(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00017914

fig|226900.1.peg.2337   Bacillus cereus ATCC 14579                                                               EKEVITATSYEDLNLTVASKITAQEIDSFI−−AKYHSDSPLVGHGQDFINAQNQYGVSAH−−−YLAAHAILESGYGK−−SEIA−−−YQ−−−−KHNLFGLRAYDG−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FKYAKY−−LPS−−−−−YGDSIAYNANYVRERYLEES−−−−−−−−−−−−GM−−−−−−−−−−−−−−−−−−−−YYNGSTLT−−−−GMNVKYASDK−−−−−−−−−−−−−−−GWAKKIAGIMERIKPFRVEDYTYAKK−−−−−LPKNPETLDVDALSNEIPYKMYADGSSSNVVSSATYYQV                                                                                                                                                               
fig|226900.8.peg.2496   Bacillus cereus ATCC 14579                                                               EKEVITATSYEDLNLTVASKITAQEIDSFI−−AKYHSDSPLVGHGQDFINAQNQYGVSAH−−−YLAAHAILESGYGK−−SEIA−−−YQ−−−−KHNLFGLRAYDG−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FKYAKY−−LPS−−−−−YGDSIAYNANYVRERYLEES−−−−−−−−−−−−GM−−−−−−−−−−−−−−−−−−−−YYNGSTLT−−−−GMNVKYASDK−−−−−−−−−−−−−−−GWAKKIAGIMERIKPFRVEDYTYAKK−−−−−LPKNPETLDVDALSNEIPYKMYADGSSSNVVSSATYYQV                                                                                                                                                               
fig|1053240.3.peg.2459   Bacillus cereus VD166                                                               EKEVITATSYEDLNLTVASKITAQEIDSFI−−AKYHSDSPLVGHGQDFINAQNQYGVSAH−−−YLAAHAILESGYGK−−SEIA−−−YQ−−−−KHNLFGLRAYDG−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FKYAKY−−LPS−−−−−YGDSIAYNANYVRERYLEES−−−−−−−−−−−−GM−−−−−−−−−−−−−−−−−−−−YYNGSTLT−−−−GMNVKYASDK−−−−−−−−−−−−−−−GWAKKIAGIMERIKPFRVEDYTYAKK−−−−−LPKNPETLDVDALSNEIPYKMYADGSSSNVVSSATYYQV                                                                                                                                                               
fig|526969.3.peg.2097   Bacillus cereus m1550                                                               EKEVITATSYEDLNLTVASKITAQEIDSFI−−AKYHSDSPLVGHGQDFINAQNQYGVSAH−−−YLAAHAILESGYGK−−SEIA−−−YQ−−−−KHNLFGLRAYDG−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FKYAKY−−LPS−−−−−YGDSIAYNANYVRERYLEES−−−−−−−−−−−−GM−−−−−−−−−−−−−−−−−−−−YYNGSTLT−−−−GMNVKYASDK−−−−−−−−−−−−−−−GWAKKIAGIMERIKPFRVEDYTYAKK−−−−−LPKNPETLDVDALSNEIPYKMYADGSSSNVVSSATYYQV                                                                                                                                                               
fig|527020.3.peg.3346   Bacillus thuringiensis IBL 4222                                                                              TVASKITAQEIDSFI−−AKYHSDSPLVGHGQDFINAQNQYGVSAH−−−YLAAHAILESGYGK−−SEIA−−−YQ−−−−KHNLFGLRAYDG−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FKYAKY−−LPS−−−−−YGDSIAYNANYVRERYLEES−−−−−−−−−−−−GM−−−−−−−−−−−−−−−−−−−−YYNGPTLT−−−−GMNVKYASDK−−−−−−−−−−−−−−−GWAKKIAGIMERIKPFRVEDYTYAKK−−−−−LPKNPETLDVDALSNEIPYKMYADGSSLNVVSSATYYQV                                                                                                                                                               
fig|405533.4.peg.4068   Bacillus cereus AH1134                                                               EKEVITATSYKDLNLTVASKITAQEIDSFI−−AKYHSDSPLVGHGQDFINAQNQYGVSAH−−−YLAAHAILESGYGK−−SEIA−−−YQ−−−−KHNLFGLRAYDG−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FKYAKY−−LPS−−−−−YGDSIAYNANYVRERYLEEN−−−−−−−−−−−−GM−−−−−−−−−−−−−−−−−−−−YYNGPTLT−−−−GMNVKYASDK−−−−−−−−−−−−−−−GWAKKIAGIMERIKPFRVEDYTYEKK−−−−−LSKNPETLDVEALSNEIPYKMYADGSSTNVVSSATYYQV                                                                                                                                                               
fig|526967.3.peg.2701   Bacillus cereus 172560W                                                               EKEVITATSYEDLNLTVASKITAQEIDSFI−−AKYHSDSPLVGHGQDFINAQNQYGVSAH−−−YLAAHAILESGYGK−−SEIA−−−YQ−−−−KHNLFGLRAYDG−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FKYAKY−−LPS−−−−−YGDSIAYNANYVRERYLEEN−−−−−−−−−−−−GM−−−−−−−−−−−−−−−−−−−−YYNGPTLT−−−−GMNVKYASDK−−−−−−−−−−−−−−−GWAKKIAGIMERIKPFRVEDYTYEKK−−−−−LSKNPETLDVEALSNEIPYKMYADGSSTNVVSSATYYQV                                                                                                                                                               
fig|405532.5.peg.2343   Bacillus cereus B4264                                                               EKEVITATSYEDLNLTVASKITAQEIDSFI−−AKYHSDSPLVGHGQDFINAQNQYGVSAH−−−YLAAHAILESGYGK−−SEIA−−−YQ−−−−KHNLFGLRAYDG−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FKYAKY−−LPS−−−−−YGDSIAYNANYVRERYLEEN−−−−−−−−−−−−GM−−−−−−−−−−−−−−−−−−−−YYNGPTLT−−−−GMNVKYASDK−−−−−−−−−−−−−−−GWAKKIAGIMERIKPFRVEDYTYEKK−−−−−LSKNPETLDVEALSNEIPYKMYADGSSTNVVSSATYYQV                                                                                                                                                               
fig|718222.3.peg.3401   Bacillus cereus TIAC219                                                                              TVASKITAQEIDSFI−−AKYHSDSPLVGHGQDFINAQNQYGVSAH−−−YLAAHAILESGYGK−−SEIA−−−YQ−−−−KHNLFGLRAYDG−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FKYAKY−−LPS−−−−−YGDSIAYNANYVRERYLEES−−−−−−−−−−−−GM−−−−−−−−−−−−−−−−−−−−YYNGPTLT−−−−GMNVKYASDK−−−−−−−−−−−−−−−GWAKKIAGIMERIKPFRVEDYTYAKK−−−−−LPKNPETLDVDALSNEIPYKMYADGSSSNVVSSATYYQV                                                                                                                                                               
fig|527019.3.peg.3329   Bacillus thuringiensis IBL 200                                                                              TVASKITAQEMDSFI−−AKYHSDSPLVGHGQDFINAQNQYGVSAH−−−YLAAHAILESGYGK−−SEIA−−−YQ−−−−KHNLFGLRAYDG−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FKYAKY−−LPS−−−−−YGDSIAYNANYVRERYLEES−−−−−−−−−−−−GM−−−−−−−−−−−−−−−−−−−−YYNGPTLT−−−−GMNVKYASDK−−−−−−−−−−−−−−−GWAKKIAGIMERIKPFRVEDYTYAKK−−−−−LPKNPETLDVDALSNEIPYKVYADGSSSNVVSSATYYQV                                                                                                                                                               
