYECP−−QKVETAHAFLEHLNDLKTNIPNDFVWSIDHTKPGVKLHKTLETEDLQKMIERLATV−−−KKAELLVGIHISPEEFSAMTNEQFLAKIESTMQPLLPLYAL   
fig|1053248.3.peg.3304   Bacillus cereus VDM034     MTLQTFTSTDFEVFTVDGLEERMSAIKTNIHPKLEALGEQFAEYLSQQTDENFFYHVAKHARRKVNPPNDTWVAFSTNKRGYKMLPHFQIGLWGTHAFIYFGLIYECP−−QKVETAHAFLEHLNDLKTNIPNDFVWSIDHTKPGVKLHKTLETEDLQKMIERLATV−−−KKAELLVGIHISPEEFSAMTNEQFLAKIESTMQPLLPLYAL   
fig|526990.3.peg.5927   Bacillus cereus AH603     MTLQTFTSTDFEVFTVDGLEERMSAIKTNIHPKLEALGEQFAEYLSQQTDENFFYHVAKHARRKVNPPNDTWVAFSTNKRGYKMLPHFQIGLWGTHAFIYFGLIYECP−−QKVETAHAFLEHLNDLKTNIPNDFVWSIDHTKPGVKLHKTLETEDLQKMIERLATV−−−KKAELLVGIHISPEEFSAMTNEQFLAKIESTMQPLLPLYAL   
fig|1053249.3.peg.4286   Bacillus cereus VDM053     MPLQTFTSTDFEVFTVDGLEERMSAIKTNIHPKLE