(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00016937

fig|35802.96.peg.854   Brucella abortus bv. 1 str. B12-0234          ASGRPVPRFASLK−−−PARVNLRVGPGRDYAVSWLFMKAGLPVEIVQ−−−−EYD−−−−−−−N−−WRRIRDADGT−−−EGWVYQ−−−−−SLLSG−−−−−−−−−−−−−KRTAITAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKNDKGTIIAMRREAAETAGVTAEVEPGVVGTVREC−−TGQ−−−−WCRLD−−−−−−−MSGV−−−−−−−−−−−RGWIKQSELWGVYPGEVFD      
fig|1169216.3.peg.1900   Brucella abortus 87/28          ASGRPVPRFASLK−−−PARVNLRVGPGRDYAVSWLFMKAGLPVEIVQ−−−−EYD−−−−−−−N−−WRRIRDADGT−−−EGWVYQ−−−−−SLLSG−−−−−−−−−−−−−KRTAITAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKNDKGTIIAMRREAAETAGVTAEVEPGVVGTVREC−−TGQ−−−−WCRLD−−−−−−−MSGV−−−−−−−−−−−RGWIKQSELWGVYPGEVFD      
fig|1169204.3.peg.1875   Brucella abortus 355/78          ASGRPVPRFASLK−−−PARVNLRVGPGRDYAVSWLFMKAGLPVEIVQ−−−−EYD−−−−−−−N−−WRRIRDADGT−−−EGWVYQ−−−−−SLLSG−−−−−−−−−−−−−KRTAITAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKNDKGTIIAMRREAAETAGVTAEVEPGVVGTVREC−−TGQ−−−−WCRLD−−−−−−−MSGV−−−−−−−−−−−RGWIKQSELWGVYPGEVFD      
fig|520450.3.peg.57   Brucella abortus bv. 2 str. 86/8/59          ASGRPVPRFASLK−−−PARVNLRVGPGRDYAVSWLFMKAGLPVEIVQ−−−−EYD−−−−−−−N−−WRRIRDADGT−−−EGWVYQ−−−−−SLLSG−−−−−−−−−−−−−KRTAITAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKNDKGTIIAMRREAAETAGVTAEVEPGVVGTVREC−−TGQ−−−−WCRLD−−−−−−−MSGV−−−−−−−−−−−RGWIKKSELWGVYPGEVFD      
fig|1169229.3.peg.1886   Brucella melitensis UK31/99          ASGRPVPRFASLK−−−PDRVNLRVGPGRDYAVSWLFMKAGLPVEIVQ−−−−EYD−−−−−−−N−−WRRIRDADGT−−−EGWVYQ−−−−−SLLSG−−−−−−−−−−−−−KRTAITAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKNDKGTMIAMRREAAETAGVTAEVEPGVVGTVREC−−TGQ−−−−WCRLD−−−−−−−MSGV−−−−−−−−−−−RGWIKQSELWGVYPGEVFD      
fig|224914.1.peg.1952   Brucella melitensis 16M          ASGRPVPRFASLK−−−PARVNLRVGPGRDYAVSWLFMKAGLPVEIVQ−−−−EYD−−−−−−−N−−WRRIRDADGT−−−EGWVYQ−−−−−SLLSG−−−−−−−−−−−−−KRTAITAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKNDKGTMIAMRREAAETAGVTAEVEPGVVGTVREC−−TGQ−−−−WCRLD−−−−−−−MSGV−−−−−−−−−−−RGWIKQSELWGVYPGEVFD      
fig|1004957.3.peg.1954   Brucella melitensis bv. 1 str. M5          ASGRPVPRFASLK−−−PARVNLRVGPGRDYAVSWLFMKAGLPVEIVQ−−−−EYD−−−−−−−N−−WRRIRDADGT−−−EGWVYQ−−−−−SLLSG−−−−−−−−−−−−−KRTAITAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKNDKGTMIAMRREAAETAGVTAEVEPGVVGTVREC−−TGQ−−−−WCRLD−−−−−−−MSGV−−−−−−−−−−−RGWIKQSELWGVYPGEVFD      
fig|437701.3.peg.3085   Brucella sp. F5/99          ASGRPVPRFASLK−−−PARVNLRVGPGRDYAVSWLFMKAGLPVEIVQ−−−−EYD−−−−−−−N−−WRRIRDADGT−−−EGWVYQ−−−−−SFLSG−−−−−−−−−−−−−KRTAITAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKNDKGTMITMRREAAETAGVTAEVEPGVVGTVREC−−TGQ−−−−WCRLD−−−−−−−MSGV−−−−−−−−−−−RGWIKQSELWGVYPGEVFD      
fig|1293913.3.peg.2169   Brucella ovis IntaBari-2009-88-4          ASGRPVPRFASLK−−−PARVNLRVGPGRDYAVSWLFMKAGLPVEIVQ−−−−EYD−−−−−−−N−−WRRIRDADGT−−−EGWVYQ−−−−−SLLSG−−−−−−−−−−−−−KRTAITAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKNDKGTMITMRREAAETAGVTAEVEPGVVGTVREC−−TGQ−−−−WCRLD−−−−−−−MSGV−−−−−−−−−−−RGWIKQSELWGVYPGEVFD      
fig|470735.3.peg.253   Brucella sp. BO1          ASGRPVPRFASLK−−−PARVNLRVGPGRDYAVSWLFMKAGLPVEIVQ−−−−EYD−−−−−−−N−−WRRIRDADGT−−−EGWVYQ−−−−−SLLSG−−−−−−−−−−−−−KRTAITAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKNDKGTMITMRREAAETAGVTAEVEPGVVGTVREC−−TGQ−−−−WCRLD−−−−−−−MSGV−−−−−−−−−−−RGWIKQSELWGVYPGEVFD      
fig|641118.3.peg.2565   Ochrobactrum intermedium LMG 3301                                               MKAGLPVEIIQ−−−−EYD−−−−−−−N−−WRRIRDADGT−−−EGWVYQ−−−−−SLLSG−−−−−−−−−−−−−KRTAITAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKNNQGSMINMRRDASETSGLVAEIEPGVVGTVREC−−TGQ−−−−WCRLD−−−−−−−MGGV−−−−−−−−−−−RGWIKQSDLWGVYPGEVFD      
fig|439375.7.peg.776   Ochrobactrum anthropi ATCC 49188               MPRFVSLK−−−PARVNLRIGPGRDYAVSWLFMKAGLPVEIIQ−−−−EYD−−−−−−−N−−WRRIRDADGT−−−EGWVYQ−−−−−SLLSG−−−−−−−−−−−−−KRTAITAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKNNQGSMINMRRDAADTSGLAAEIEPGVVGTVREC−−TGQ−−−−WCRVD−−−−−−−MGGV−−−−−−−−−−−RGWIKQSDLWGVYPGEVFD      
fig|360095.7.peg.1260   Bartonella bacilliformis KC583          PSGLPLPRFVSIK−−−PARVNVRVGPGSNYAIVFTYQKKGLPIEIIQ−−−−EYD−−−−−−−Q−−WRKIRDAEGD−−−EGWVYQ−−−−−SLLSG−−−−−−−−−−−−−KRTAITIPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKDKTKRLM−−LRKTPTDNAPLVAEVEPNIIGNIRQC−−DGY−−−−WCELS−−−−−−−IGKV−−−−−−−−−−−RGWLHQTQLWGIYPGE         
fig|360095.3.peg.53   Bartonella bacilliformis KC583          PSGLPLPRFVSIK−−−PARVNVRVGPGSNYAIVFTYQKKGLPIEIIQ−−−−EYD−−−−−−−Q−−WRKIRDAEGD−−−EGWVYQ−−−−−SLLSG−−−−−−−−−−−−−KRTAITIPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKDKTKRLM−−LRKTPTDNAPLVAEVEPNIIGNIRQC−−DGY−−−−WCELS−−−−−−−IGKV−−−−−−−−−−−RGWLHQTQLWGIYPGE         
fig|283165.4.peg.141   Bartonella quintana str. Toulouse          PSGLPLPRFASIK−−−PTRVNVRIGPGSNYSIIFTYKKQGLPIEIIQ−−−−EYD−−−−−−−Q−−WRKIRDAEGD−−−EGWVYQ−−−−−SLLSG−−−−−−−−−−−−−KRTAITIPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKDKTKRLM−−LRKTPTDNAKVVAEVEPNVIGNIHQC−−DGY−−−−WCELD−−−−−−−INNI−−−−−−−−−−−RGWLHQPQLWGIYPDE         
fig|283166.1.peg.118   Bartonella henselae str. Houston-1          PSGLPLPRFASIK−−−PTRVNVRVGPGSDYAIIFTYKKQGLPIEIIQ−−−−EYD−−−−−−−Q−−WRKIRDAEGD−−−EGWVYQ−−−−−SLLSG−−−−−−−−−−−−−KRTAITIPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKDKTKRLI−−LRKSPADNAEVVAEVEPNVIGNIRHC−−NGY−−−−WCELN−−−−−−−INNI−−−−−−−−−−−RGWVYQSQLWGIYPDEKIN      