fig|527026.3.peg.3356   Bacillus thuringiensis serovar sotto str. T04001                                                                               MTSKITAQEIDSFI−−AKYHSDSPLVGHGQDFINAQNQYGVSAH−−−YLAAHAILESGYGK−−SEIA−−−YQ−−−−KHNLFGLRAYDG−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FKYAKY−−LPS−−−−−YGDSIAYNANYVRERYLEES−−−−−−−−−−−−GM−−−−−−−−−−−−−−−−−−−−YYNGPTLT−−−−GMNVKYASDK−−−−−−−−−−−−−−−GWAKKIAGIMERIKPFRVEDYTYAKK−−−−−LPKNPETLDVDALSNEIPYKMYADGSSSNVVSSATYYQV                                                                                                                                                               
fig|269801.1.peg.1035   Bacillus cereus G9241                                                                                 SKITAQEIDSFI−−AKYHSDSPLVGHGQDFINAQNKYGVNAH−−−YLAAHAILESGYGK−−SEIA−−−YQ−−−−KHNLFGLRAYDG−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FKYAKY−−LPT−−−−−YGDSIAYNANYVRERYLEES−−−−−−−−−−−−GM−−−−−−−−−−−−−−−−−−−−YYNGPTLA−−−−DMNVKYASDK−−−−−−−−−−−−−−−GWAKKIAGIMERIKPFHVEDYTYAKK−−−−−LPKNPETLDVEALSNEIPYKMYADGSSSNVVSPAAYYHV                                                                                                                                                               
fig|269801.5.peg.1037   Bacillus cereus G9241                                                                                 SKITAQEIDSFI−−AKYHSDSPLVGHGQDFINAQNKYGVNAH−−−YLAAHAILESGYGK−−SEIA−−−YQ−−−−KHNLFGLRAYDG−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FKYAKY−−LPT−−−−−YGDSIAYNANYVRERYLEES−−−−−−−−−−−−GM−−−−−−−−−−−−−−−−−−−−YYNGPTLA−−−−DMNVKYASDK−−−−−−−−−−−−−−−GWAKKIAGIMERIKPFHVEDYTYAKK−−−−−LPKNPETLDVEALSNEIPYKMYADGSSSNVVSPAAYYHV                                                                                                                                                               
fig|527028.3.peg.889   Bacillus thuringiensis serovar pulsiensis BGSC 4CC1                                 QPNRFITRAEAAQLTAKTDMMQLTPKNVLKEKEIITATSYEDLNLTVTSKITAQEIDSFI−−AKYHSDSPLVGHGQDFINAQNQYGVSAH−−−YLAAHAILESGYGK−−SEIA−−−YQ−−−−KHNLFGLRAYDR−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FKYAKY−−LPT−−−−−YGDSIAYNANYVRERYLEES−−−−−−−−−−−−GM−−−−−−−−−−−−−−−−−−−−HYNGPTLA−−−−GMNVKYASDK−−−−−−−−−−−−−−−GWAKKIAGIMERMKPFRAEDYTYAKK−−−−−LPKSPGTLDVEALSDEIPYKMYADGSSANIVSSATY                                                                                                                                                                  
fig|527022.3.peg.2028   Bacillus thuringiensis serovar monterrey BGSC 4AJ1                                 QPNRFITRAEAAQLTAKTDMMQLTPKNVLKEKEIITATSYEDLNLTVTSKITAQEIDSFI−−AKYHSDSPLVGHGQDFINAQNQYGVNAH−−−YLAAHAILESGYGK−−SEIA−−−YQ−−−−KHNLFGLRAYDR−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FKYAKY−−LPT−−−−−YGDSIAYNANYVRERYLEES−−−−−−−−−−−−GM−−−−−−−−−−−−−−−−−−−−HYNGPTLA−−−−GMNVKYASDK−−−−−−−−−−−−−−−GWAKKIAGIMERMKPFRAEDYTYAKK−−−−−LPKSPETLDVEALSNEIPYKMYADGSSANIVSSATY                                                                                                                                                                  
fig|526990.3.peg.2277   Bacillus cereus AH603                                                                              TVASNITAQEIDSFI−−VQYHSDSPLMGHGQDFINAQNKYGVNAQ−−−YLAAHAILESGYGK−−SEIA−−−YR−−−−KHNLFGLRAYDK−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FKYAKY−−LPT−−−−−YGDSIAYNANYVRERYLEED−−−−−−−−−−−−GM−−−−−−−−−−−−−−−−−−−−HYNGPTLD−−−−GMNVKYASDK−−−−−−−−−−−−−−−GWARKIANIMERIKPFRVEDYTSAKK−−−−−LPKNPETLDVEALSNNIPYNMYEDGTTANVVSSAAYYHV                                                                                                                                                               
fig|1053240.3.peg.5904   Bacillus cereus VD166                                                                              TVSSNITAQEIDSFI−−AEYHSDSPLIGHGQDFINAQNQYGVNAL−−−YLAAHAILESGYGK−−SEIA−−−YR−−−−KHNLFGLRAYDK−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FKYAKY−−LPT−−−−−YGDSIAYNANYVRERYLEED−−−−−−−−−−−−GM−−−−−−−−−−−−−−−−−−−−HYNGPTLD−−−−GMNVKYASDK−−−−−−−−−−−−−−−GWAGKIANIMERIKPFRVEDYTSAKK−−−−−LPKNPETLDVEALSNNIPYNMYEDGTTANVVSTAAYYHV                                                                                                                                                               
fig|451709.4.peg.5895   Bacillus cereus 03BB108                                                                              TVSSNITAQEIDSFI−−AEYHSDSPLIGHGQDFINAQNQYGVNAL−−−YLAAHAILESGYGK−−SEIA−−−YR−−−−KHNLFGLRAYDK−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FKYAKY−−LPT−−−−−YGDSIAYNANYVRERYLEED−−−−−−−−−−−−GM−−−−−−−−−−−−−−−−−−−−HYNGPTLD−−−−GMNVKYASDK−−−−−−−−−−−−−−−GWAGKIANIMERIKPFRVEDYTSAKK−−−−−LPKNPETLDVEALSNNIPYNMYEDGTTANVVSTAAYYHV                                                                                                                                                               
fig|526980.3.peg.1277   Bacillus cereus ATCC 10876                                                                              TVASKITAQEIDSFI−−AKYHSDSPLVGHGQDFINAQNQYGVNAQ−−−YLAAHAILESGYGK−−SEIA−−−YR−−−−KHNLFGLRAYDK−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FKYAKY−−LPT−−−−−YGDSIAYNANYVRERYLEED−−−−−−−−−−−−GM−−−−−−−−−−−−−−−−−−−−HYNGPTLA−−−−GMNVKYASDK−−−−−−−−−−−−−−−GWAGKIANIMERIKPFRAEDYTSAKK−−−−−LPKNPEILDVEALSNNIPYNMYEDGTTVNVVSTAAYYHV                                                                                                                                                               
fig|405533.4.peg.5792   Bacillus cereus AH1134                                                                              TVASKITAQEIDSFI−−AKYHSDSPLVGHGQDFINAQNQYGVNAQ−−−YLAAHAILESGYGK−−SEIA−−−YR−−−−KHNLFGLRAYDK−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FKYAKY−−LPT−−−−−YGDSIAYNANYVRERYLEED−−−−−−−−−−−−GM−−−−−−−−−−−−−−−−−−−−HYNGPTLA−−−−GMNVKYASDK−−−−−−−−−−−−−−−GWAGKIANIMERIKPFRAEDYTSAKK−−−−−LPKNPEILDVEALSNNIPYNMYEDGTTVNVVSTAAYYHV                                                                                                                                                               
fig|527024.3.peg.3005   Bacillus thuringiensis serovar tochigiensis BGSC 4Y1                                                                                 SNVTAQEIDNYI−−QRFHPDSPLVGIGQDFIKAQNEYGVNAL−−−YLAAHAILESGYGK−−SEIA−−−YR−−−−KHNLFGLRAYDR−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FAYAKY−−LPS−−−−−YGLSISYNADYVKKNYLEDG−−−−−−−−−−−−AR−−−−−−−−−−−−−−−−−−−−YFKGYTLP−−−−AMNVMYSTDT−−−−−−−−−−−−−−−AWAGKIANIMERIKPFNKADYQNAKR−−−−−LPKNPNTLNVEVLSEAIPYTDYAKDAKTTVQSVGSYYQVPFPFNNPIKSVPNVTQN                                                                                                                                              
