(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00015841

fig|344747.3.peg.4635   Planctomyces maris DSM 8797                            GKHVSGRIQAADRDEVAS−−RL−−−−−−−−−−−QDQGLKIARIE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EEESA−−−LAFSMPAVSASAGSQKLSSRDYDVISDHLSDLTRARLPLST−−−GLEAVSYE−−−−−−IE−−−SPR−−−−LR−−SA−−VQNLASQLDAG−−NDLETVL−−ADS−−R−−−−−−−APRELCALV−−−−HAGTRSGKMSEILADYVAHTRQ−−−−−−−−−−ISEMKNQ−−−−−−LLM−−−−−−−ALSYPLILM−−−AFAMLMFLSIML−−−−−−−−W−−−−−ILPAF−−ESIYR−−−−−−−−−−−−−−−−−−−−−−−−EFG−−−−−−IEL−−−−−−PGMT−−−LRLFELSLFL−−−−−−RTQWWWYLPTGLLLAGCYLLLMKTERGQI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WSQ−−−−−−−KIIYR−−−−−−−L−−−P−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IG−−−−−−−−GLLSGLSVSRFSHLL−−−ALLVDNQ−−−−VPFLEALK−−−−MT−−−−−−−−−−GES−−−SSNYEI−−−RNACR−−−−−−−−−−−−RFSES−−−−−−−VSSGQAEIASL−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SLKIFPATFL−−−−−−−−−−−−−−−−−−−−−−QTLASQSGTTSHQG−−−−PRYSVEILNALSD−−−−MLNSQTRVRIT−−FFSSVVEPM−−−−−−−VIIFCGILM−−−GF−−−−LFIAMLAPLIQLLNLL  
fig|344747.3.peg.1823   Planctomyces maris DSM 8797                                                                                                                                                                                                                                                                                IPL−−−−−GPEIDTYA−−−−−−ET−−−QPRK−−−YR−−AR−−LELLSSRLYSG−−VSLSTAL−−SETPGL−−−−−−−VPQSTVVSI−−−−RIGEVSNTLGLALRDAAVQTSK−−−−−−−−−−−−SLKNESGETSATYL−−−−−−−AVYVTVVGTI−−−LFTIAGF−−−IMY−−−−−−−−W−−−−−IIPKF−−KKIFM−−−−−−−−−−−−−−−−−−−−−−−−DFD−−−−−−ANL−−−−−−PTMT−−−LTVINLSDFI−−−−−−IANFFLFLP−−−IFSIPFTLLILIHMGNYFG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WSN−−−−−−−−−−LR−−−−−−−I−−−P−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FT−−−−−−−−TWFPRLNTPDCLRQI−−−AQSISAQ−−−−−−−−QQPQ−−−−IA−−−−−−−−−−LSS−−−ASQYHL−−−WADVR−−−−−−−−−−−−IRSESVKNR−−VNQGENLWASL−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HAKIIS−−−−−−−−−−−−−−−−−−−−−−−−−−RSEAALCVTAERVGN−−LP−−−−EVLRALAL−−−−SIEQRRNRKLR−−VLADLLKPV−−−−−−−IVCTLGLVV−−−GL−−−−FVIALFIPIVQLI     