fig|634504.3.peg.139   Bartonella grahamii as4aup          PSGLPLPRFASIK−−−PTSVNVRVGPGSNYSIIFTYKKKGLPIEIIQ−−−−EYD−−−−−−−Q−−WRKIRDAEGD−−−EGWVYQ−−−−−SLLSG−−−−−−−−−−−−−KRTAITIPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKDKTKRLM−−LRKNPTDNAELVAEVEPNVIGNIRQC−−DGQ−−−−WCELN−−−−−−−INNT−−−−−−−−−−−RGWLQQPQLWGIYPDE         
fig|382640.5.peg.168   Bartonella tribocorum CIP 105476          PSGLPLPRFASIK−−−PTRVNVRVGPGSNYSIIFTYKKKGLPIEIIQ−−−−EYD−−−−−−−Q−−WRKIRDAEGD−−−EGWVYQ−−−−−SLLSG−−−−−−−−−−−−−KRTAITIPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QKDKTKRLM−−LRKKPTDNAELLAEVEPNVIGNIHQC−−DGQ−−−−WCEIT−−−−−−−LNNV−−−−−−−−−−−HGWLHQSQLWGIYPDE         
fig|314231.3.peg.1819   Fulvimarina pelagi HTCC2506           SKLPLPRYVSLK−−−SSRVNLRNGPGREHKVNWLYLKSGLPVEIIQ−−−−EFD−−−−−−−H−−WRKIRDADGT−−−EGWVYH−−−−−SLLSG−−−−−−−−−−−−−ERTAIAAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LRGK−−DALVDVHMSPAKDAPLIVRMEPGVVSKVEKC−−NAG−−−−WCEIA−−−−−−−VSER−−−−−−−−−−−VGFVEQNEIWGVYPDEPIE      
fig|287752.3.peg.220   Aurantimonas manganoxydans SI85-9A1          VSKLPLPRYVSLK−−−ASRVNLRIGPGRDYPVTWLYLKEGLPVEVIQ−−−−EYE−−−−−−−L−−WRRIRDSEGT−−−EGWVYH−−−−−SLLSG−−−−−−−−−−−−−DRTSIAAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LRGK−−ATMIDIHNSPATDAPLVARIEPGVVAGVKTC−−TAG−−−−WCELK−−−−−−−VADR−−−−−−−−−−−DGYVRQQEIWGVYPDERFE      
fig|411684.3.peg.2377   Hoeflea phototrophica DFL-43          PSGLPLPRFVSLK−−−ATRVNLRIGPGRDYAVAWLYTRPGVPMEVIQ−−−−EYD−−−−−−−N−−WRRVRDAEGT−−−EGWVYQ−−−−−SLLSG−−−−−−−−−−−−−ERTATVAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KAASGKDEFTSMHREARANARVVARLEPGVVVKVKAC−−DGE−−−−WCEAS−−−−−−−AEGM−−−−−−−−−−−DGYVAQSQIWGAYPGEAF       
fig|1194717.3.peg.3454   Sinorhizobium meliloti C0431A          PSGLPLPRFVSLK−−−AKSVNLRIGPSVDYAVAFRYLKSGVPVEIIQ−−−−EYD−−−−−−−N−−WRRIRDADGT−−−EGWVNQ−−−−−ALLSG−−−−−−−−−−−−−DRTALAAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MRSKGEGVFVNMRRDPQGTASIVARVEPGVMLHIGEC−−NGD−−−−WCHAE−−−−−−−TQGV−−−−−−−−−−−EGWIAQSEIWGAYPGEAF       
fig|266834.1.peg.1467   Sinorhizobium meliloti 1021          PSGLPLPRFVSLK−−−AKSVNLRIGPSVDYAVAFRYLKSGVPVEIIQ−−−−EYD−−−−−−−N−−WRRIRDADGT−−−EGWVNQ−−−−−ALLSG−−−−−−−−−−−−−DRTALAAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MRSKGEGVFVNMRRDPQGTASIVARVEPGVMLHIGEC−−NGD−−−−WCHAE−−−−−−−TQGV−−−−−−−−−−−EGWIAQSEIWGAYPGEAF       
fig|366394.8.peg.6625   Sinorhizobium medicae WSM419          PSGLPLPRFVSLK−−−AKSVNLRIGPSVDYAVAFRYLKSGVPVEIIQ−−−−EYD−−−−−−−N−−WRRIRDADGT−−−EGWVNQ−−−−−ALLSG−−−−−−−−−−−−−DRTAMAAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MRSKGEGVFVNMRRDPQGTAPIVARIEPGVMLHIGEC−−NGD−−−−WCHAE−−−−−−−TQGV−−−−−−−−−−−EGWIAQSEIWGAYPGEAF       
fig|394.7.peg.6344   Rhizobium sp. NGR234          PSGLPLPRFVSLK−−−SRSVNLRIGPSLDYAVAFRYLKTGVPVEIIQ−−−−EYD−−−−−−−N−−WRRIRDADGT−−−EGWVNQ−−−−−ALLSG−−−−−−−−−−−−−DRTAVAAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MRGKGEGIFVNLRRDPQGTAPIVARMQPGVLLHIGEC−−NGD−−−−WCHAE−−−−−−−TQGV−−−−−−−−−−−EGWIAQGEIWGAYPGEAF       
fig|176299.10.peg.71   Agrobacterium tumefaciens str. C58          ASGLPLPRFVSLK−−−SKRVNMRIGPSTDYAVSWMYLKSGMPVEIIQ−−−−EYE−−−−−−−N−−WRRIRDADGT−−−EGWVNQ−−−−−ALLSG−−−−−−−−−−−−−ERTAVAAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MRGKGKEVYVNMRREAQSGAAVTARLEPGVVFRIGEC−−NGD−−−−WCRAE−−−−−−−AGQA−−−−−−−−−−−SGWVSQGEIWGAYPGEAF       
fig|82789.3.peg.144   Agrobacterium sp. ATCC 31749          ASGLPLPRFVSLK−−−SKRVNMRIGPSTDYAVSWMYLKSGMPVEIIQ−−−−EYE−−−−−−−N−−WRRIRDADGT−−−EGWVNQ−−−−−ALLSG−−−−−−−−−−−−−ERTAVAAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MRGKGKEVYVNMRREAQSGAAVTARLEPGVVFRIGEC−−NGD−−−−WCRAE−−−−−−−AGQA−−−−−−−−−−−SGWVSQGEIWGAYPGEAF       
fig|1144306.3.peg.890   Rhizobium sp. AP16          PSGLPLPRFVTLK−−−SKRVNLRVGPSADYAVSWLYLKQGLPVEIIQ−−−−EYD−−−−−−−N−−WRRVRDADGT−−−EGWVNQ−−−−−SLLSG−−−−−−−−−−−−−QRSALAAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MKGKGKAVFVNMRRDAQPSGTVIAKLQPGVMMNVREC−−TGD−−−−WCLAT−−−−−−−ADGT−−−−−−−−−−−EGWVAQSEIWGAYPGEAF       
fig|311403.8.peg.2610   Agrobacterium radiobacter K84          PSGLPLPRFVTLK−−−SKRVNLRVGPSADYAVSWLYLKQGLPVEIIQ−−−−EYD−−−−−−−N−−WRRVRDADGT−−−EGWVNQ−−−−−SLLSG−−−−−−−−−−−−−QRSALAAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MKGKGKAVFVNMRRDAQPSGTVIAKLQPGVMMNVREC−−TGD−−−−WCLAT−−−−−−−ADGT−−−−−−−−−−−EGWVAQSEIWGAYPGEAF       
fig|311402.9.peg.2483   Agrobacterium vitis S4           SGLPLPRFVTLK−−−SARVNLRIGPSTDYATSWMYTRAGLPVEIIQ−−−−EYD−−−−−−−N−−WRRIRDADGT−−−EGWVNQ−−−−−TLLSG−−−−−−−−−−−−−ERSALAAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MKGKGDNIYVNMRREGQAGAGVVAKLQPGVLIKLLEC−−NGN−−−−WCRAE−−−−−−−VDGT−−−−−−−−−−−KGWVAQGEIWGAYPGEAF       
fig|491916.7.peg.174   Rhizobium etli CIAT 652          PSGLPLPRFVTLK−−−SKRVNLRIGPGTDYAVSWMYLKSGLPVEIIQ−−−−EYD−−−−−−−N−−WRRIRDADGT−−−EGWVNQ−−−−−SLLSG−−−−−−−−−−−−−QRAAIAAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MKTKGKGVFVNLRREAQPSASIIAKLEPGVMLTIGEC−−NGD−−−−WCRAE−−−−−−−ADGA−−−−−−−−−−−TGWVAQSEIWGAYPGEAF       
fig|754764.3.peg.2711   Rhizobium leguminosarum bv. trifolii WSM597          PSGLPLPRFVTLK−−−SKRVNLRIGPGTDYAVSWMYLKSGLPVEIIQ−−−−EYD−−−−−−−N−−WRRIRDADGT−−−EGWVNQ−−−−−SLLSG−−−−−−−−−−−−−QRAAIAAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MKTKAKGVFVNLRREALPSASIVAKLEPGVMLTIGEC−−NGD−−−−WCRAE−−−−−−−TDGA−−−−−−−−−−−SGWVAQSEIWGAYPGEAF       