fig|526977.3.peg.1386   Bacillus cereus ATCC 4342                                                                                 SNVTAQEIDNYI−−QRFHPDSPLVGIGQDFIKAQNEYGVNAL−−−YLAAHAILESGYGK−−SEIA−−−YR−−−−KHNLFGLRAYDR−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FAYAKY−−LPS−−−−−YGLSISYNADYVKKNYLEDS−−−−−−−−−−−−AR−−−−−−−−−−−−−−−−−−−−YFKGYTLP−−−−AMNVMYSTDT−−−−−−−−−−−−−−−AWAGKIANIMERIKPFNKADYQNAKR−−−−−LPKNPNTLNVEVLSEAIPYTDYAKDAKTTVQSVGSYYQVPFPFNNPIKSVPNVTQN                                                                                                                                              
fig|222523.1.peg.1878   Bacillus cereus ATCC 10987                                                                                 SNVTAQEIDNYI−−QRFHPDSPLVGIGQDFIKAQNEYGVNAL−−−YLAAHAILESGYGK−−SEIA−−−YR−−−−KHNLFGLRAYDR−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FAYAKY−−LPS−−−−−YGLSISYNADYVKKNYLEEG−−−−−−−−−−−−AR−−−−−−−−−−−−−−−−−−−−YFKGYTLP−−−−AMNVMYSTDT−−−−−−−−−−−−−−−AWAGKIANIMERIKPFNKADYQNAKR−−−−−LPKNPNTLNVEVLSEAIPYTDYAKDAKATVQSVGSYYQV                                                                                                                                                               
fig|526992.3.peg.5244   Bacillus cereus AH1271                                                                           LDVTLPSNVTALEIDEFI−−KNSHADSPLIGTGKDFVQAQNEYGVSAL−−−YLAAHAILESGYGK−−SEIA−−−YR−−−−KHNLFGLKAFDW−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FAYAKY−−LPS−−−−−YKESISYNADYVRKNYLEKG−−−−−−−−−−−−AD−−−−−−−−−−−−−−−−−−−−HFNGYTLP−−−−AMNIKYATDK−−−−−−−−−−−−−−−AWAGKIANIMERIKPFNNKDYENVKR−−−−−LAKNPNTLNVNALGEAIPYKDYAKDATATVQLVGSYYQVPYPFGYTIK                                                                                                                                                      
fig|526973.3.peg.3153   Bacillus cereus m1293                                                                                 SNVTAQEIDNFI−−KKSHPDSPLVGNGKDFIQAQNEYGVSAL−−−YLAAHAILESGYGK−−SEIA−−−YR−−−−KHNLFGLKAFDW−−−−−−−−−−−−−−EP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FANAKY−−LPS−−−−−YAQSISYNADYVRKNYLEEG−−−−−−−−−−−−AD−−−−−−−−−−−−−−−−−−−−HFHGYTLP−−−−AMNEKYATDK−−−−−−−−−−−−−−−EWAGKIANIMERIKPFNKKDYENVKR−−−−−LPKNPNTLNVNALDEAIPYKDYAKDATATVQLVGSYYQVPYPFGYTIKSVPNITQN                                                                                                                                              
fig|526985.3.peg.3638   Bacillus cereus Rock3-42                                                                                 SNVTAQEIDNFI−−KKSHADSPLIGTGQDFIQAQNEYGVSAL−−−YLAAHAILESGYGK−−SEIA−−−YR−−−−KHNLFGLRAYDR−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FAYAKY−−LPS−−−−−YKDSISYNADYVRKNYLEKG−−−−−−−−−−−−AD−−−−−−−−−−−−−−−−−−−−HFNGYTLP−−−−AMNIKYATDK−−−−−−−−−−−−−−−EWAGKIANIMERIKPFNKKDYENVKR−−−−−LPKNPNTLNVNALGEAIPYKDYAKDATATVQLVGSYYQVPYPFGYTIKSVPNITQN                                                                                                                                              
fig|572264.4.peg.1702   Bacillus cereus 03BB102                                                                                 SNVTAQEIDNFI−−KKSHADSPLIGTGQDFIQAQNEYGVSAL−−−YLAAHAILESGYGK−−SEIA−−−YR−−−−KHNLFGLRAYDR−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FAYAKY−−LPS−−−−−YKDSISYNADYVRKNYLEKG−−−−−−−−−−−−AD−−−−−−−−−−−−−−−−−−−−HFNGYTLP−−−−AMNIKYATDK−−−−−−−−−−−−−−−EWAGKIANLMERIKPFNKKDYENVKR−−−−−LPKNPNTLNVEALGKEIPYKDYVKDATATVQLVGSYYQVPYPFGYTIKSVPNITQN                                                                                                                                              
fig|347495.3.peg.1673   Bacillus cereus F837/76                                                                                 SNVTAQEIDNFI−−KKSHADSPLIGTGQDFIQAQNEYGVSAL−−−YLAAHAILESAYGK−−SEIA−−−YR−−−−KHNLFGLRAYDR−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FAYAKY−−LPS−−−−−YKESISYNADYVRKNYLEKG−−−−−−−−−−−−AD−−−−−−−−−−−−−−−−−−−−HFNGYTLP−−−−AMNIKYATDK−−−−−−−−−−−−−−−EWAGKIANLMERIKPFNKKDYENVKR−−−−−LPKNPNTLNVEALGKEIPYKDYVKDATATVQLVGSYYQVPYPFGYTIKSVPNITQN                                                                                                                                              
fig|451709.4.peg.2613   Bacillus cereus 03BB108                                                                                 SNVTAQEIDNFI−−KKSHADSPLIGTGQDFIQAQNEYGVSAL−−−YLAAHAILESAYGK−−SEIA−−−YR−−−−KHNLFGLRAYDR−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FAYAKY−−LPS−−−−−YKESISYNADYVRKNYLEKG−−−−−−−−−−−−AD−−−−−−−−−−−−−−−−−−−−HFNGYTLP−−−−AMNIKYATDK−−−−−−−−−−−−−−−EWAGKIANLMERIKPFNKKDYENVKR−−−−−LPKNPNTLNVEALGKEIPYKDYVKDATATVQLVGSYYQVPYPFGYTIKSVPNITQN                                                                                                                                              
fig|527029.3.peg.689   Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1                                                                                 SNVTAQEIDGFI−−KEWHPDSPLIGTGQDFIQAQNEYGVSAL−−−YLAAHAILESGYGK−−SEIA−−−YR−−−−KHNLFGLRAYDR−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FAYAKY−−LPS−−−−−YKDSISYNADYVRKNYLEKG−−−−−−−−−−−−AD−−−−−−−−−−−−−−−−−−−−HFNGYTLP−−−−AMNIKYATDK−−−−−−−−−−−−−−−EWAGKIANLMERIKPFNKKDYENVKR−−−−−LPKNPNTLNVETLGKEIPYKDYAKDAKATVQLVGSYYQVPYPFGYTIK                                                                                                                                                      
fig|288681.15.peg.1711   Bacillus cereus E33L                                                                                 SNITAQEIDGFI−−KEWHPDSPLIGTGQDFIQAQNEYGVSAL−−−YLAAHAILESGYGK−−SEIA−−−YR−−−−KHNLFGLRAYDR−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FAYAKY−−LPS−−−−−YKDSISYNADYVRKNYLEKG−−−−−−−−−−−−AD−−−−−−−−−−−−−−−−−−−−HFNGYTLP−−−−AMNIKYATDK−−−−−−−−−−−−−−−EWAGKIANLMERIKPFNKKDYENVKR−−−−−LPKNPNTLNVEALGKEIPYKDYAKDATATVQLVGSYYQVPYPFGYTIKSVPNITQN                                                                                                                                              