fig|344747.3.peg.1824   Planctomyces maris DSM 8797                                   IDAENDESARI−−KL−−−−−−−−−−−MEQGLKILRVDLLSSENDIDTRDSEHWEIEEFAEEQLSDFGKAAW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SEESE−−−FVSTLPKVSQPEIDG−−−−−−−−−−−−−−−−−−−−−IPLSA−−−CLLTLAE−−−−−−ET−−−NSRQ−−−LS−−RI−−FQNIANDLEQG−−VIPEHSF−−DRHLKS−−−−−−−IPHHLESLI−−−−LAGAQTKHLESIIEDYIECQRY−−−−−−−−−−LKQSRHK−−−−−−ILI−−−−−−−SLFYSGVLI−−−AVSFLLFYFLMV−−−−−−−−K−−−−−VVANF−−KSIFE−−−−−−−−−−−−−−−−−−−−−−−−GFG−−−−−−TEL−−−−−−PSLT−−−VLAFHISDVFSEYGLQMLGWFLLISIGIWFSFDLFRLQSTRR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RVINK−−−−−−−I−−−P−−−V−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FG−−−−−−−−GILCNTSNAQFCRML−−−ATMTEAR−−−−INLPDAIE−−−−LS−−−−−−−−−−AKT−−−TKDPNL−−−IAGCQ−−−−−−−−−−−−LLKSRAKEG−−LSLSQASSGIS−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FSKGFVHIF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RWQD−−RPDIFIDSLRASSN−−−−IFQAKANMKTS−−SLVFMLQPI−−−−−−−VLAGILIIV−−−SF−−−−PIGAIYLPLIKLLN    
fig|521674.4.peg.1647   Planctomyces limnophilus DSM 3776                                            ISSAAL−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ALN−−−−−−−−−−−QE−−−−−−−−−−−−LALLIRAGIPLEI−−−GFQQLG−−−−−−RGSS−−−−−−S−−−−−−−DLARLAERIGERLQQG−−QALDLAIASENTP−−−−−−−−−EARLYATIV−−−−QLGIRSGRLPEMLESMAHLGDQ−−−−−−−−−−MSAVREE−−−−−−FHR−−−−−−−VAIYPTIVV−−−VLTYLLICGLAI−−−−−−−−W−−−−−FIPRW−−LLTLE−−−−−−−−−−−−−−−−−−−−−−−−MFRIQGGWIEVAL−−−−−−−−−−−−−RLIHDYASY−−−−−−−W−−−−−−−−−−−−−−−−−MPAIPILAMIVLWA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AGRTSIVRAG−−−−−−−−−−−−LLETR−−−−−−−ASVWPGLQV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSGALS−−−−−−−−WLIGLPDAVRWVQWLHICGLLTKEG−−−−LPIEECLK−−−−SS−−−−−−−−−−NYL−−−LGTGRM−−−QQDSR−−−−−−−−−−−−EALQAISAG−−ISPEAALLRI−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DLP−−−−−−−−−−−−−−−−−−−−−−PFVADAIEIGVRTNS−−LP−−−−VALELSTG−−−−VMFRQLQSRLE−−WLSGLIPLV−−−−−−−LTLLIG−−−−−−GGCGVLYVVAVFGPLMV       
fig|1053200.3.peg.645   Bacillus cereus HD73                                                SL−−−−−−−−−−−SDQV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLL−−−−−−−−−−−KR−−−−−−−−−−−−LGELLEKGYSLLQ−−−ALEFLQFQLPVEKKVQ−−−−−−−−−−−−−−−−−−LQRMIEGLKDG−−KSLHDSF−−HQLK−−−−−−−−−FHQDMLSYL−−−−FYAEQHGDISFALQQGSVLLYK−−−−−−−−−−KDKYRRD−−−−−−MMK−−−−−−−IMQYPMFLM−−−FFLLIMLFIFNL−−−−−−−−I−−−−−LLPQV−−EMVYS−−−−−−−−−−−−−−−−−−−−−−−−SFG−−−−−−SNT−−−−−−PLLT−−−EQILSAIKL−−−−−−−−−−−−−−−−−−−−−