fig|347834.17.peg.468   Rhizobium etli CFN 42          PSGLPLPRFVTLK−−−SKRVNLRIGPGTDFAVSWMYLKSGLPVEIIQ−−−−EYD−−−−−−−N−−WRRIRDADGT−−−EGWVNQ−−−−−SLLSG−−−−−−−−−−−−−QRAAIAAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MKTKGKGVYVNLRREAQPSASIVAKLEPGVMLTIGEC−−NGD−−−−WCHAE−−−−−−−TDGA−−−−−−−−−−−AGWVAQSEIWGAYPGEAF       
fig|936136.4.peg.6413   Rhizobium leguminosarum bv. viciae 248          PSGLPLPRFVTLK−−−SKRVNLRIGPGTDYAVSWMYLKSGLPVEIIQ−−−−EYD−−−−−−−N−−WRRIRDADGT−−−EGWVNQ−−−−−SLLSG−−−−−−−−−−−−−QRAAIAAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MKTKGKGIYVNLRREAQPSASIVAKLEPGVMLTIGEC−−NGD−−−−WCRAE−−−−−−−SDGA−−−−−−−−−−−SGWVAQSEIWGAYPGEAF       
fig|395491.3.peg.5223   Rhizobium leguminosarum bv. trifolii WSM1325          PSGLPLPRFVTLK−−−SKRVNLRIGPGTDYAVSWMYLKSGLPVEIIQ−−−−EYD−−−−−−−N−−WRRIRDADGT−−−EGWVNQ−−−−−SLLSG−−−−−−−−−−−−−QRAAIAAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MKTKGKGIYVNLRREAQPSASIVAKLEPGVMLTIGEC−−NGD−−−−WCRAE−−−−−−−SDGA−−−−−−−−−−−SGWVAQSEIWGAYPGEAF       
fig|266835.9.peg.4429   Mesorhizobium loti MAFF303099          PSGLPLPRFVSLK−−−SGRVNSRVGPGANYSVDWMYLKAGLPMEVVQ−−−−EFD−−−−−−−T−−WRRVRDADGS−−−EGWINQ−−−−−SLLSG−−−−−−−−−−−−−RRTAIIAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QRGK−−GAQINLMKSPDKDARVVAIVEPGVMGTIKSC−−DGQ−−−−WCEMT−−−−−−−LEGH−−−−−−−−−−−TGWLAQAAVWGAYPGE         
fig|536019.3.peg.2777   Mesorhizobium opportunistum WSM2075                                               MKAGLPMEIIQ−−−−EFD−−−−−−−T−−WRRVRDADGS−−−EGWINQ−−−−−SLLSG−−−−−−−−−−−−−RRTAIIAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QRGK−−GAQINLLNSPDKDARVIAIVEPGVMGMIKSC−−DGQ−−−−WCEMT−−−−−−−LGGH−−−−−−−−−−−TGWLAQSTVWGAYPGE         
fig|266779.1.peg.3118   Mesorhizobium sp. BNC1                               MRVGPGTQYAVMWLYLKPGLPVEIIQ−−−−EYD−−−−−−−N−−WRRVRDADGT−−−EGWINQ−−−−−ALLSG−−−−−−−−−−−−−QRTAVVAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FKGKENAAVPLVAKPEEGAREVAKVEPGLVGEVAMC−−NGS−−−−WCRIN−−−−−−−FAGH−−−−−−−−−−−EGWMDQGAIWGVYPGEAI       
fig|266779.9.peg.4736   Chelativorans sp. BNC1          PSGLPLPRFVSLK−−−SGRVNMRVGPGTQYAVMWLYLKPGLPVEIIQ−−−−EYD−−−−−−−N−−WRRVRDADGT−−−EGWINQ−−−−−ALLSG−−−−−−−−−−−−−QRTAVVAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FKGKENAAVPLVAKPEEGAREVAKVEPGLVGEVAMC−−NGS−−−−WCRIN−−−−−−−FAGH−−−−−−−−−−−EGWMDQGAIWGVYPGEAI       
fig|311403.8.peg.5363   Agrobacterium radiobacter K84           TGLPIPRYVSLK−−−AHKARMRVGPSTIYATKWIYMKPGLPLEIID−−−−EYG−−−−−−−R−−WRQVRDDTGT−−−TGWMHG−−−−−ALLSG−−−−−−−−−−−−−QRTAVVAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKTN−−−AMLRGGPEKTANLIAELQPRVLLSLHSC−−TGA−−−−WCNVSVR−−−−−EHSA−−−−−−−−−−−RGYIRQDLLWGAYPGEMF       
fig|395491.3.peg.6252   Rhizobium leguminosarum bv. trifolii WSM1325           TGLPIPRFVSLK−−−TTRARMRIGPAFEYAVKWLYQAPGLPLEITE−−−−EYG−−−−−−−N−−WRQVRDSDGV−−−SGWMHR−−−−−SLLSS−−−−−−−−−−−−−NRTAVIGPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKET−−−TALRAQARQNSFAKAELESRVRVQILSC−−TLS−−−−WCNVALN−−−−−KDHI−−−−−−−−−−−SGFVEKSALWGVYPQEVVN      
fig|311402.9.peg.3113   Agrobacterium vitis S4          VTGYPLPRFASLK−−−ADRVRMRAGPSTDYPVRFIYEARGLPVEIIE−−−−EYD−−−−−−−N−−WRQVRDSDGT−−−SGWMSA−−−−−VMLSG−−−−−−−−−−−−−ARTGLVAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RGSKGDLVMLRTRPLATAAITAQLQPRVRLKIGGC−−DGH−−−−WCSVSVE−−−−−RGGP−−−−−−−−−−−SGFVRQGLVWGVYPGETI       
fig|648757.4.peg.2384   Rhodomicrobium vannielii ATCC 17100          VTGLPLPRFVSLK−−−ASEVNARVGPGGEYQIAWVFRRAGLPVEVIA−−−−EFE−−−−−−−N−−WRQVRDSEGG−−−TGWVNA−−−−−ALTSA−−−−−−−−−−−−−RRTAVVAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VKDRMLFRLTATRGGGTLVAQIEPGAIVDIAQC−−DGE−−−−DCEVY−−−−−−−ASKQ−−−−−−−−−−−KGYLPQKSLWGVYPGE         
fig|1174529.3.peg.457   Liberibacter asiaticus str. gxpsy          FEKKPLPRFVTIK−−−ASRANSRIGPGIMYTVVCTYLTKGLPVEVVK−−−−EYE−−−−−−−N−−WRQIRDFDGT−−−IGWINK−−−−−SLLSG−−−−−−−−−−−−−KRSAIVSPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NRKTNNPIYINLYKKPDIQSIIVAKVEPGVLLTIREC−−SGE−−−−WCFGY−−−−−−−NLDT−−−−−−−−−−−EGWIKKQKIWGIYPGEVF       
fig|335992.3.peg.509   Pelagibacter ubique HTCC1062                 KFLSLK−−−KSKVNVRYGPSFDSKIKYIYKKINLPIKQID−−−−QKE−−−−−−−N−−FRRIVDLKNN−−−SGWIHI−−−−−SQIKK−−−−−−−−−−−−−SNSIII−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LEDKILYKKPSNFSKPIAKLEKGRLLILKKC−−ENI−−−−WCNVK−−−−−−−TEDY−−−−−−−−−−−SGWIKTENIWG              
fig|1115650.3.peg.335   Pelagibacter ubique HTCC1016                 KFLSLK−−−KSKVNVRYGPSFDSKIKYIYKKINLPIKQID−−−−QKE−−−−−−−N−−FRRIVDLKNN−−−SGWIHI−−−−−SQIKK−−−−−−−−−−−−−SNSIII−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LEDKILYKKPSNFSKPIAKLEKGRLLILKKC−−ENI−−−−WCNVK−−−−−−−TEDY−−−−−−−−−−−SGWVKTENIWG              
fig|439493.6.peg.180   Pelagibacter sp. HTCC7211                  FLSLK−−−KNKVNVRYGPSFDSDVKYVYKKINLPLKQID−−−−KKE−−−−−−−N−−FRRIIDMKNN−−−SGWIHV−−−−−SQLKN−−−−−−−−−−−−−NNSVIS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TDLKILFKKPSSFAKPIAQLKKGRLLIVKEC−−KKK−−−−WCSVE−−−−−−−TGKF−−−−−−−−−−−TGWVDKENLWGISK           