fig|269801.1.peg.1262   Bacillus cereus G9241                                                                                 SNVTAQEIDNFI−−EKSHSDSPLIGTGKDFIQAQNEYGVSAL−−−YLAAHAILESGYGK−−SEIA−−−YR−−−−KHNLFGLRAYDR−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FAYAKY−−LPS−−−−−YKDSISYNADYVRKNYLEKG−−−−−−−−−−−−AD−−−−−−−−−−−−−−−−−−−−HFNGYTLP−−−−AMNIKYATDK−−−−−−−−−−−−−−−EWAGKIANLMERIKPFNKKDYENVKR−−−−−LPKNPTTLNVEALGKEIPYKDYAKNATATIQLVGSYYQVPYPFGYTIKSVPNITQN                                                                                                                                              
fig|269801.5.peg.1284   Bacillus cereus G9241                                                                                 SNVTAQEIDNFI−−EKSHSDSPLIGTGKDFIQAQNEYGVSAL−−−YLAAHAILESGYGK−−SEIA−−−YR−−−−KHNLFGLRAYDR−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FAYAKY−−LPS−−−−−YKDSISYNADYVRKNYLEKG−−−−−−−−−−−−AD−−−−−−−−−−−−−−−−−−−−HFNGYTLP−−−−AMNIKYATDK−−−−−−−−−−−−−−−EWAGKIANLMERIKPFNKKDYENVKR−−−−−LPKNPTTLNVEALGKEIPYKDYAKNATATIQLVGSYYQVPYPFGYTIKSVPNITQN                                                                                                                                              
fig|262543.8.peg.963   Exiguobacterium sibiricum 255-15                         SNRSYYEKQGDRLLHYIVADAGLGGLITAGEAPASLDDRTMQYIESKTLTQDLRKPTALTAKQLDAYI−−KKNAPDSPLIGKGKTFKQVERTYRINAA−−−YLLAHAIHESDYGR−−SDIA−−−KD−−−−KFNLFGVNATDI−−−−−−−−−−−−−−AP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GQNATS−−YDS−−−−−FEDSIRKTGRFIARDYLSKD−−−−−−−−−−−−GK−−−−−−−−−−−−−−−−−−−−YYRGPFLGNKARGMNVFYASDP−−−−−−−−−−−−−−−YWSEKIAGIL                                                                                                                                                                                                                            
fig|262543.4.peg.950   Exiguobacterium sibiricum 255-15                         SNRSYYEKQGDRLLHYIVADAGLGGLITAGEAPASLDDRTMQYIESKTLTQDLRKPTALTAKQLDAYI−−KKNAPDSPLIGKGKTFKQVERTYRINAA−−−YLLAHAIHESDYGR−−SDIA−−−KD−−−−KFNLFGVNATDI−−−−−−−−−−−−−−AP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GQNATS−−YDS−−−−−FEDSIRKTGRFIARDYLSKD−−−−−−−−−−−−GK−−−−−−−−−−−−−−−−−−−−YYRGPFLGNKARGMNVFYASDP−−−−−−−−−−−−−−−YWSEKIAGIL                                                                                                                                                                                                                            
fig|445974.6.peg.565   Clostridium ramosum DSM 1402                                                                            PMRSKTNYTAQELTTYLNNKANSSTSKLNNTGDMFIKYQNKYGVNAL−−−MAASFAALESGWGK−−SSIA−−−QN−−−−KNNLFGMNATDA−−−−−−−−−−−−−−NP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SEDAKK−−YSS−−−−−VEACIEDFASNWMSKKYL−−N−−−−−−−−−−−−GT−−−YTS−−−−−−−−−−−−−−LFRGGYFGDKGSGIFGKYSSDP−−−−−−−−−−−−−−−YEGEKCASIAENMDASISGKDKNYYTIGVKDVAGTSRTNLNVRQSSNISSTVLYTTIKNPSYAFIVRK                                                                                                                                                                  
fig|439292.4.peg.809   Bacillus selenitireducens MLS10                                                                                 SRYTAEELDHYI−−REHAGSASKMQGMGKYLKEAEARYGVNAL−−−FILGAAAHESAFGN−−SVIA−−−RD−−−−TNNLYGIRATDS−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YVNASR−−FDT−−−−−VRESTMSFASTYMLNGYMHYN−−−−−−−−−−−−PAGNLLTQ−−−−−−−−−−−−−−RFQGAIPGTKAVGANVRYASDM−−−−−−−−−−−−−−−FWGQKIAGHMFRADRYLGGKDFGRYRI−−−−−AETTVSGLNVRTEPDST                                                                                                                                                                                     
fig|471223.3.peg.3252   Geobacillus sp. WCH70                                                                                   YTAEELNRFV−−AANRSDSPLKTLGEAFKKTEEKYNVNAL−−−YLLAHAIHESDWGT−−SEIA−−−KE−−−−KKNLFGIRAVDS−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LNSAVK−−FNT−−−−−FEDCINYMAQTIVSNRYA−−N−−−−−−−−−−−−PK−−−−DW−−−−−−−−−−−−−−RYSGAVLGDKTIGFNVRYASDP−−−−−−−−−−−−−−−YWGQKIAGIMYRADKFLGWKDWGKYTI−−−−−MGTT                                                                                                                                                                                                  
fig|420246.7.peg.3263   Geobacillus thermodenitrificans NG80-2                                                                 VGTAYQYFNVLSLRTKTNYTADELNRFV−−AAYRSQSPLKELGTAFKQAEEKYQVNAL−−−YLLAQAILESNWGL−−SQLA−−−QT−−−−KNNLFGIKAYDS−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LNSADS−−FKS−−−−−FEECIDYMAKTIVAGRYA−−N−−−−−−−−−−−−PS−−−−DW−−−−−−−−−−−−−−RYNGAVLGDKSVGFNVRYASDP−−−−−−−−−−−−−−−YWGQKIAGWMYQADQF                                                                                                                                                                                                                      
fig|420246.5.peg.2976   Geobacillus thermodenitrificans NG80-2                                                                 VGTAYQYFNVLSLRTKTNYTADELNRFV−−AAYRSQSPLKELGTAFKQAEEKYQVNAL−−−YLLAQAILESNWGL−−SQLA−−−QT−−−−KNNLFGIKAYDS−−−−−−−−−−−−−−DP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LNSADS−−FKS−−−−−FEECIDYMAKTIVAGRYA−−N−−−−−−−−−−−−PS−−−−DW−−−−−−−−−−−−−−RYNGAVLGDKSVGFNVRYASDP−−−−−−−−−−−−−−−YWGQKIAGWMYQADQF                                                                                                                                                                                                                      
fig|66692.6.peg.3304   Bacillus clausii KSM-K16                                                                                         QAFI−−−−−−−−−−−−−−−−NASK−−−−−LYGVNEI−−−YLISHALLETGNGK−−SQLATGVQVNGKTVYNMYGIGAYDG−−−−−−−−−−NAVSAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AQYAYN−−−−QGWF−−−−T−−−−−PEDAIIGGARFVSSNYFARGQNTLYKMRWNPANPGTYQYATDVGWAVKQTHHMSNLYSLVDDYEMTFDVPVYKNQPTGDAGNDKLEQLPTGTFGTTTARLNVRTGPGTSHSIVTT                                                                                                                                                                                                              