−−−−LPYI−−−−ILTAIL−−−−−−−−−−−−−−−−−−−−−TVIIGCSLYMLYFR−−KLPHIRQV−−−−−KI−−−−−−−−−−−ML−−R−−−−−−−I−−−P−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IK−−−−−−−−TFLILKHSHYFATQL−−−SGLLNGG−−−−LSVCEALT−−−−IM−−−−−−−−−−MEQ−−−RYHPFF−−−QYEAN−−−−−−−−−−−−RIERQLIGG−−EQLQSIIAKS−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YYE−−−−−−−−−−−−−−−−−−−−−−KELSYVITHGQANGN−−LG−−−−IELGDYSD−−−−LIMEKIERKIK−−HMLVIIQPI−−−−−−−LFTCIGGIV−−−VL−−−−MYLAMIMPMFQMMNSI  
fig|1053233.3.peg.5455   Bacillus cereus VD133                                                SL−−−−−−−−−−−SDQV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLL−−−−−−−−−−−KR−−−−−−−−−−−−LGELLEKGYSLLQ−−−ALEFLQFQLPVEKKVQ−−−−−−−−−−−−−−−−−−LQRMIEGLKDG−−KSLHDSF−−HQLK−−−−−−−−−FHQDMLSYL−−−−FYAEQHGDISFALQQGSVLLYK−−−−−−−−−−KDKYRRD−−−−−−MMK−−−−−−−IMQYPMFLM−−−FFLLIMLFIFNL−−−−−−−−I−−−−−LLPQV−−EMVYS−−−−−−−−−−−−−−−−−−−−−−−−SFG−−−−−−SNT−−−−−−PLLT−−−EHILSAIKL−−−−−−−−−−−−−−−−−−−−−−−−−LPYI−−−−ILTAIL−−−−−−−−−−−−−−−−−−−−−TVIIGCSLYMLYFR−−KLPHIRQV−−−−−KI−−−−−−−−−−−ML−−R−−−−−−−I−−−P−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IK−−−−−−−−TFLILKHSHYFATQL−−−SGLLNGG−−−−LSVCEALT−−−−IM−−−−−−−−−−MEQ−−−RYHPFF−−−QYEAN−−−−−−−−−−−−RIERQLIGG−−EQLQSIIAKS−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YYE−−−−−−−−−−−−−−−−−−−−−−KELSYVITHGQANGN−−LG−−−−IELGDYSD−−−−LIMEKIERKIK−−HMLVIIQPI−−−−−−−LFTCIGGIV−−−VL−−−−MYLAMIMPMFQMMNSI  
fig|526989.3.peg.353   Bacillus cereus F65185                                                SL−−−−−−−−−−−SDQV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLL−−−−−−−−−−−KR−−−−−−−−−−−−LGELLEKGYSLLQ−−−ALEFLQFQLPVEKKVQ−−−−−−−−−−−−−−−−−−LQRMIEGLKDG−−KSLHDSF−−HQLK−−−−−−−−−FHQDMLSYL−−−−FYAEQHGDISFALQQGSALLYK−−−−−−−−−−KDKYRKD−−−−−−MMK−−−−−−−IMQYPMFLM−−−FFLLIMLFIFNL−−−−−−−−I−−−−−LLPQV−−EMVYS−−−−−−−−−−−−−−−−−−−−−−−−SFG−−−−−−SNT−−−−−−PLLT−−−EQILSAIKL−−−−−−−−−−−−−−−−−−−−−−−−−LPYI−−−−ILTAIL−−−−−−−−−−−−−−−−−−−−−TVIIGCSLYMLYFR−−KLPHIRQV−−−−−KI−−−−−−−−−−−ML−−R−−−−−−−I−−−P−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IK−−−−−−−−TFLILKHSHYFATQL−−−SGLLNGG−−−−LSVCEALT−−−−IM−−−−−−−−−−MEQ−−−RYHPFF−−−QYEAN−−−−−−−−−−−−RIERQLIGG−−EQLQSIIAKS−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YYE−−−−−−−−−−−−−−−−−−−−−−KELSYVITHGQANGN−−LG−−−−IELGDYSD−−−−LIMEKIERKIK−−HMLVIIQPI−−−−−−−LFTCIGGIV−−−VL−−−−MYLAMIMPMFQMMNSI  