fig|684719.3.peg.1129   alpha proteobacterium HIMB114                    SLK−−−NNKVNVRLGPSKTYPVKFIYKNKYLPVLIID−−−−EHY−−−−−−−N−−WRKIKDYEND−−−LGWIHI−−−−−SQLSR−−−−−−−−−−−−−TRSTVT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TKNNQVIFSSPTIFSKPKAKLEIYQVLIISEC−−TKN−−−−WCKVK−−−−−−−NSKI−−−−−−−−−−−NGWIKKNHLWGIQKDEII       
fig|384035.3.peg.108   Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24                               MRTGPGFHYPVKWIYTCKNLPLKVIE−−−−EFE−−−−−−−S−−WKKVCDIDED−−−CGWIKG−−−−−NLLSD−−−−−−−−−−−−−KRYAIV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KEDTYGYQKQSVDSKITMKIDKFVVMKIEKC−−NEE−−−−WCFLS−−−−−−−TPKR−−−−−−−−−−−KAWVQKKHIYGVD            
fig|163164.1.peg.1054   Wolbachia sp. endosymbiont of Drosophila melanogaster                  FVSTK−−−SNKINMRTGPGFHYPVKWIYTCKNLPLKVIE−−−−EFE−−−−−−−S−−WKKVCDIDED−−−CGWIKG−−−−−NLLSD−−−−−−−−−−−−−KRYAIV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KEDTYGYQKQSVDSKITMKIDKFVVMKIEKC−−NEE−−−−WCFLS−−−−−−−TPKR−−−−−−−−−−−KAWVQKKHIYGVD            
fig|357244.3.peg.1696   Orientia tsutsugamushi Boryong               IPRFISTK−−−TNEINMRTGPNIKYPIKWIFTKKDEPLEIVD−−−−KFD−−−−−−−Q−−WYYVRDITGD−−−FGWIHS−−−−−SVLSQ−−−−−−−−−−−−−KRTVVI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NSNKIQNLYKSSNYESRIIAYLEPKVRCELKKC−−TAL−−−−MCKLH−−−−−−−CKNY−−−−−−−−−−−IGWVDRKILWGVYDHE         
fig|334380.3.peg.760   Orientia tsutsugamushi str. Ikeda               IPRFVSTK−−−TNEINMRTGPNIKYPIKWIFTKKDEPLEIVD−−−−KFD−−−−−−−Q−−WYYVRDITGD−−−FGWIHS−−−−−SVLSQ−−−−−−−−−−−−−KRTVVI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NSNKIQNLYKSSNYESRIIAYLEPKIRCELKKC−−TAL−−−−MCKLH−−−−−−−CKNY−−−−−−−−−−−IGWVDRKILWGVYDHE         
fig|391896.4.peg.18   Rickettsia bellii OSU 85-389            KLPIPRFVSIK−−−SNEVNARSGPTTKAAIEWVFVKKGEPVEIIA−−−−EYE−−−−−−−Q−−WRQVRDIHGE−−−SGWIHS−−−−−SILSG−−−−−−−−−−−−−RRSVII−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IADQEIELLKHANIESRVIAKLMPKVRCGLKKC−−KEQ−−−−FCQIT−−−−−−−CKNY−−−−−−−−−−−TGWVLKKDLWGVYDD          
fig|336407.4.peg.190   Rickettsia bellii RML369-C            KLPIPRFVSIK−−−SNEVNARSGPTTKAAIEWVFVKKGEPVEIIA−−−−EYE−−−−−−−Q−−WRQVRDIHGE−−−SGWIHS−−−−−SVLSG−−−−−−−−−−−−−RRSVII−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IADQEIELLKYANIESRVIAKLMPKVRCGLKKC−−KEQ−−−−FCQIT−−−−−−−CKNY−−−−−−−−−−−TGWVLKKDLWGVYDD          
fig|293613.4.peg.1122   Rickettsia canadensis str. McKiel            KLPVPRFVSIK−−−SNEVNARSGPTTKSAIEWVFIKKGEPVEIIA−−−−EYE−−−−−−−Q−−WRQVRDINGE−−−GGWIHS−−−−−SVLSG−−−−−−−−−−−−−KRSVVV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IGDKEIELTKSVNPKSRVIVKLMPKVRCGLKKC−−KEQ−−−−FCQIT−−−−−−−CKDY−−−−−−−−−−−TGWISKKVIWGVYND          
fig|140892.3.peg.1484   Rickettsia conorii subsp. caspia A-167            KLPIPRFVSIK−−−SNEVNARSGPTTKSAVEWVFVKKGEPVEITA−−−−EYK−−−−−−−Q−−WRQVRDINGE−−−GGWIHS−−−−−SVLSG−−−−−−−−−−−−−KRSVVI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSDKEIELTKSADHKSRVIAKLMPKVRCSLKKC−−KEQ−−−−FCQIT−−−−−−−CKDY−−−−−−−−−−−TGWISKKVIWGVYDD          
fig|272944.1.peg.1251   Rickettsia conorii str. Malish 7            KLPIPRFVSIK−−−SNEVNARSGPTTKSAVEWVFVKKGEPVEITA−−−−EYK−−−−−−−Q−−WRQVRDINGE−−−GGWIHS−−−−−SVLSG−−−−−−−−−−−−−KRSVVI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSDKEIELTKSADHKSRVIAKLMPKVRCSLKKC−−KEQ−−−−FCQIT−−−−−−−CKDY−−−−−−−−−−−TGWISKKVIWGVYDD          
fig|416276.5.peg.1565   Rickettsia massiliae MTU5            KLPIPRFVSIK−−−SNEVNARSGPTTKSAVEWVFVKKGEPVEIIA−−−−EYK−−−−−−−Q−−WRQVRDINGE−−−GGWIHS−−−−−SVLSG−−−−−−−−−−−−−KRSVVI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSDKEIELTKSADPKSRVIAKLMPKVRCSLKKC−−KEQ−−−−FCQIT−−−−−−−CKDY−−−−−−−−−−−TGWISKKVIWGVYDD          
fig|315456.3.peg.1282   Rickettsia felis URRWXCal2            KLPIPRFVSIK−−−SNEVNARSGPTTKSAVEWLFVKKGEPVEITA−−−−EYE−−−−−−−Q−−WRQVRDINGE−−−GGWIHS−−−−−SVLSG−−−−−−−−−−−−−KRSVVI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSDKEIELTKSADHKSRVIAKLMPKVRCGLKKC−−KEQ−−−−FCQIT−−−−−−−CKNY−−−−−−−−−−−TGWISKKVIWGVYDD          
fig|315456.7.peg.1543   Rickettsia felis URRWXCal2            KLPIPRFVSIK−−−SNEVNARSGPTTKSAVEWLFVKKGEPVEITA−−−−EYE−−−−−−−Q−−WRQVRDINGE−−−GGWIHS−−−−−SVLSG−−−−−−−−−−−−−KRSVVI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSDKEIELTKSADHKSRVIAKLMPKVRCGLKKC−−KEQ−−−−FCQIT−−−−−−−CKNY−−−−−−−−−−−TGWISKKVIWGVYDD          
fig|444612.3.peg.249   Rickettsia endosymbiont of Ixodes scapularis            KLPIPRFVSIK−−−SNEVNARSGPTTKSAVEWVFVKKGEPVEITA−−−−EYE−−−−−−−Q−−WRQVRDINGE−−−GGWIHS−−−−−SVLSG−−−−−−−−−−−−−KRSVII−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSDKKIELTKSADPKSRVIAKLMPKVRCGLKKC−−KEQ−−−−FCQIT−−−−−−−CKDY−−−−−−−−−−−TGWISKKVIWGVYDD          
fig|293614.5.peg.1310   Rickettsia akari str. Hartford            KLSIPRFVSIK−−−SNEVNARSGPTTKSAVEWVFVKKGEPVEITA−−−−EYE−−−−−−−Q−−WRQVRDINGE−−−GGWIHS−−−−−SVLSG−−−−−−−−−−−−−KRSVII−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSDKEIELTKSVDSKSRVIAKLMPKVRCGLKKC−−KEQ−−−−FCQIT−−−−−−−CKDY−−−−−−−−−−−TGWISKKAIWGVY            
fig|293614.3.peg.1182   Rickettsia akari str. Hartford            KLSIPRFVSIK−−−SNEVNARSGPTTKSAVEWVFVKKGEPVEITA−−−−EYE−−−−−−−Q−−WRQVRDINGE−−−GGWIHS−−−−−SVLSG−−−−−−−−−−−−−KRSVII−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSDKEIELTKSVDSKSRVIAKLMPKVRCGLKKC−−KEQ−−−−FCQIT−−−−−−−CKDY−−−−−−−−−−−TGWISKKAIWGVY            