fig|269482.11.peg.3263   Burkholderia vietnamiensis G4                                                   GAKLTPPRGAAPAASPSSGAPAASGGSNLSAPGFIDRVRAAI−−−−−−−−−−−−−−−−AAAKESERKYGVPWL−−−VTFAQWALESGFGS−−SGLS−−−−−−−KRSNNPFSIQATKG−−−−−−−−−−QDFVLG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LDHRADGTPYQAKFRRFKT−−−−−LEDAFDAHAQL−−−−−LAKGR−−−−−−−−−−−−−−−−PYA−−−−−−−NARRHMGDAFSFADAL−−−−−TGVYAEDP−−−−−−−−−−−−−−−QYGAKLKAIMAR                                                                                                                                                                                                                          
fig|269482.4.peg.2694   Burkholderia vietnamiensis strain G4                                                   GAKLTPPRGAAPAASPSSGAPAASGGSNLSAPGFIDRVRAAI−−−−−−−−−−−−−−−−AAAKESERKYGVPWL−−−VTFAQWALESGFGS−−SGLS−−−−−−−KRSNNPFSIQATKG−−−−−−−−−−QDFVLG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LDHRADGTPYQAKFRRFKT−−−−−LEDAFDAHAQL−−−−−LAKGR−−−−−−−−−−−−−−−−PYA−−−−−−−NARRHMGDAFSFADAL−−−−−TGVYAEDP−−−−−−−−−−−−−−−QYGAKLKAIMAR                                                                                                                                                                                                                          
fig|471855.5.peg.1873   Slackia heliotrinireducens DSM 20476                                                                                                             EAALECQEQYGHPAG−−−CTLAQIICESGQGDHLSGLA−−−TQ−−−−DNNLFGIKWAAS−−−−−−−−−−FASCPE−−−−−−−−VSGKSSWSTGE−−−−−−−−−−−−−−−−EYGGEYVTIMADFTSFRS−−−−−HRDCIVFRSRVLLQS−−−−−−−−−−−−−−−−−−−−−DRYAGNELIQRAIAEH−−−DSDLMAEGLKDAG−−−−YATSS−−−−−−−−−−−−−−−VYVESLKSVMDTYGLRRFDGMSVEDWKSGTASGNAVVAAATSQLGVPYVWGGSTPGVGLDCSGLTQWCYAQAGIAI                                                                                                                                                         
fig|471855.4.peg.825   Slackia heliotrinireducens DSM 20476                                                                                                             EAALECQEQYGHPAG−−−CTLAQIICESGQGDHLSGLA−−−TQ−−−−DNNLFGIKWAAS−−−−−−−−−−FASCPE−−−−−−−−VSGKSSWSTGE−−−−−−−−−−−−−−−−EYGGEYVTIMADFTSFRS−−−−−HRDCIVFRSRVLLQS−−−−−−−−−−−−−−−−−−−−−DRYAGNELIQRAIAEH−−−DSDLMAEGLKDAG−−−−YATSS−−−−−−−−−−−−−−−VYVESLKSVMDTYGLRRFDGMSVEDWKSGTASGNAVVAAATSQLGVPYVWGGSTPGVGLDCSGLTQWCYAQAGIAI                                                                                                                                                         
fig|411903.6.peg.613   Collinsella aerofaciens ATCC 25986                                           AAPALLGAVAGIVAFVACALAVAQLLSALFGFWDDAASKQGLEGLPPYIT−−YEMV−−−−−−−−−−EAALECQEEYGHPAG−−−CTIAQIIQESGQGDRMSRLA−−−ER−−−−DHNLFGMKWWSG−−−−−−−−−−YAGCPE−−−−−−−−VAGKANWATSE−−−−−−−−−−−−−−−−EYVPGEHTQITASFIRFTG−−−−−DAECIRFRSRVFLQA−−−−−−−−−−−−−−−−−−−−−ERYSGNALIREAIERH−−−DSDRMAEGLKDAG−−−−WATDS−−−−−−−−−−−−−−−SYVESLKSIMAQWGLYRLD                                                                                                                                                                                                                  
fig|479437.5.peg.1556   Eggerthella lenta DSM 2243                                           AVPVAGVLAAIMAFLLAVLAISQIVSALFGFWENEASKASLEGLPPYIT−−YEMV−−−−−−−−−−EEALACQEEYGHPAG−−−CTIAQIIVESGQGDHLSGLA−−−TQ−−−−DHNLFGMKWSSS−−−−−−−−−−YALCEE−−−−−−−−VAGKSSWRTGE−−−−−−−−−−−−−−−−EYGGEQVTITADFISFVG−−−−−DAECIRFRSRVFLQA−−−−−−−−−−−−−−−−−−−−−DRYASNALIREAIANH−−−DSDKMAEGLKDAG−−−−WATSS−−−−−−−−−−−−−−−SYVESLKSTMETYNLYRFDG                                                                                                                                                                                                                 
fig|500632.7.peg.2333   Clostridium nexile DSM 1787                                                                          EANKQIVQSDLDGLPAWIT−−VEMV−−−−−−−−−−QAAIDMMNETGYPAS−−−VVLGQMILEAGADG−−SELA−−−NP−−−PYYNCLGQKA−−−−−−−−−−−−−HCYKES−−−−−−−−GTV−−VMRTEE−−−−−−−−−−−−−−−−−−−−−AWGTVTAEFSTFAN−−−−−YVDCMLAWGNKFTR−−−−−−−−−−−−−−−−−−−−−−QPYVDNVIACKRDPVTGHYDADSFITALWKSG−−−−YATDP−−−−−−−−−−−−−−−AYVSKVIAVMKSRNLYRFNYMTSADLENGLGE                                                                                                                                                                                                     
fig|500632.7.peg.3551   Clostridium nexile DSM 1787                                                                          EANKQITQSDLEGLPAWIT−−VEMV−−−−−−−−−−QAAIDMMNETGYPAS−−−VVLGQMILEAGADG−−SELA−−−NP−−−PYYNCLGQKA−−−−−−−−−−−−−HCYKEN−−−−−−−−GTV−−VMRTEE−−−−−−−−−−−−−−−−−−−−−AWGTVTAEFSTFAN−−−−−YVDCMLAWGNKFTR−−−−−−−−−−−−−−−−−−−−−−QPYVDNVTACKRDPVTGHYDADSFITALWKSG−−−−YATDP−−−−−−−−−−−−−−−AYVSKVIAVMKSRNLYRFNYMTSADLENGLGEIGTGMFT                                                                                                                                                                                              
fig|226186.1.peg.1538   Bacteroides thetaiotaomicron VPI-5482                                                                               VQAQRRNARYVEYI−−NKYS−−−−−−−−−−DLAVEQMKLHKIPAS−−−ITLAQGLLESGAGN−−SQLA−−−RK−−−−SNNHFGIKCGGS−−−−−−−−−−W−−−RG−−−−−−−RSVR−−−−−−HD−−−−−−−−−−−−−−−−DDARNEC−−−−−−FRAYKH−−−−−PRESYEDHSDFLKRG−−−−−−−−−−−−−−−−−−−−−ARYAF−−−LFKLDIT−−−DYKGWARGLKKAG−−−−YATDP−−−−−−−−−−−−−−−SYANRLITIIEDYDLYKYDSKGVYS−−−−−−−−−−−−−−−−−ERKLRKN−−−−−−−−−−PWLLSPHPVYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANDIAYIVARSGDTFKDLGKEFDISWKKLVKYN−−−DLQRD                                                                                
fig|469585.3.peg.3339   Bacteroides sp. 1_1_14                                                                                                                                                    MA−−−RK−−−−SNNHFGIKCGGS−−−−−−−−−−W−−−RG−−−−−−−RSVR−−−−−−HD−−−−−−−−−−−−−−−−DDARNEC−−−−−−FRAYKH−−−−−PRESYEDHSDFLKRG−−−−−−−−−−−−−−−−−−−−−ARYAF−−−LFKLDIT−−−DYKGWARGLKKAG−−−−YATDP−−−−−−−−−−−−−−−SYANRLITIIEDYDLYKYDSKGVYS−−−−−−−−−−−−−−−−−ERKLRKN−−−−−−−−−−PWLLSPHPVYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANDIAYIVARSGDTFKDLGKEFDISWKKLVKYN−−−DLQRDYTLVAGDII                                                                      