fig|1053182.3.peg.1288   Bacillus cereus BAG3O-2                                                SL−−−−−−−−−−−SDQV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLL−−−−−−−−−−−KR−−−−−−−−−−−−LGELLEKGYSLLQ−−−ALEFLQFQLPVEKKVQ−−−−−−−−−−−−−−−−−−LQRMIEGLKDG−−KSLHDSF−−HQLK−−−−−−−−−FHQDMLSYL−−−−FYAEQHGDISFALQQGSALLYK−−−−−−−−−−KDKYRKD−−−−−−MMK−−−−−−−IMQYPMFLM−−−FFLLIMLFIFNL−−−−−−−−I−−−−−LLPQV−−EMVYS−−−−−−−−−−−−−−−−−−−−−−−−SFG−−−−−−SNT−−−−−−PLLT−−−EQILSAIKL−−−−−−−−−−−−−−−−−−−−−−−−−LPYI−−−−ILTAIL−−−−−−−−−−−−−−−−−−−−−TVIIGCSLYMLYFR−−KLPHIRQV−−−−−KI−−−−−−−−−−−ML−−R−−−−−−−I−−−P−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IK−−−−−−−−TFLILKHSHYFATQL−−−SGLLNGG−−−−LSVCEALT−−−−IM−−−−−−−−−−MEQ−−−RYHPFF−−−QYEAN−−−−−−−−−−−−RIERQLIGG−−EQLQSIIAKS−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YYE−−−−−−−−−−−−−−−−−−−−−−KELSYVITHGQANGN−−LG−−−−IELGDYSD−−−−LIMEKMERKIK−−HMLVIIQPI−−−−−−−LFTCIGGIV−−−VL−−−−MYLAMIMPMFQMMNSI  
fig|714359.3.peg.4189   Bacillus thuringiensis BMB171                                                SL−−−−−−−−−−−SDQV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLL−−−−−−−−−−−KR−−−−−−−−−−−−LGELLEKGYSLLQ−−−ALEFLQFQLPVEKKVQ−−−−−−−−−−−−−−−−−−LQRMIEGLKDG−−KSLHDSF−−HQLK−−−−−−−−−FHQDMLSYL−−−−FYAEQHGDISFALQQGSGLLYK−−−−−−−−−−KDKYRRD−−−−−−MMK−−−−−−−IMHYPMFLM−−−FFLLIMLFIFKL−−−−−−−−I−−−−−LLPQV−−EMVYS−−−−−−−−−−−−−−−−−−−−−−−−SFG−−−−−−SNT−−−−−−PLLT−−−EKILSAIKL−−−−−−−−−−−−−−−−−−−−−−−−−LPYI−−−−ILTAIL−−−−−−−−−−−−−−−−−−−−−TVIIGGILYMLYFR−−KLPHIRQV−−−−−KI−−−−−−−−−−−ML−−R−−−−−−−I−−−P−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IK−−−−−−−−TFLILKHSHYFATQL−−−SGLLNGG−−−−LSVCEALT−−−−IM−−−−−−−−−−MEQ−−−RYHPFF−−−KYEAS−−−−−−−−−−−−WIERQLIGG−−EQLHSIIAKS−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YYE−−−−−−−−−−−−−−−−−−−−−−KELSYVITHGQANGN−−LG−−−−IELGDYSD−−−−LIMEKMERKIK−−HMLVIIQPI−−−−−−−LFTCIGGIV−−−VL−−−−MYLAMIMPMFQMMNSI  