fig|257363.1.peg.763   Rickettsia typhi str. Wilmington            KLPIPRFVSIK−−−SNEVNVRRGPTTKSAVEWVFIKKGEPVEITA−−−−EYA−−−−−−−Q−−WRQICDINGE−−−CGWIHS−−−−−SVLSS−−−−−−−−−−−−−KRSVII−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSDKEIELTKSADPKSRVIAKLMPKVRCSLKKC−−KEQ−−−−FCQIT−−−−−−−CKDY−−−−−−−−−−−KGWISKNAIWGVY            
fig|257363.4.peg.815   Rickettsia typhi str. Wilmington            KLPIPRFVSIK−−−SNEVNVRRGPTTKSAVEWVFIKKGEPVEITA−−−−EYA−−−−−−−Q−−WRQICDINGE−−−CGWIHS−−−−−SVLSS−−−−−−−−−−−−−KRSVII−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSDKEIELTKSADPKSRVIAKLMPKVRCSLKKC−−KEQ−−−−FCQIT−−−−−−−CKDY−−−−−−−−−−−KGWISKNAIWGVY            
fig|1290429.3.peg.407   Rickettsia prowazekii str. GvF12            KLPIPRFVSIK−−−SNEVNARRGPTTKSAVEWVFIKKGEPVEITA−−−−EYE−−−−−−−Q−−WRQVRDINGE−−−CGWIHS−−−−−SVLSA−−−−−−−−−−−−−KRSVII−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ASDKEIELTKSADPKSRVIAKLMPKVRCSLKKC−−KEE−−−−FCQVT−−−−−−−CKDY−−−−−−−−−−−KGWISKKAIWGVY            
fig|272947.5.peg.845   Rickettsia prowazekii str. Madrid E            KLPIPRFVSIK−−−SNEVNARRGPTTKSAVEWVFIKKGEPVEITA−−−−EYE−−−−−−−Q−−WRQVRDINGE−−−CGWIHS−−−−−SVLSA−−−−−−−−−−−−−KRSVII−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ASDKEIELTKSADPKSRVIAKLMPKVRCSLKKC−−KEE−−−−FCQVT−−−−−−−CKDY−−−−−−−−−−−KGWISKKAIWGVY            
fig|272947.1.peg.763   Rickettsia prowazekii str. Madrid E            KLPIPRFVSIK−−−SNEVNARRGPTTKSAVEWVFIKKGEPVEITA−−−−EYE−−−−−−−Q−−WRQVRDINGE−−−CGWIHS−−−−−SVLSA−−−−−−−−−−−−−KRSVII−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ASDKEIELTKSADPKSRVIAKLMPKVRCSLKKC−−KEE−−−−FCQVT−−−−−−−CKDY−−−−−−−−−−−KGWISKKAIWGVY            
fig|582899.5.peg.3317   Hyphomicrobium denitrificans ATCC 51888           SGLPVPRFVSLK−−−SDRVNLRNGPGTDYPTGWVYRRAGLPLEIVQ−−−−EFE−−−−−−−S−−WRKVRDSEGA−−−TGWVLQ−−−−−SFLSG−−−−−−−−−−−−−RRTALVLPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERKASTKPPLVPIHASDSERSHIVVNVEAGVIADLRTC−−DGR−−−−WCRVT−−−−−−−VDAY−−−−−−−−−−−TGYIEQKKLWGAYEGETI       
fig|384765.3.peg.3776   Labrenzia aggregata IAM 12614          ASGLPVPRFVSLK−−−SDRVNVRIGPSREHDIAWTFVQSGLPVEIVG−−−−EFE−−−−−−−N−−WRRIRDWEGK−−−QGWVFR−−−−−SLLSS−−−−−−−−−−−−−RRTALVTPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKSDRTPLRARSRSDADIVAELDPFVLTTISEC−−AGG−−−−WCRVN−−−−−−−GENY−−−−−−−−−−−DGWLDQTRLFGVYPDELI       
fig|244592.3.peg.2240   Labrenzia alexandrii DFL-11          ATGLPVPRFVSLK−−−SDRVNVRLGPSREHDISWTFVQSGLPVEIIQ−−−−EFE−−−−−−−N−−WRRIRDWEGK−−−QGWVFH−−−−−SLLSG−−−−−−−−−−−−−RRTALVTPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERDNRTPLRARSQSDADIVAELEPFVLTAVGEC−−AGG−−−−WCRVS−−−−−−−GEEF−−−−−−−−−−−NGWLDQTRLFGVYPDELIE      
fig|439495.5.peg.3108   Pseudovibrio sp. JE062          VSGLPVPRFVSLK−−−SDRVNVRNGPSRKHDIGWTFVRSRLPVEVVQ−−−−EYD−−−−−−−D−−WRRIRDWEGK−−−EGWVFK−−−−−TLLTG−−−−−−−−−−−−−YRSALVTPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LVNTVETTPLRKRPGPNEEIVAFLEPLVLAGVVEC−−TDG−−−−YCRIS−−−−−−−GKEF−−−−−−−−−−−EGWVDQSRLFGVYKNETIN      
fig|419610.10.peg.401   Methylobacterium extorquens PA1          VTKLPLPRYASLK−−−TNRVNLREGPSKDHRTLWVFQREGLPVEIVA−−−−EFE−−−−−−−T−−WRRIRDSEGT−−−EGWVLH−−−−−SLLSG−−−−−−−−−−−−−RRTAVVIPPS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GERADSAKATVPLTARADEQSAEQARLQPGVIGSVKGC−−TGS−−−−WCRLVVPLPDKRGD−−V−−−−−−−−−−−DGYIRQSRLWGVYPDERVE      
fig|419610.8.peg.353   Methylobacterium extorquens PA1          VTKLPLPRYASLK−−−TNRVNLREGPSKDHRTLWVFQREGLPVEIVA−−−−EFE−−−−−−−T−−WRRIRDSEGT−−−EGWVLH−−−−−SLLSG−−−−−−−−−−−−−RRTAVVIPPS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GERADSAKATVPLTARADEQSAEQARLQPGVIGSVKGC−−TGS−−−−WCRLVVPLPDKRGD−−V−−−−−−−−−−−DGYIRQSRLWGVYPDERVE      
fig|661410.3.peg.570   Methylobacterium extorquens DM4          VTKLPLPRYASLK−−−TNRVNLREGPSKDHRTLWVFQREGLPVEIVA−−−−EFE−−−−−−−T−−WRRIRDSEGT−−−EGWVLH−−−−−SLLSG−−−−−−−−−−−−−RRTAVVIPPS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GERADSAKATVPLTARADEQSGEQARLQPGVIGSVKGC−−TGS−−−−WCRLVVPLPDKRGD−−V−−−−−−−−−−−DGYIRQSRLWGVYPDERVE      
fig|441620.7.peg.514   Methylobacterium populi BJ001          VTKLPLPRYASLK−−−TNRVNLREGPSKDHRTLWVFQREGLPVEIVA−−−−EFE−−−−−−−T−−WRRIRDSEGT−−−EGWVLH−−−−−SLLSG−−−−−−−−−−−−−RRTAVVIPPS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GERADAAKATVPLNARADEQSGEQARLQPGVIGSVKSC−−TGT−−−−WCRLVVPLPDKRGD−−V−−−−−−−−−−−DGYIRQSRLWGVYPDERVE      
fig|426355.14.peg.2752   Methylobacterium radiotolerans JCM 2831          VTKLPLPRYASLK−−−TDRVNLREGPSKDHRTLWVFQRAGLPVEIVG−−−−EFE−−−−−−−T−−WRRIRDSEGT−−−EGWVLH−−−−−SLLSG−−−−−−−−−−−−−RRTAIV−−NA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GPDKGAEKAAVSLRAKADDGADDEAKLQTGVIGSVKSC−−TGT−−−−WCRMIVALPNKRD−−V−−−−−−−−−−−DGYIRQNRLWGVYPNEVVE      
fig|460265.11.peg.1254   Methylobacterium nodulans ORS 2060          VSGLPMPRYVSLK−−−TDRVNLREGPSKDHRTLWVFQRAGLPVEIVS−−−−EFE−−−−−−−T−−WRRIRDSEGT−−−EGWVLH−−−−−SLLSG−−−−−−−−−−−−−RRTAVVLAQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GDKAAPVPLYAEPEGRGGVVAQLQAGVIGSIKSC−−SGT−−−−WCRLIVALPQKRGD−−V−−−−−−−−−−−DGYLRQDRLWGVYPNEKVE      
fig|426117.3.peg.1968   Methylobacterium sp. 4-46           SGLPVPRYVSLK−−−TDRVNLREGPSKDHRTLWVFQRAGLPVEIVA−−−−EFE−−−−−−−N−−WRRIRDSEGT−−−EGWVLH−−−−−SLLSG−−−−−−−−−−−−−RRTAVVLAP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GDKAAPVPLYAEREGGGGVVAQLQAGVIGSVKSC−−NGT−−−−WCRLIVALPQKRGD−−V−−−−−−−−−−−DGYMRQDRLWGVYPNEKVE      