fig|469586.3.peg.4584   Bacteroides sp. 1_1_6                                                                                                               AVEQMKLHKIPAS−−−ITLAQGLLESGAGN−−SQLA−−−RK−−−−SNNHFGIKCGGS−−−−−−−−−−W−−−RG−−−−−−−RSVR−−−−−−HD−−−−−−−−−−−−−−−−DDARNEC−−−−−−FRAYKH−−−−−PRESYEDHSDFLKRG−−−−−−−−−−−−−−−−−−−−−ARYAF−−−LFKLDIT−−−DYKGWARGLKKAG−−−−YATDP−−−−−−−−−−−−−−−SYANRLITIIEDYDLYKYDSKGVYS−−−−−−−−−−−−−−−−−ERKLRKN−−−−−−−−−−PWLLSPHPVYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANDIAYIVARSGDTFKDLGKEFDISWKKLVKYN−−−DLQRDYTLVAGDII                                                                      
fig|483215.6.peg.460   Bacteroides finegoldii DSM 17565                                                                               MQAQRRNARYVEYI−−NKYS−−−−−−−−−−ELAVEQMKLHKIPAS−−−ITLAQGLLESGAGY−−SQLA−−−RK−−−−SNNHFGIKCGSS−−−−−−−−−−W−−−RG−−−−−−−RSVR−−−−−−HD−−−−−−−−−−−−−−−−DDARNEC−−−−−−FRAYKR−−−−−PRDSYEDHSDFLRRG−−−−−−−−−−−−−−−−−−−−−ARYAF−−−LFKLDIT−−−DYKGWARGLKKAG−−−−YATDP−−−−−−−−−−−−−−−SYANRLITIIEDYDLYKYDRKGVYS−−−−−−−−−−−−−−−−−ERKLRKN−−−−−−−−−−PWLMNPHQVYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANDIAYIVARNGDTFKDLGKEFDISWKKLVKYN−−−DLQRDYTLVEGDIIYLKSKKKKASKPYT−−VYIVKDGDSMHGISQKYGIRLKNLYKMNRKDGEYV                   
fig|556259.3.peg.3355   Bacteroides sp. D2                                                                               VQAQKRNARYIEYI−−NKYS−−−−−−−−−−DLAVEQMKLHKIPAS−−−ITLAQGLLESGAGY−−SQLA−−−RK−−−−SNNHFGIKCGGS−−−−−−−−−−W−−−RG−−−−−−−RSVR−−−−−−HD−−−−−−−−−−−−−−−−DDARNEC−−−−−−FRAYKH−−−−−PRDSYEDHSDFLRRG−−−−−−−−−−−−−−−−−−−−−ARYAF−−−LFKLDIT−−−DYKGWARGLKKAG−−−−YATDP−−−−−−−−−−−−−−−SYANRLITIIEDYDLYKYDRKGVYS−−−−−−−−−−−−−−−−−ERKLKKN−−−−−−−−−−PWLMNPHQVYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANDIAYVVARNGDTFKDLGDEFDISWKKLVKYN−−−DLQRDYTLVEGDIIYLKSKKKKASKPYT−−VYIVKDGDSMHGISQKYGIRLKNLYKMNRKDGEYV                   
fig|469588.3.peg.4002   Bacteroides sp. 2_1_22                                                                               VQAQKRNARYVEYI−−NKYS−−−−−−−−−−DLAVEQMKLHKIPAS−−−ITLAQGLLESGAGY−−SQLA−−−RK−−−−SNNHFGIKCGGS−−−−−−−−−−W−−−RG−−−−−−−RTVR−−−−−−HD−−−−−−−−−−−−−−−−DDARNEC−−−−−−FRAYKH−−−−−PRDSYEDHSDFLRRG−−−−−−−−−−−−−−−−−−−−−ARYAF−−−LFKLDIT−−−DYKGWARGLKKAG−−−−YATDP−−−−−−−−−−−−−−−SYANRLITIIEDYDLYKYDRKGVYS−−−−−−−−−−−−−−−−−ERKLKKN−−−−−−−−−−PWLMSPHQVYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANDIAYVVARNGDTFKDLGNEFDISWKKLVKYN−−−DLQRDYTLMEGDIIYLKSKKKKASKPYT−−VYVVKDGDSMHGISQKYGIRLKNLYKMNRKDGEYV                   
fig|457390.3.peg.1520   Bacteroides sp. 3_1_23                                                                               VQAQKRNARYVEYI−−NKYS−−−−−−−−−−DLAVEQMKLHKIPAS−−−ITLAQGLLESGAGY−−SQLA−−−RK−−−−SNNHFGIKCGGS−−−−−−−−−−W−−−RG−−−−−−−RTVR−−−−−−HD−−−−−−−−−−−−−−−−DDARNEC−−−−−−FRAYKH−−−−−PRDSYEDHSDFLRRG−−−−−−−−−−−−−−−−−−−−−ARYAF−−−LFKLDIT−−−DYKGWARGLKKAG−−−−YATDP−−−−−−−−−−−−−−−SYANRLITIIEDYDLYKYDRKGVYS−−−−−−−−−−−−−−−−−ERKLKKN−−−−−−−−−−PWLMSPHQVYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANDIAYVVARNGDTFKDLGKEFDISWKKLVKYN−−−DLQRDYTLMEGDIIYLKSKKKKASKPYT−−VYVVKDGDSMHGISQKYGIRLKNLYKMNRKDGEYV                   
fig|585544.3.peg.3992   Bacteroides sp. D22                                                                               VQAQKRNARYVEYI−−NKYS−−−−−−−−−−DLAVEQMKLHKIPAS−−−ITLAQGLLESGAGY−−SQLA−−−RK−−−−SNNHFGIKCGGS−−−−−−−−−−W−−−WG−−−−−−−RTVR−−−−−−HD−−−−−−−−−−−−−−−−DDARNEC−−−−−−FRAYKH−−−−−PRDSYEDHSDFLRRG−−−−−−−−−−−−−−−−−−−−−ARYAF−−−LFKLDIT−−−DYKGWARGLKKAG−−−−YATDP−−−−−−−−−−−−−−−SYANRLITIIEDYDLYKYDRKGVYS−−−−−−−−−−−−−−−−−ERKLKKN−−−−−−−−−−PWLMSPHQVYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANDIAYVVARNGDTFKDLGKEFDISWRKLVKYN−−−DLQHDYTLMEGDIIYLKSKKKKASKPYT−−VYVVKDGDSMHGISQKYGIRLKNLYKMNRKDGEYV                   
fig|702443.3.peg.4042   Bacteroides ovatus SD CMC 3f                                                                               VQAQKRNARYVEYI−−NKYS−−−−−−−−−−DLAVEQMKLHKIPAS−−−ITLAQGLLESGAGY−−SQLA−−−RK−−−−SNNHFGIKCGGS−−−−−−−−−−W−−−RG−−−−−−−RTVR−−−−−−HD−−−−−−−−−−−−−−−−DDARNEC−−−−−−FRAYKH−−−−−PRDSYEDHSDFLRRG−−−−−−−−−−−−−−−−−−−−−ARYAF−−−LFKLDIT−−−DYKGWARGLKKAG−−−−YATDP−−−−−−−−−−−−−−−SYANRLITIIEDYDLYKYDRKGVYS−−−−−−−−−−−−−−−−−ERKLKKN−−−−−−−−−−PWLMSPHQVYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANDIAYVVARNGDTFKDLGKEFDISWRKLVKYN−−−DLQRDYTLMEGDIIYLKSKKKKASKPYT−−VYVVKDGDSMHGISQKYGIRLKNLYKMNRKDGEYV                   
fig|411901.7.peg.2747   Bacteroides caccae ATCC 43185                                                                               AQAQRRNSRYVEYI−−NKYS−−−−−−−−−−DLAVEQMKLHKIPAS−−−ITLAQGLLESGAGY−−SQLA−−−RK−−−−SNNHFGIKCGGS−−−−−−−−−−W−−−RG−−−−−−−RSVR−−−−−−HD−−−−−−−−−−−−−−−−DDARNEC−−−−−−FRAYSN−−−−−PRDSYEDHSEFLRRG−−−−−−−−−−−−−−−−−−−−−ARYAF−−−LFKLDIT−−−DYKGWARGLKKAG−−−−YATDP−−−−−−−−−−−−−−−SYANRLITIIEDYDLYKYDRKGVYS−−−−−−−−−−−−−−−−−ERKLRKN−−−−−−−−−−PWLMNPHQIYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANDIAYVVARHGDTFQDLGKELGISWKKLVKYN−−−DLHREYTLMEGDIIYLKSKKKKASKPHT−−VYVVRDGDSMHGISQKYGIRLKNLYKMNRKDGDYVPEVGDRLRL          
fig|997882.3.peg.1459   Bacteroides fragilis CL07T00C01                                                                            AAGAQAQRRNSRYVDYI−−NKYS−−−−−−−−−−ALAVQQMKEHKIPAS−−−ITLAQGLLESGAGM−−STLA−−−RK−−−−SNNHFGIKCGSN−−−−−−−−−−W−−−NG−−−−−−−RTVR−−−−−−HD−−−−−−−−−−−−−−−−DDARNEC−−−−−−FRAYRN−−−−−PRDSYEDHSAFLKRG−−−−−−−−−−−−−−−−−−−−−ARYAF−−−LFKLKIT−−−DYKGWARGLKKAG−−−−YATDP−−−−−−−−−−−−−−−SYANRLITIIEDYDLYKYDRKG−−−−−−−−−−−−−−−−−−GWSSSKSE−−−−−−−−−−PTVLNPHQVYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANGIAYIVARDGDTFKSLAKEFDIRWKKLVKYN−−−DLQRDYTLMSGDIIYLKEKKKRASKPYT−−VYIVKDGDSMHTISQKFAIRLKNLYKMNRKDGDYI                   
fig|272559.17.peg.1398   Bacteroides fragilis NCTC 9343                                                                                                                    MKEHKIPAS−−−ITLAQGLLESGAGM−−STLA−−−RK−−−−SNNHFGIKCGSN−−−−−−−−−−W−−−NG−−−−−−−RTVR−−−−−−HD−−−−−−−−−−−−−−−−DDARNEC−−−−−−FRAYRN−−−−−PRDSYEDHSAFLKRG−−−−−−−−−−−−−−−−−−−−−ARYAF−−−LFKLKIT−−−DYKGWARGLKKAG−−−−YATDP−−−−−−−−−−−−−−−SYANRLITIIEDYDLYKYDRKG−−−−−−−−−−−−−−−−−−GWSSSKSE−−−−−−−−−−PTVLNPHQVYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANGIAYIVARDGDTFKSLAKEFDIRWKKLVKYN−−−DLQRDYTLMSGDIIYLKEKKKRASKPYT−−VYIVKDGDSMHTISQKFAIRLKNLYKMNRKDGDYI                   
fig|1073386.3.peg.2719   Bacteroides fragilis HMW 610                                                                               AQAQRRNSRYVDYI−−NKYS−−−−−−−−−−ALAVEQMKEHKIPAS−−−ITLAQGLLESGAGM−−STLA−−−RK−−−−SNNHFGIKCGSS−−−−−−−−−−W−−−NG−−−−−−−RTVR−−−−−−HD−−−−−−−−−−−−−−−−DDARNEC−−−−−−FRAYRN−−−−−PRDSYEDHSAFLKRG−−−−−−−−−−−−−−−−−−−−−ARYAF−−−LFKLKIT−−−DYKGWARGLKKAG−−−−YATDP−−−−−−−−−−−−−−−SYANRLITIIEDYDLYKYDRKG−−−−−−−−−−−−−−−−−−GWSSSKSE−−−−−−−−−−PTVLNPHQVYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANGIAYIVARDGDTFKSLGKEFDIRWKKLVKYN−−−DLQRDYTLMDGDIIYLKEKKKRASKPYT−−VYIVKDGDSMHTISQKYAIRLKNLYKMNRKDGDYVPEVGDRLRL          