fig|718222.3.peg.1462   Bacillus cereus TIAC219                                                                V−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLL−−−−−−−−−−−KR−−−−−−−−−−−−LGELLEKGYSLLQ−−−ALEFLQFQLPVEKKVQ−−−−−−−−−−−−−−−−−−LQSMVEGLKDG−−KSLHDSF−−HQLR−−−−−−−−−FHQDMLSYL−−−−FYAEQHGDISFALQQGSALLYK−−−−−−−−−−KDKYRRD−−−−−−MMK−−−−−−−IMQYPMFLV−−−FFLLIMLFIFNL−−−−−−−−I−−−−−LLPQV−−EMVYS−−−−−−−−−−−−−−−−−−−−−−−−SFG−−−−−−SNT−−−−−−PLLT−−−EQILSAIKM−−−−−−−−−−−−−−−−−−−−−−−−−LPYI−−−−ILTAIV−−−−−−−−−−−−−−−−−−−−−TVIIGCSLYMLYFR−−KLPHIRQV−−−−−KI−−−−−−−−−−−MH−−R−−−−−−−I−−−P−−−F−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IK−−−−−−−−TFLILKHSHYFATQL−−−SGLLNGG−−−−LSVCEALT−−−−IM−−−−−−−−−−MEQ−−−RYHPFF−−−QYEAS−−−−−−−−−−−−RIERQLIGG−−EQLQSIIAKS−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YYE−−−−−−−−−−−−−−−−−−−−−−KELSYVITHGQANGN−−LA−−−−IELGDYSD−−−−LIMEKMERKIK−−HMVVIIQPI−−−−−−−LFTCIGGIV−−−VL−−−−MYLAMIMPMFQMMNSI  
fig|527020.3.peg.1482   Bacillus thuringiensis IBL 4222                                                                V−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLL−−−−−−−−−−−KR−−−−−−−−−−−−LGELLEKGYSLLQ−−−ALEFLQFQLPVEKKVQ−−−−−−−−−−−−−−−−−−LQRMVEGLKDG−−KSLHDSF−−HQLR−−−−−−−−−FHQDMLSYL−−−−FYAEQHGDISFALQQGSALLYK−−−−−−−−−−KDKYRRD−−−−−−MMK−−−−−−−IMQYPMFLV−−−FFLLIMLFIFNL−−−−−−−−I−−−−−LLPQV−−EMVYS−−−−−−−−−−−−−−−−−−−−−−−−SFG−−−−−−SNT−−−−−−PLLT−−−EQILSAIKM−−−−−−−−−−−−−−−−−−−−−−−−−LPYI−−−−ILTAIV−−−−−−−−−−−−−−−−−−−−−TVIIGCSLYMLYFR−−KLPHIRQV−−−−−KI−−−−−−−−−−−MH−−R−−−−−−−I−−−P−−−F−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IK−−−−−−−−TFLILKHSHYFATQL−−−SGLLNGG−−−−LSVCEALT−−−−IM−−−−−−−−−−MEQ−−−RYHPFF−−−QYEAS−−−−−−−−−−−−RIERQLIGG−−EQLQSIIAKS−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YYE−−−−−−−−−−−−−−−−−−−−−−KELSYVITHGQANGN−−LA−−−−IELGDYSD−−−−LIMEKMERKIK−−HMVVIIQPI−−−−−−−LFTCIGGIV−−−VL−−−−MYLAMIMPMFQMMNSI  
fig|526983.3.peg.3328   Bacillus cereus Rock3-28                                                             SEQL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLL−−−−−−−−−−−KR−−−−−−−−−−−−LGELLEKGYSLLQ−−−ALEFLRFQLPLEKKVQ−−−−−−−−−−−−−−−−−−LQHMIEGLKEG−−RSLHDSF−−HQLM−−−−−−−−−FHQEMLSYL−−−−FYAEKHGDISFALQQGSALLYK−−−−−−−−−−KDKYRKD−−−−−−MMK−−−−−−−IMQYPMLLA−−−FFLMIMLAVFNL−−−−−−−−F−−−−−LLPQV−−EMVYS−−−−−−−−−−−−−−−−−−−−−−−−SFG−−−−−−STT−−−−−−PLFT−−−EQILSVIKR−−−−−−−−−−−−−−−−−−−−−−−−−IPYI−−−−IFSGIL−−−−−−−−−−−−−−−−−−−−−IFIIGCSVYLFYFR−−KLPHIEQV−−−−−KI−−−−−−−−−−−ML−−R−−−−−−−I−−−P−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IK−−−−−−−−VFLILKHSHYFSTQL−−−SGLLYGG−−−−LSVLEALT−−−−IM−−−−−−−−−−MEQ−−−KYNRFF−−−QYEAA−−−−−−−−−−−−RIERQLIAG−−ESLQSIIAKS−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YYE−−−−−−−−−−−−−−−−−−−−−−KELSYIITHGQANGN−−LA−−−−VELEDYSD−−−−LVIEKMEQKMK−−RMLVIIQPI−−−−−−−LFTCIGGIV−−−VL−−−−MYLAMIMPMFQMMNSI  