fig|426117.7.peg.2208   Methylobacterium sp. 4-46           SGLPVPRYVSLK−−−TDRVNLREGPSKDHRTLWVFQRAGLPVEIVA−−−−EFE−−−−−−−N−−WRRIRDSEGT−−−EGWVLH−−−−−SLLSG−−−−−−−−−−−−−RRTAVVLAP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GDKAAPVPLYAEREGGGGVVAQLQAGVIGSVKSC−−NGT−−−−WCRLIVALPQKRGD−−V−−−−−−−−−−−DGYMRQDRLWGVYPNEKVE      
fig|595536.4.peg.1864   Methylosinus trichosporium OB3b          VSGLALPRFVSLK−−−SDRVNLHEGPSKEHPTLWVYERAGLPVEITA−−−−EFE−−−−−−−T−−WRKIRDSEGT−−−EGWVLH−−−−−SLLSG−−−−−−−−−−−−−RRTALVAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KKE−−−PALAYARDRSTPLARLSPGVVANLRLC−−DGS−−−−WCRVS−−−−−−−GDGF−−−−−−−−−−−DGYVHQENLWGVYPGEKID      
fig|395963.13.peg.782   Beijerinckia indica subsp. indica ATCC 9039                                             FQRAGLPVEITA−−−−EFE−−−−−−−T−−WRKIRDSEGS−−−EGWVLH−−−−−SLLSG−−−−−−−−−−−−−RRTALIAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KKGEEFPLYEKPSDHSALRAKLQANVIAGVRRC−−DGT−−−−WCRLT−−−−−−−GDGF−−−−−−−−−−−DGYLQQALLWGVYPDEKIE      
fig|395965.4.peg.2682   Methylocella silvestris BL2          ASGLPIPRYVSLK−−−SDRVNLREGPSKDHRTTWVFLRAGLPVEITA−−−−EFE−−−−−−−I−−WRRVRDSEGS−−−EGWVLH−−−−−SLLSG−−−−−−−−−−−−−RRTALVTPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KKGADSPVYDKPDAKAAVAANLQSNVIANVRSC−−DGS−−−−WCRVW−−−−−−−GDGF−−−−−−−−−−−KGYIEQGDLWGVYPNEKIE      
fig|639283.3.peg.239   Starkeya novella DSM 506          ASGLPVPRFVSLK−−−ADKVNVRSGPTRDHAVAWVFTRAGLPVEITA−−−−EFE−−−−−−−T−−WRRIRDSDGA−−−EGWVYH−−−−−SMLSG−−−−−−−−−−−−−RRTALVSPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KAGEPTPLYADPDKSSAVKAKLEPGVLGKVEHC−−DGK−−−−WCRFF−−−−−−−ENGF−−−−−−−−−−−DGFVAQERLWGVYPGEKIE      
fig|78245.7.peg.4468   Xanthobacter autotrophicus Py2          TSGLPVPRFVSLK−−−ADKVNVRNGPNKDHDVSWVFNRAGLPVEVTA−−−−EFE−−−−−−−T−−WRRIRDADGA−−−EGWVYH−−−−−SMLSL−−−−−−−−−−−−−RRTALVAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKGETVPMRDAPNTDAKVVARLEPSVLGVVKTC−−DGK−−−−FCRLI−−−−−−−GDGF−−−−−−−−−−−DGYVQQSQLFGIYPNEKVE      
fig|438753.4.peg.244   Azorhizobium caulinodans ORS 571           TGLPVPRFVSLK−−−ADRVNVRNGPNRDQDVAWIFTRAGLPVEITA−−−−EFE−−−−−−−T−−WRRIRDADGA−−−EGWVYH−−−−−SMLSG−−−−−−−−−−−−−RRTALVAPW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SKDTTITLRDKPDANARAVARLEANVLGTIKSC−−DGK−−−−WCRIL−−−−−−−GDGF−−−−−−−−−−−DGYVEQNKLWGVYPNEKVD      
fig|666684.3.peg.1676   Afipia sp. 1NLS2          TSGLPVPRYVSLK−−−SDHVNVRVGPTKDQDVSWIYTRAGLPVEVTA−−−−EFE−−−−−−−N−−WRRVRDSEGS−−−EGWVYH−−−−−SLLSG−−−−−−−−−−−−−RRTAVVTMK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TKGELAALRDDPSEDSAVSARLQAGVIAQVKRC−−TGK−−−−WCRIT−−−−−−−GEGF−−−−−−−−−−−DGWIEQQRLWGVYADEKVN      
fig|504832.7.peg.42   Oligotropha carboxidovorans OM5          TSGLPVPRYVSLK−−−SDHVNVRGGPTKDQDVSWIYTRAGLPVEVTA−−−−EFE−−−−−−−N−−WRRVRDSEGS−−−EGWVYH−−−−−SLLSG−−−−−−−−−−−−−RRTAVVIMK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKDELAVLRDRPDEESAVAARLQAGVIAQVKRC−−TGT−−−−WCRIA−−−−−−−GDGF−−−−−−−−−−−DGWIRQQRLWGVYADEKLN      
fig|323098.3.peg.33   Nitrobacter winogradskyi Nb-255          TSGLPVPRYVSLK−−−SDHVNVRAGPTKDNDVAWVYTKAGLPVEITA−−−−EFE−−−−−−−N−−WRRIRDSEGA−−−EGWVYH−−−−−SLLSG−−−−−−−−−−−−−RRTAVVTMK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AKDDFTPLYDRADVQGNVAARLQAGVVTQVKRC−−AAG−−−−WCHVT−−−−−−−GDGF−−−−−−−−−−−DGWIEQQRLWGVYADEKIN      
fig|314253.3.peg.1113   Nitrobacter sp. Nb-311A          TSGLPIPRYVSLK−−−SDHVNVRAGPTKDNDVAWVYTKAGLPVEITA−−−−EFE−−−−−−−N−−WRRIRDSEGA−−−EGWVYH−−−−−SLLSG−−−−−−−−−−−−−RRTAVVTMK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IKGDFAVLYDRADVQGNVAARLQAGVVTQVKHC−−AAG−−−−WCHVA−−−−−−−GDGF−−−−−−−−−−−DGWIEQRRLWGVYADEKIN      
fig|323097.3.peg.315   Nitrobacter hamburgensis X14          ASGLPVPRYVSLK−−−SDHVNVRAGPTKDNDVAWVYTKAGLPVEITA−−−−EFE−−−−−−−N−−WRRIRDSEGA−−−EGWVYH−−−−−SLLSG−−−−−−−−−−−−−RRTAVVTMK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HKDDLAQLYSSADTESAVAARLQAGVVAQVKHC−−AAG−−−−WCHVA−−−−−−−GDGF−−−−−−−−−−−DGWIQQQRLWGVYADEKIN      
fig|224911.5.peg.791   Bradyrhizobium japonicum USDA 110          ASGLPVPRYVSLK−−−SDHVNVRAGPTKDNDVAWVYTRAGLPVEITA−−−−EFE−−−−−−−N−−WRRVRDSEGA−−−EGWVYH−−−−−SLLSG−−−−−−−−−−−−−RRTAVVTMK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HKDELAPIYDRADPDSAVAAKLQAGVVTQVKKC−−SAN−−−−WCRVT−−−−−−−GNGF−−−−−−−−−−−DGWIQQERLWGVYSDEQVN      
fig|395960.3.peg.441   Rhodopseudomonas palustris TIE-1          ASGLPVPRYVSLK−−−SDHVNVRVGPTKDNDVAWVYTRAGLPVEVTA−−−−EFE−−−−−−−N−−WRRVRDSEGA−−−EGWVYH−−−−−SLLSG−−−−−−−−−−−−−RRTAVVTMK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKDGLAPLYESASSGSAVVARLQAGVVAQVKRC−−DMK−−−−WCRIV−−−−−−−GSGF−−−−−−−−−−−DGWIEKLQLWGVYADEQVN      
fig|258594.1.peg.420   Rhodopseudomonas palustris CGA009          ASGLPVPRYVSLK−−−SDHVNVRVGPTKDNDVAWVYTRAGLPVEVTA−−−−EFE−−−−−−−N−−WRRVRDSEGA−−−EGWVYH−−−−−SLLSG−−−−−−−−−−−−−RRTAVVTMK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKDGLAPLYESASSGSAVVARLQAGVVAQVKRC−−DMK−−−−WCRIV−−−−−−−GSGF−−−−−−−−−−−DGWIEKLQLWGVYADEQVN      
fig|652103.3.peg.3991   Rhodopseudomonas palustris DX-1               MPRYVSLK−−−SDHVNVRVGPTKDNDVAWVYTRAGLPVEVTA−−−−EFE−−−−−−−N−−WRRVRDSEGA−−−EGWVYH−−−−−SLLSG−−−−−−−−−−−−−RRTAVVIMK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKDELAPLYERATAGSAVVARLQAGVVAQVRRC−−DMK−−−−WCRIV−−−−−−−GSGF−−−−−−−−−−−DGWIEKLQLWGVYADEQVN      