fig|537012.5.peg.455   Bacteroides cellulosilyticus DSM 14838                                                                  LTAILALLVCTVAAQAQRRNTRYVEYI−−EKYA−−−−−−−−−−PLAVQQMKEHKIPAS−−−ITLAQGLLESGAGQ−−SALA−−−RK−−−−SNNHFGIKCGSN−−−−−−−−−−W−−−RG−−−−−−−RTVR−−−−−−HD−−−−−−−−−−−−−−−−DDARNEC−−−−−−FRAYSN−−−−−PRDSYEDHSAFLKRG−−−−−−−−−−−−−−−−−−−−−ARYAF−−−LFDLKVT−−−DYKGWARGLKKAG−−−−YATDP−−−−−−−−−−−−−−−SYANRLITIIEDYDLYKYDSRGMSKREA−−−−−−−−−−−RNWEKELKKK−−−−−−−−−−PWLANPHQVYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANDIAYVVARDGDTFRFLGKEFDISWKKLVKYN−−−DLHKDYTLEAGDIIYLKSKKKKASKPHT−−VYIVKDGDSMHTISQKYGIRLKNLYKMNRKDDEYI                   
fig|471870.8.peg.3186   Bacteroides intestinalis DSM 17393                                                                  LTAILALLVCTVAAQAQRKNARYVEYI−−EKYA−−−−−−−−−−PLAVQQMKEHKIPAS−−−ITLAQGLLESGAGQ−−SALA−−−RK−−−−SNNHFGIKCGSN−−−−−−−−−−W−−−RG−−−−−−−RTVR−−−−−−HD−−−−−−−−−−−−−−−−DDARNEC−−−−−−FRAYSN−−−−−PRDSYEDHSAFLKRG−−−−−−−−−−−−−−−−−−−−−ARYAF−−−LFDLKVT−−−DYKGWARGLKKAG−−−−YATDP−−−−−−−−−−−−−−−SYANRLITIIEDYELYKYDSRGMSNREN−−−−−−−−−−−RNWEKELKKK−−−−−−−−−−PWLANPHQVYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANDIAYIVARDGDTFRLLGKEFDISWKKLVKYN−−−DLHKDYTLEAGDIIYLKGKKKKASKRHT−−VYIVKDGDSMHTISQKYGIRLKNLYKMNRKDDEYI                   
fig|585543.3.peg.2982   Bacteroides sp. D20                                                                                                                    MQRHKIPAS−−−ITLAQGLLESGAGY−−SELA−−−RK−−−−SNNHFGIKCGGN−−−−−−−−−−W−−−RG−−−−−−−RTVR−−−−−−HD−−−−−−−−−−−−−−−−DDARNEC−−−−−−FRAYRN−−−−−PKDSYEDHSDFLKRG−−−−−−−−−−−−−−−−−−−−−ARYAF−−−LFKLKIT−−−DYKGWARGLKKAG−−−−YATDP−−−−−−−−−−−−−−−SYANRLITIIEDYELYKYDSRGMSKHDV−−−−−−−−−−−RSWEKELKKK−−−−−−−−−−PWLANPHQVYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANDIAYVVARDGDTFQVLGKEFDISWKKLVKYN−−−DLHKEYTLEVGDIIYLKEKRKKAAKPHT−−VYIVKDGDSMHSISQKYGIRLKNLYKMNRKDAEYV                   
fig|483216.6.peg.1378   Bacteroides eggerthii DSM 20697                                                                  LTAIVALLLISVAVQAQRRNSRYNEYI−−KQYA−−−−−−−−−−PLAVEQMREHRIPAS−−−ITLAQGLLESGAGQ−−STLA−−−RK−−−−SNNHFGIKCGSN−−−−−−−−−−W−−−RG−−−−−−−RSVR−−−−−−HD−−−−−−−−−−−−−−−−DDARNEC−−−−−−FRAYRN−−−−−PKDSYEDHSLFLKRG−−−−−−−−−−−−−−−−−−−−−ARYAF−−−LFKLKIT−−−DYRGWARGLKKAG−−−−YATDP−−−−−−−−−−−−−−−SYANRLITIIEDYDLYKYDTRGLSNREA−−−−−−−−−−−RNLEKELKKK−−−−−−−−−−PWLANPHQVYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANDIAYVVARDGDTFQFLGKEFDISWRKLVKYN−−−DLHKDYTLEAGDIIYLKGKRKKAAKPYT−−VYIVRDGDSMHSISQKYGIRLKNLYKMNRKDAEYV                   
fig|449673.7.peg.710   Bacteroides stercoris ATCC 43183                                                                  LTAIIALLLICVAVQAQRRNSRYNEYI−−KQYA−−−−−−−−−−PLAVEQMKEHKIPAS−−−ITLAQGLLESGAGQ−−SALA−−−RK−−−−SNNHFGIKCHSD−−−−−−−−−−W−−−RG−−−−−−−RRVY−−−−−−HD−−−−−−−−−−−−−−−−DDAKGEC−−−−−−FRAYRH−−−−−PKDSYEDHSLFLKRG−−−−−−−−−−−−−−−−−−−−−ARYAF−−−LFKLKIT−−−DYKGWARGLKKAG−−−−YATDP−−−−−−−−−−−−−−−SYANRLITIIEDYDLYKYDSRGMSKREA−−−−−−−−−−−RKWEKELKKK−−−−−−−−−−PWLANPHQVYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANDIAYVVARDGDTFQFLGKEFDISWRKLVKYN−−−DLHKEYTLEAGDIIYLKDKRKKAAKPHT−−VYIVKDGDSMHSISQKYGIRLKNLYKMNRKDAEYV                   
fig|484018.6.peg.2023   Bacteroides plebeius DSM 17135                                                            MKSLKYILVCCLAGMALSLGAAQRKNKAYEDYI−−RQYH−−−−−−−−−−KIAVEEMKRYHIPAS−−−ITLAQGLLESGAGR−−SELA−−−RK−−−−SNNHFGIKCGRS−−−−−−−−−−W−−−DG−−−−−−−RTVR−−−−−−HN−−−−−−−−−−−−−−−−DDAPNEC−−−−−−FRAYRH−−−−−AKDSYRDHSKFLRTG−−−−−−−−−−−−−−−−−−−−−ARYAF−−−LFRLKIT−−−DYKGWARGLKKAG−−−−YATDP−−−−−−−−−−−−−−−RYADRLINIIELYDLDRYDTKKGLE−−−−−−−−−−−−−−−−WIEE−−−−−−−−−−−−−−−−FPNPHQPYL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANDMVYIIARRGDTFEKLSDELGISKKKLRTYN−−−ELPKDYQFMGGEIVYLEKKRRRATKEYI−−VYVVRQGDSMYSISQKFGIRLKNLYKLNKM                        
fig|547042.5.peg.624   Bacteroides coprophilus DSM 18228                                                                                GAQTRNRAYEEYI−−EKYR−−−−−−−−−−EVAIEEMKRYHIPAS−−−ITLAQGLLESGAGR−−SELA−−−RK−−−−SNNHFGIKCGST−−−−−−−−−−W−−−EG−−−−−−−RTVR−−−−−−HN−−−−−−−−−−−−−−−−DDAPREC−−−−−−FRAYRH−−−−−ARESYRDHSKFLSTG−−−−−−−−−−−−−−−−−−−−−ARYAF−−−LFRLKIT−−−DYKGWARGLKKAG−−−−YATDS−−−−−−−−−−−−−−−RYAQRLIDIIELYDLDKYDRKDGLK−−−−−−−−−−−−−−−−WAKE−−−−−−−−−−−−−−−−NPNPHQPYL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANELVYVIARKGDTFKSLGKELDISHRKLRKYN−−−ELPKDYELKGGEIIYIEEKKKRADKDHI−−VYVVRSGDSMYSISQKFGIRLKNLYKMNRM                        
fig|470145.6.peg.37   Bacteroides coprocola DSM 17136                                                                                 AQKRNKVYEDYI−−HKYR−−−−−−−−−−GIAVDEMKHYRIPAS−−−ITLAQGLLESGAGK−−SELA−−−RK−−−−SNNHFGIKCGGS−−−−−−−−−−W−−−DG−−−−−−−RSVR−−−−−−HD−−−−−−−−−−−−−−−−DDARNEC−−−−−−FRAYKH−−−−−PKDSYRDHSKFLRSG−−−−−−−−−−−−−−−−−−−−−ARYAF−−−LFRLKIT−−−DYKGWARGLKKAG−−−−YATDP−−−−−−−−−−−−−−−QYANRLINIIELYDLDKYDHKGGLE−−−−−−−−−−−−−−−−WAEE−−−−−−−−−−−−−−−−FPNPHQPYL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANELLYVVARRGDTFKSLGKEFDISHRKLRKYN−−−ELPKDYVFRGGEIVYLEEKRRRATKDHI−−AYVVRSGDSMYSISQKFGVRLERLYKMNNMDPD                     
fig|997875.3.peg.646   Bacteroides dorei CL02T00C15                                                                              TVQAQTRNRQYEEYI−−HKYK−−−−−−−−−−DLAVDEMKRYRIPAS−−−ITLAQGLLESGAGK−−STLA−−−RK−−−−SNNHFGIKCGGD−−−−−−−−−−W−−−TG−−−−−−−RTVR−−−−−−HD−−−−−−−−−−−−−−−−DDARNEC−−−−−−FRAYKH−−−−−PRESYEDHSKFLKGR−−−−−−−−−−−−−−−−−−−−−SRYAS−−−LFKLKIT−−−DYKGWAHGLKKAG−−−−YATDP−−−−−−−−−−−−−−−RYAYRLIDIIELYELHKYDTKDGIK−−−−−−−−−−−−−−−−WMKE−−−−−−−−−−−−−−−−FPNPHQPYL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANDLLYIVVRPGDTFKKLSKEFDISQRKLRKYN−−−DLYKGYVLKPGDIIYLDKKHRRADKEHI−−VHVVREGESMYSISQKYGIRLKNLYKMNKMK                       
fig|435590.9.peg.2417   Bacteroides vulgatus ATCC 8482                                                                               MQAQTRNRQYEEYI−−HKYK−−−−−−−−−−DLAIDEMKRYRIPAS−−−ITLAQGLLESGAGK−−STLA−−−RK−−−−SNNHFGIKCGGD−−−−−−−−−−W−−−TG−−−−−−−RTVR−−−−−−HD−−−−−−−−−−−−−−−−DDARNEC−−−−−−FRAYKH−−−−−PRDSYEDHSKFLKGR−−−−−−−−−−−−−−−−−−−−−SRYAS−−−LFKLKIT−−−DYKGWAHGLKKAG−−−−YATDP−−−−−−−−−−−−−−−RYAYRLIDIIELYELHKYDTKDGIK−−−−−−−−−−−−−−−−WMKE−−−−−−−−−−−−−−−−FPNPHQPYL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANDLLYIVVRPGDTFKKLSKEFDISQRKLRKYN−−−DLYKGYVLKPGDIIYLDKKHRRADKEHI−−VHVVRGGESMYSISQKYGIRLKNLYKMNKMK                       