fig|526988.3.peg.4646   Bacillus cereus Rock4-18                                                             SEQL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLL−−−−−−−−−−−KR−−−−−−−−−−−−LGELLEKGYSLLQ−−−ALEFLRFQLPIEKKVQ−−−−−−−−−−−−−−−−−−LQHMIEGLKEG−−RSLHDSF−−HQLM−−−−−−−−−FHQEMLSYL−−−−FYAEKHGDISFALQQGSALLYK−−−−−−−−−−KDKYRKD−−−−−−MMK−−−−−−−IMQYPMLLA−−−FFLMIMLAVFNL−−−−−−−−I−−−−−LLPQV−−EMVYS−−−−−−−−−−−−−−−−−−−−−−−−SFG−−−−−−STA−−−−−−PLFT−−−EQILSAIKR−−−−−−−−−−−−−−−−−−−−−−−−−IPYI−−−−IFSGIL−−−−−−−−−−−−−−−−−−−−−IFIIGCSVYLFYFR−−KLPHIEQV−−−−−KI−−−−−−−−−−−ML−−R−−−−−−−I−−−P−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IK−−−−−−−−VFLILKHSHYFSTQL−−−SGLLYGG−−−−LSVLEALT−−−−IM−−−−−−−−−−MEQ−−−KYNRFF−−−QYEAA−−−−−−−−−−−−RIERQLIAG−−ESLQSIIAKS−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YYE−−−−−−−−−−−−−−−−−−−−−−KELSYIIRHGQANGN−−LA−−−−VELEDYSD−−−−LVIEKMEQKMK−−RMLVIIQPI−−−−−−−LFTCIGGIV−−−VL−−−−MYLAMIMPMFQMMNSI  
fig|1053212.3.peg.4062   Bacillus cereus HuB5-5                                                             SEQL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLL−−−−−−−−−−−KR−−−−−−−−−−−−LGELLEKGYSLLQ−−−ALEFLRFQLPLEKKVQ−−−−−−−−−−−−−−−−−−LQHMIEGLKEG−−RSLHDSF−−HQLM−−−−−−−−−FHQEMLSYL−−−−FYAEKHGDISFALQQGSALLYK−−−−−−−−−−KDKYRKD−−−−−−MMK−−−−−−−IMQYPMLLA−−−FFLMIMLAVFNL−−−−−−−−I−−−−−LLPQV−−EMVYS−−−−−−−−−−−−−−−−−−−−−−−−SFG−−−−−−STA−−−−−−PLFT−−−EQILSAIKR−−−−−−−−−−−−−−−−−−−−−−−−−IPYI−−−−IFSGIL−−−−−−−−−−−−−−−−−−−−−IFIIGCSVYLFYFR−−KLPHIEQV−−−−−KI−−−−−−−−−−−ML−−R−−−−−−−I−−−P−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IK−−−−−−−−VFLILKHSHYFSTQL−−−SGLLYGG−−−−LSVLEALT−−−−IM−−−−−−−−−−MEQ−−−KYNRFF−−−QYEAA−−−−−−−−−−−−RIERQLIAG−−ESLQSIIAKS−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YYE−−−−−−−−−−−−−−−−−−−−−−KELSYIIRHGQANGN−−LA−−−−VELEDYSD−−−−LVIEKMEQKMK−−RMLVIIQPI−−−−−−−LFTCIGGIV−−−VL−−−−MYLAMIMPMFQMMNSI  