fig|316057.6.peg.223   Rhodopseudomonas palustris BisB5          ASGLPVPRYVSLK−−−SDHVNVRIGPTKDNDVAWVYTRAGLPVEITA−−−−EFE−−−−−−−N−−WRRVRDSEGA−−−EGWVYH−−−−−SLLSG−−−−−−−−−−−−−RRTAVITMK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKDELATLYEAASTGSAVAARLQAGVVAQIKRC−−DPN−−−−WCRII−−−−−−−GSGF−−−−−−−−−−−DGWIEKQRLWGVYADE         
fig|316058.9.peg.614   Rhodopseudomonas palustris HaA2          TSGLPVPRYVSLK−−−SDHVNVRIGPTKDNDVAWVYTRAGLPVEITA−−−−EFE−−−−−−−N−−WRRVRDSEGA−−−EGWVYH−−−−−SLLSG−−−−−−−−−−−−−RRTAVITMK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKDELATLYESASTDSAVAARLQAGVVAQIKRC−−DAV−−−−WCRIA−−−−−−−GQGF−−−−−−−−−−−DGWIEKQRLWGVYADE         
fig|316056.14.peg.349   Rhodopseudomonas palustris BisB18          ASGLPIPRYVSLK−−−SDHVNVRAGPTKDNDVAWVYTRSGLPVEITA−−−−EYE−−−−−−−N−−WRRVRDSEGA−−−EGWVYH−−−−−SLLSG−−−−−−−−−−−−−RRTAVVTMK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SKDELAPLYDSASVTSPVAARLQAGVLTQVKRC−−AQG−−−−WCRVI−−−−−−−GNGF−−−−−−−−−−−DGWIQQERLWGVYADEKVD      
fig|316055.14.peg.243   Rhodopseudomonas palustris BisA53          TSGLPIPRYVSLK−−−SDHVNVRAGPTKDNDVAWVYTRSGLPVEITA−−−−EYE−−−−−−−N−−WRRVRDSEGA−−−EGWVYH−−−−−SLLSG−−−−−−−−−−−−−RRTAVITMK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKDDLAPVYDEANPASSVAAKLQVGVVAQIKRC−−ASG−−−−WCRVL−−−−−−−GNGF−−−−−−−−−−−EGWIQQERLWGVYADEKVE      
fig|114615.3.peg.68   Bradyrhizobium sp. ORS278          TSGLPVPRYVSLK−−−SDHVNVRAGPTKDNDVAWVYTRSGLPVEITA−−−−EYE−−−−−−−N−−WRRVRDSEGS−−−EGWVYH−−−−−SLLSG−−−−−−−−−−−−−RRTAVVTMK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKDDLAPIYESADATSAVTARLQAGVVAQVKKC−−GNG−−−−WCRVL−−−−−−−GNGF−−−−−−−−−−−EGWIQQQRLWGVYADEQVN      
fig|288000.5.peg.296   Bradyrhizobium sp. BTAi1               MPRYVSLK−−−SDHVNVRAGPTKDNDVAWVYTRSGLPVEITA−−−−EYE−−−−−−−N−−WRRVRDSEGS−−−EGWVYH−−−−−SLLSG−−−−−−−−−−−−−RRTAVVTMK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKDDLAAVYDSPSASGAVTARLQVGVIAQVKKC−−SNG−−−−WCRVL−−−−−−−GNGF−−−−−−−−−−−DGWIEQQRLWGVYADEQVN      
fig|1765.116.peg.6994   Mycobacterium bovis str. 06-1787          TSGLPVPRYVSLK−−−SDHVNVRAGPTKDNDVAWVYTRSGLPVEITA−−−−EYE−−−−−−−N−−WRRVRDSEGS−−−EGWVYH−−−−−SLLSG−−−−−−−−−−−−−RRTAVVTMK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKDDLAAVYDSPSASGAVTARLQVGVIAQVKKC−−SNG−−−−WCRVL−−−−−−−GNGF−−−−−−−−−−−DGWIEQQRLWGVYADEQVN      
fig|288000.8.peg.277   Bradyrhizobium sp. BTAi1          TSGLPVPRYVSLK−−−SDHVNVRAGPTKDNDVAWVYTRSGLPVEITA−−−−EYE−−−−−−−N−−WRRVRDSEGS−−−EGWVYH−−−−−SLLSG−−−−−−−−−−−−−RRTAVVTMK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKDDLAAVYDSPSASGAVTARLQVGVIAQVKKC−−SNG−−−−WCRVL−−−−−−−GNGF−−−−−−−−−−−DGWIEQQRLWGVYADEQVN      
fig|190650.1.peg.3695   Caulobacter crescentus CB15          PSGLEVPRYVSLK−−−YAEVNARNGPDEAHQLLWVYHAKGLPVQVVA−−−−ETR−−−−−−−E−−WRRICDPEGG−−−LAWVHK−−−−−RTTDG−−−−−−−−−−−−−RRSAMR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQPTNLALLSAPKDGAKVNAYLKARAVASLDKC−−ENG−−−−WCRLR−−−−−−−ADGS−−−−−−−−−−−SGWAREGEIWGADPA          
fig|565050.3.peg.3742   Caulobacter crescentus NA1000          PSGLEVPRYVSLK−−−YAEVNARNGPDEAHQLLWVYHAKGLPVQVVA−−−−ETR−−−−−−−E−−WRRICDPEGG−−−LAWVHK−−−−−RTTDG−−−−−−−−−−−−−RRSAMR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQPTNLALLSAPKDGAKVNAYLKARAVASLDKC−−ENG−−−−WCRLR−−−−−−−ADGS−−−−−−−−−−−SGWAREGEIWGADPA          
fig|509190.6.peg.4249   Caulobacter segnis ATCC 21756          PSGLEVPRYVSLK−−−YAEVNARKGPDEAHQLLWVYRAKGLPVQVVA−−−−ETR−−−−−−−E−−WRRICDPEGG−−−LAWVHR−−−−−RTVDG−−−−−−−−−−−−−RRSAMR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQPTNLPLLSAPKDGAKINAYLKSRSVAALDKC−−EDG−−−−WCRLR−−−−−−−ADGA−−−−−−−−−−−SGWAREREIWGADPA          
fig|366602.8.peg.5479   Caulobacter sp. K31          PSGMDVPRYVSLK−−−YGEVNARVGPDEEHRLLWIYKAKGLPVQVVA−−−−ETR−−−−−−−E−−WRRICDPEGG−−−LSWVHK−−−−−RTIDG−−−−−−−−−−−−−RRTAMR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQAAALPLRAQPKANARITAYLAGRATAGLDRC−−EKG−−−−WCRLK−−−−−−−ADGE−−−−−−−−−−−SGWAPESEIWGA             
fig|366602.3.peg.5418   Caulobacter sp. K31          PSGMDVPRYVSLK−−−YGEVNARVGPDEEHRLLWIYKAKGLPVQVVA−−−−ETR−−−−−−−E−−WRRICDPEGG−−−LSWVHK−−−−−RTIDG−−−−−−−−−−−−−RRTAMR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQAAALPLRAQPKANARITAYLAGRATAGLDRC−−EKG−−−−WCRLK−−−−−−−ADGE−−−−−−−−−−−SGWAPESEIWGA             
fig|450851.6.peg.375   Phenylobacterium zucineum HLK1          PSGLPVPRYISLK−−−FGKVNARAGPGDDHRLLWVYRARGLPVQVVA−−−−ETS−−−−−−−E−−WRRICDPEGG−−−LAWVHR−−−−−RVTDG−−−−−−−−−−−−−RRSVMN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LQPAAAPLLRKPKAGAETVAYLRPKAMASLVRC−−QKG−−−−WCKVK−−−−−−−ADRA−−−−−−−−−−−TGWVREGALWG              
fig|573065.5.peg.164   Asticcacaulis excentricus CB 48          PSKQPVPRWASLR−−−SNEVYARSGPTKENKVLWTYRQKNLPVQIIS−−−−ETR−−−−−−−E−−WRMICDPDGG−−−IAWVSR−−−−−SMLKS−−−−−−−−−−−−−QRSVVS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MGTQKIDLLSAAKPTAKVKARLNPRSLAALDKC−−RKG−−−−YCKVS−−−−−−−VGNV−−−−−−−−−−−DGWAPQDRLWGA             
fig|633149.4.peg.586   Brevundimonas subvibrioides ATCC 15264          PTGLDVPRWVSLK−−−SSHVRARQGPGLDYRILWEYRAAGLPVQVIA−−−−ETR−−−−−−−E−−WRKICDPELG−−−VAWINR−−−−−SVVSG−−−−−−−−−−−−−RRGVFN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DTGAEVAVHAARNAQSPVRARFSAHSIVALDDC−−KDG−−−−WCRVR−−−−−−−ARKL−−−−−−−−−−−KGWLPEGAVFGTQP           