fig|702446.3.peg.3448   Bacteroides vulgatus PC510                                                                              TVQAQTRNRQYEEYI−−HKYK−−−−−−−−−−DLAIDEMKRYRIPAS−−−ITLAQGLLESGAGK−−STLA−−−RK−−−−SNNHFGIKCGGD−−−−−−−−−−W−−−TG−−−−−−−RTVR−−−−−−HD−−−−−−−−−−−−−−−−DDARNEC−−−−−−FRAYKH−−−−−PRDSYEDHSKFLKGR−−−−−−−−−−−−−−−−−−−−−SRYAS−−−LFKLKIT−−−DYKGWAHGLKKAG−−−−YATDP−−−−−−−−−−−−−−−RYAYRLIDIIELYELHKYDTKDGIK−−−−−−−−−−−−−−−−WMKE−−−−−−−−−−−−−−−−FPNPHQPYL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANDLLYIVVRPGDTFKKLSKEFDISQRKLRKYN−−−DLYKGYVLKPGDIIYLDKKHRRADKEHI−−VHVVRGGESMYSISQKYGIRLKNLYKMNKMK                       
fig|435590.6.peg.2198   Bacteroides vulgatus ATCC 8482                                                                              TVQAQTRNRQYEEYI−−HKYK−−−−−−−−−−DLAIDEMKRYRIPAS−−−ITLAQGLLESGAGK−−STLA−−−RK−−−−SNNHFGIKCGGD−−−−−−−−−−W−−−TG−−−−−−−RTVR−−−−−−HD−−−−−−−−−−−−−−−−DDARNEC−−−−−−FRAYKH−−−−−PRDSYEDHSKFLKGR−−−−−−−−−−−−−−−−−−−−−SRYAS−−−LFKLKIT−−−DYKGWAHGLKKAG−−−−YATDP−−−−−−−−−−−−−−−RYAYRLIDIIELYELHKYDTKDGIK−−−−−−−−−−−−−−−−WMKE−−−−−−−−−−−−−−−−FPNPHQPYL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANDLLYIVVRPGDTFKKLSKEFDISQRKLRKYN−−−DLYKGYVLKPGDIIYLDKKHRRADKEHI−−VHVVRGGESMYSISQKYGIRLKNLYKMNKMK                       
fig|242619.8.peg.69   Porphyromonas gingivalis W83                                                                            TAIGQAQSRNRTYEAYV−−KQYA−−−−−−−−−−DEAIRQMSRYNIPAS−−−ITIAQALVETGAGA−−STLA−−−SV−−−−HNNHFGIKCHKS−−−−−−−−−−W−−−TG−−−−−−−KRTY−−−−−−RT−−−−−−−−−−−−−−−−DDAPNEC−−−−−−FRSYSA−−−−−ARESYEDHSRFLLQ−−−−−−−−−−−−−−−−−−−−−PRYRP−−−LFKLDRE−−−DYRGWATGLQRCG−−−−YATNR−−−−−−−−−−−−−−−GYANLLIKMVELYELYALDREKYPSWFH−−KSYPGS−−−NKKSHQTTKQ−−−−−−−−−−KQSGLKHEAYF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYGLLYIIAKQGDTFDSLAEEFDMRASKLAKYN                                                                                        
fig|431947.6.peg.1985   Porphyromonas gingivalis ATCC 33277                                                                                            M−−KQYA−−−−−−−−−−DEAIRQMSRYNIPAS−−−ITIAQALVETGAGA−−STLA−−−SV−−−−HNNHFGIKCHKS−−−−−−−−−−W−−−TG−−−−−−−KRTY−−−−−−RT−−−−−−−−−−−−−−−−DDAPNEC−−−−−−FRSYSA−−−−−ARESYEDHSRFLLQ−−−−−−−−−−−−−−−−−−−−−PRYRP−−−LFKLDRE−−−DYRGWATGLQRCG−−−−YATNR−−−−−−−−−−−−−−−GYANLLIKMVELYELYALDREKYPSWFH−−KSYPGS−−−NKKSHQTTKQ−−−−−−−−−−KQSGLKHEAYF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYGLLYIIAKQGDTFDSLAEEFDMRASKLAKYN                                                                                        
fig|553198.3.peg.1078   Propionibacterium sp. oral taxon 191 str. F0233                                                                                     NAAYQAYI−−RKYA−−−−−−−−−−NEAILQMKRHKIPAS−−−ITIAQGLLESNAGA−−STLA−−−SV−−−−HNNHFGIKCHKS−−−−−−−−−−W−−−QG−−−−−−−NRAY−−−−−−KD−−−−−−−−−−−−−−−−DDEMGEC−−−−−−FRSYDS−−−−−PLDSYTDHSYFLQQ−−−−−−−−−−−−−−−−−−−−−PRYKS−−−LFQLSLD−−−DYQGWAKGLQRCG−−−−YATDK−−−−−−−−−−−−−−−GYANKLIALVELYSLYELDREASPSWMRGKASSPSSTREKKREKQTTPK−−−−−−−−−−APQ−−KRTQYN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CYGLEYVLAEEGDSFATIARDVNIDEEKLATFN−−−DATVDF                                                                               
fig|596327.3.peg.1170   Porphyromonas uenonis 60-3                                                                                     NPNYQTYI−−RTYA−−−−−−−−−−DECIRQMKRHKIPAS−−−ITMAQGLIETGAGS−−SRLA−−−RD−−−−GNNHFGIKCHRA−−−−−−−−−−W−−−QG−−−−−−−QRIY−−−−−−AD−−−−−−−−−−−−−−−−DDLKGEC−−−−−−FRKYRS−−−−−AGDSYEDHSNFLKQ−−−−−−−−−−−−−−−−−−−−−PRYKV−−−LYTYQIT−−−DYEAWARGLQQCG−−−−YATNK−−−−−−−−−−−−−−−GYANMLIKVIEQYELYELDRGRYPRWMSGRPAPTYTPSEKDPEMKLT−−−−−−−−−−−−−−−−−−HEGYF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYGLLYILANKGDSLESIAREMGISLKHLADYN−−−DMPVDF                                                                               
fig|411477.4.peg.1073   Parabacteroides merdae ATCC 43184                                                                                 SQRKVPAYEKYI−−KQYS−−−−−−−−−−SLAIQHQKKYRIPAS−−−ITLAQGLLESGAGR−−SELA−−−RK−−−−SNNHFGIKCHSD−−−−−−−−−−W−−−RG−−−−−−−GRVY−−−−−−HD−−−−−−−−−−−−−−−−DDLRGEC−−−−−−FRKYKN−−−−−PEQSYEDHARFLVGR−−−−−−−−−−−−−−−−−−−−−PRYAS−−−LFKLKIT−−−DYKGWARGLQKCG−−−−YATDR−−−−−−−−−−−−−−−AYANRLIKLIEDYDLYRYDTAKGRK−−−−−−−−−−−−−−−−−KSD−−KQ−−−−−−−−−−PAHISRYTVYR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TNGLLYVYSNGKDCFDDIAASLGFRVKDLKKYN−−−EVPEDF                                                                               
fig|537006.5.peg.3454   Parabacteroides johnsonii DSM 18315                                                                                 SQRKVPAYEKYI−−KQYS−−−−−−−−−−SLAVQHQKKYRIPAS−−−ITLAQGLLESGAGR−−SELA−−−RK−−−−SNNHFGIKCHSD−−−−−−−−−−W−−−RG−−−−−−−GRVY−−−−−−HD−−−−−−−−−−−−−−−−DDLRGEC−−−−−−FRKYKN−−−−−PEQSYEDHARFLVDR−−−−−−−−−−−−−−−−−−−−−PRYAR−−−LFKLKVT−−−DYKGWARGLQKCG−−−−YATDR−−−−−−−−−−−−−−−AYANRLIKLIEDYDLYRYDTAKGGK−−−−−−−−−−−−−−−−−KKG−−KQ−−−−−−−−−−PARISRYTIYR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TNGLLYVYSNGKDSFDDIAASLGFRVKDLKKYN−−−EVPEDF                                                                               
fig|563193.3.peg.3061   Parabacteroides sp. D13                                                                                                               AVQHQKKYRIPAS−−−ITLAQGLLESGAGQ−−SDLA−−−KR−−−−SNNHFGIKCHSD−−−−−−−−−−W−−−RG−−−−−−−GRVY−−−−−−HD−−−−−−−−−−−−−−−−DDLRGEC−−−−−−FRKYKR−−−−−VEDSYDDHSRFLAER−−−−−−−−−−−−−−−−−−−−−SRYER−−−LFKLNIK−−−DYKGWAKGLQKCG−−−−YATDR−−−−−−−−−−−−−−−AYANKLIKVIEDYELYRFDSGKGTK−−−−−−−−−−−−−−−−−KTSTKKQ−−−−−−−−−−NLPVFNYQVYR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−THGLIYVYAKDNDSFDQIARSMGFKAKQLMKFN−−−EVPEDF                                                                               
fig|469589.3.peg.2679   Bacteroides sp. 2_1_33B                                                                                 SQRKLTSYQKYI−−SKYS−−−−−−−−−−DLAIQHQKKYRIPAS−−−ITLAQGLLESGAGQ−−SDLA−−−RR−−−−SNNHFGIKCHSD−−−−−−−−−−W−−−RG−−−−−−−GRVY−−−−−−HD−−−−−−−−−−−−−−−−DDLRGEC−−−−−−FRKYKR−−−−−VEDSYDDHSRFLAER−−−−−−−−−−−−−−−−−−−−−SRYER−−−LFKLNIK−−−DYKGWAKGLQKCG−−−−YATDR−−−−−−−−−−−−−−−AYANKLIKVIEDYEL