fig|391600.3.peg.3151   Brevundimonas sp. BAL3          PTGLEVPRWISLK−−−SSHVRARQGPGLDYPILWEYRAAGLPVQVVA−−−−ETT−−−−−−−E−−WRKICDPDGA−−−VAWIHR−−−−−TVSSG−−−−−−−−−−−−−RRSVFN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSPEEVMIHAGKSQASAVRARLSPRSLVSLDEC−−EDG−−−−WCQVR−−−−−−−ARRL−−−−−−−−−−−RGWVQERAVFG              
fig|314260.3.peg.770   Parvularcula bermudensis HTCC2503          ASGLPIPRFVGLR−−−KDRVRARFGPSFDYPVSYEFSMKGLPLKVIG−−−−EDR−−−−−−−DNIWRRVEDRDGQ−−−RMWIHR−−−−−SMLSA−−−−−−−−−−−−−NSHAVV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QAPEAILRTGPGATNAARARLANGVFLKLETC−−EAG−−−−WCRVH−−−−−−−AGEY−−−−−−−−−−−RGWLPATSLWGAD            
fig|314254.3.peg.2917   Oceanicaulis alexandrii HTCC2633          FSGLPVPRFVSLK−−−FNETRGRAGPSFTHPVAWLYQRKGLPMEVVA−−−−ETP−−−−−−−D−−WRRVRDPEGE−−−EVWMHR−−−−−RTLTG−−−−−−−−−−−−−RRSVW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ASEATRLLSRPDTDASLIADVEAGAVLWLERC−−RAG−−−−WCRLE−−−−−−−ADDR−−−−−−−−−−−RGWARADAFWGVYPEET        
fig|394221.8.peg.3143   Maricaulis maris MCS10          PSGQAVPRFVSLK−−−VDVANGRSGPSSQHPIAWRYLRAGLPMEVIA−−−−ETP−−−−−−−D−−WRRVRDPEGE−−−VTWMHR−−−−−SILSG−−−−−−−−−−−−−RRSVY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TLEETTLHARDSDSSPIEAVAEAGVILSLERC−−RTG−−−−WCRVE−−−−−−−GQGF−−−−−−−−−−−RGWVRPHTLWGVYPQEL        
fig|394221.5.peg.2989   Maricaulis maris MCS10          PSGQAVPRFVSLK−−−VDVANGRSGPSSQHPIAWRYLRAGLPMEVIA−−−−ETP−−−−−−−D−−WRRVRDPEGE−−−VTWMHR−−−−−SILSG−−−−−−−−−−−−−RRSVY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TLEETTLHARDSDSSPIEAVAEAGVILSLERC−−RTG−−−−WCRVE−−−−−−−GQGF−−−−−−−−−−−RGWVRPHTLWGVYPQEL        
fig|582402.5.peg.3139   Hirschia baltica ATCC 49814          FSSMPVPRYASLK−−−YNEVNGRLGPGLEYPIKWQYQRSGLPVLVVK−−−−ESK−−−−−−−N−−WRKIRDPQGD−−−EVWVHQ−−−−−RMLGA−−−−−−−−−−−−−RRTGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSTNVIMYQKPDLETLPIAEVEMGVVADIAEC−−EGD−−−−WCRVD−−−−−−−IDGR−−−−−−−−−−−NGWAYRNSIWGVD            
fig|228405.9.peg.3437   Hyphomonas neptunium ATCC 15444          FSKKPVPRFETLR−−−WAEVNGRTGPSLSSPIAWQYNRKGLPVMVVK−−−−ESG−−−−−−−E−−WYRVRDPAGD−−−EVWIHM−−−−−RMLAE−−−−−−−−−−−−−GTTAMV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TRTAVLASSPDRSGEGVAELGKGVLVEVTAC−−EAA−−−−LCEVE−−−−−−−AAGY−−−−−−−−−−−RGWMPRASLWGASTG          
fig|228405.5.peg.3288   Hyphomonas neptunium ATCC 15444          FSKKPVPRFETLR−−−WAEVNGRTGPSLSSPIAWQYNRKGLPVMVVK−−−−ESG−−−−−−−E−−WYRVRDPAGD−−−EVWIHM−−−−−RMLAE−−−−−−−−−−−−−GTTAMV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TRTAVLASSPDRSGEGVAELGKGVLVEVTAC−−EAA−−−−LCEVE−−−−−−−AAGY−−−−−−−−−−−RGWMPRASLWGASTG          
fig|488538.3.peg.1589   alpha proteobacterium IMCC1322           SGHPIPRFVTIK−−−FEKANLRAGPGSEYPVLWQYRRLGLPVLVDA−−−−EFG−−−−−−−V−−WRKVVDHEGT−−−SGWMRG−−−−−SLLGL−−−−−−−−−−−−−KRNAFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TKGVIKIRAQDNQEARVIAVAERGALLDLETC−−PKQ−−−−WCRVA−−−−−−−HGDI−−−−−−−−−−−TGWVPRHSIWGIMDGEVIN      
fig|272568.12.peg.1247   Gluconacetobacter diazotrophicus PAl 5          VTGLPLPRFAALR−−−ADEVNMRSGPGQRYPIAWVYHRRDLPVKIER−−−−EFD−−−−−−−V−−WRLVEDSDGQ−−−KGWVHQ−−−−−ATLVG−−−−−−−−−−−−−ARTFVVPGLPPVDPASDAAAQGASAQGAPARSGTAPAGGKPAAPTPQPGPGGHFDTTVVGHLADPAAAATIPGAVILRAAADAASAVVAVLKPGSVGTFRTCAAGTT−−−−WCRVS−−−−−−−VQHY−−−−−−−−−−−SGWLDRSSVWGLLPQETI       
fig|272568.11.peg.1995   Gluconacetobacter diazotrophicus PAl 5          VTGLPLPRFAALR−−−ADEVNMRSGPGQRYPIAWVYHRRDLPVKIER−−−−EFD−−−−−−−V−−WRLVEDSDGQ−−−KGWVHQ−−−−−ATLVG−−−−−−−−−−−−−ARTFVVPGLPPVDPASDAAAQGASAQGAPARSGTAPAGGKPAAPTPQPGPGGHFDTTVVGHLADPAAAATIPGAVILRAAADAASAVVAVLKPGSVGTFRTCAAGTT−−−−WCRVS−−−−−−−VQHY−−−−−−−−−−−SGWLDRSSVWGLLPQETI       
fig|714995.3.peg.503   Gluconacetobacter hansenii ATCC 23769          ATGLPLPRFAAFR−−−ADEVNLRAGPGQRYPIDWVYHRRGLPVKIER−−−−EFD−−−−−−−V−−WRLVEDADGQ−−−KGWVHQ−−−−−ATLVG−−−−−−−−−−−−−TRTFVIPGQP−−−−−−−−−−VQGDAQQ−−−−−−−−−−−AGQPSA−−KETDVIGRADSRIIGHVADATQAAAVPGGVMLRGKADPASPIVAVLKPGVVGTLRQCPAGSG−−−−WCQVT−−−−−−−VKQY−−−−−−−−−−−SGWLERQSLWGLLPQEVI       
fig|634452.3.peg.650   Acetobacter pasteurianus IFO 3283-01          VTGLPLPRYAALR−−−ADEVNMRAGPGQRFPIIWVYHRRGMPVRIER−−−−EFD−−−−−−−V−−WRLVEDPTGQ−−−KGWMQQ−−−−−ATLAG−−−−−−−−−−−−−GRDFLVPGEPP−−−−−−−−−−−−−−−−−−−−GDDAPIAPKLDKNGEKIPASGHMDTRVVETVPTLDDAKSIAGAVMLRASASDDAPVVAVLKPGAVGSVKECAAGSA−−−−WCRVS−−−−−−−VKQY−−−−−−−−−−−NGWVPRKAIWGVDADEAVN      
fig|634453.3.peg.650   Acetobacter pasteurianus IFO 3283-03          VTGLPLPRYAALR−−−ADEVNMRAGPGQRFPIIWVYHRRGMPVRIER−−−−EFD−−−−−−−V−−WRLVEDPTGQ−−−KGWMQQ−−−−−ATLAG−−−−−−−−−−−−−GRDFLVPGEPP−−−−−−−−−−−−−−−−−−−−GDDAPIAPKLDKNGEKIPASGHMDTRVVETVPTLDDAKSIAGAVMLRASASDDAPVVAVLKPGAVGSVKECAAGSA−−−−WCRVS−−−−−−−VKQY−−−−−−−−−−−NGWVPRKAIWGVDADEAVN      
fig|290633.1.peg.2184   Gluconobacter oxydans 621H           TGLPLPRYAALR−−−ADKVYMRRGPGDRYPIDWVYHRRGLPVEIER−−−−EFD−−−−−−−V−−WRLVEDSDGQ−−−KGWVHQ−−−−−ATLYG−−−−−−−−−−−−−SRTFVIPGLPP−−−−−−−−−EGVKAQ−−−−−−−−−−−NGEASA−−QEGDHIGKADARILARVATQDEARAHKNDVLLMSHPEEDSTVIAVLQQGTVGNIKLCPQNSQ−−−−WCRVS−−−−−−−VKGY−−−−−−−−−−−EGWLPRRLFWGLLPGETI       
fig|391165.9.peg.2194   Granulibacter bethesdensis CGDNIH1          ATGLPIPRFAALR−−−ADEVNMRVGPDTRYPIEWVYKRRELPVEIVR−−−−EFQ−−−−−−−V−−WRLVQDQEGV−−−KGWVHQ−−−−−ATLTG−−−−−−−−−−−−−RRTFLTIGQTP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VTLRRRADEESSAVAILKPGVVGRIQNCEAKSE−−−−WCQVQ−−−−−−−VKSY−−−−−−−−−−−RGYLRR