fig|315730.5.peg.4654   Bacillus weihenstephanensis KBAB4                                           FKRKWSL−−−−−−−−−−−SDQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LLC−−−−−−−−−−−KR−−−−−−−−−−−−LSDLLEKGYSLLQ−−−ALEFLQLQLPLGKKLQ−−−−−−−−−−−−−−−−−−LQRMIEGLKNG−−QSLHASF−−HQLM−−−−−−−−−FHSEMLSYL−−−−FYAERHGDISFALQQGSVLLYK−−−−−−−−−−KDKYRKD−−−−−−MMK−−−−−−−VMRYPMFLS−−−FFLMIMLSVFNL−−−−−−−−I−−−−−LLPQF−−EMMYS−−−−−−−−−−−−−−−−−−−−−−−−SLR−−−−−−STA−−−−−−PPLT−−−EQILVAIKL−−−−−−−−−−−−−−−−−−−−−−−−−LPYF−−−−IYMIVL−−−−−−−−−−−−−−−−−−−−−IVITGFSIYIFYFR−−KLPPTQKV−−−−−KI−−−−−−−−−−−MI−−R−−−−−−−I−−−P−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MK−−−−−−−−TFLILNHSHYFSTQL−−−SGLLHGG−−−−LSVHEALT−−−−IM−−−−−−−−−−MKQ−−−NYHPFF−−−QYEAD−−−−−−−−−−−−RIERQLIAG−−EPLQSIIDKS−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YYE−−−−−−−−−−−−−−−−−−−−−−KELSYIITHGQANGN−−LA−−−−NELGDYSE−−−−LIIEKVEQKIK−−RMLFVIQPI−−−−−−−LFTCLGVIV−−−IL−−−−MYLAMIMPMFQMMNSI  
fig|315749.4.peg.2992   Bacillus cereus subsp. cytotoxis NVH 391-98                                          FNRKKWRL−−−−−−−−−−−DEQV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MLL−−−−−−−−−−−KR−−−−−−−−−−−−LGDLLEKGYSLLQ−−−ALEFLQFQLSSQKRLQ−−−−−−−−−−−−−−−−−−LQHMTEELKNG−−QSLHDAF−−HQLM−−−−−−−−−FHPDILSYL−−−−FYAQKHGDISFALRQGSLLLQR−−−−−−−−−−KNKHQKE−−−−−−MIK−−−−−−−VLRYPIFLS−−−VFLIGILAVFHF−−−−−−−−I−−−−−LLPQF−−EILYS−−−−−−−−−−−−−−−−−−−−−−−−SLR−−−−−−TST−−−−−−TSFT−−−DSIISFIQT−−−−−−−−−−−−−−−−−−−−−−−−−LPYI−−−−IAGFFL−−−−−−−−−−−−−−−−−−−−−TVLVGFCVYVFYLR−−KLPPVQRV−−−−−NI−−−−−−−−−−−LL−−R−−−−−−−I−−−P−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SK−−−−−−−−TFLISTHSHYLSVQL−−−SGLLQGG−−−−LSVLEALT−−−−LM−−−−−−−−−−SKQ−−−RHHPFF−−−QYEAA−−−−−−−−−−−−RIEERLMAG−−EPLDSIIMKS−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YYE−−−−−−−−−−−−−−−−−−−−−−ADLSYVIAHGQKNGN−−LA−−−−AELGDYSE−−−−LMIEKMEGKMN−−RIFVVIQPL−−−−−−−LFVCIGIIV−−−VF−−−−MYLAMIMPMFQMMNSI  
fig|315749.8.peg.3079   Bacillus cytotoxicus NVH 391-98                                          FNRKKWRL−−−−−−−−−−−DEQV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MLL−−−−−−−−−−−KR−−−−−−−−−−−−LGDLLEKGYSLLQ−−−ALEFLQFQLSSQKRLQ−−−−−−−−−−−−−−−−−−LQHMTEELKNG−−QSLHDAF−−HQLM−−−−−−−−−FHPDILSYL−−−−FYAQKHGDISFALRQGSLLLQR−−−−−−−−−−KNKHQKE−−−−−−MIK−−−−−−−VLRYPIFLS−−−VFLIGILAVFHF−−−−−−−−I−−−−−LLPQF−−EILYS−−−−−−−−−−−−−−−−−−−−−−−−SLR−−−−−−TST−−−−−−TSFT−−−DSIISFIQT−−−−−−−−−−−−−−−−−−−−−−−−−LPYI−−−−IAGFFL−−−−−−−−−−−−−−−−−−−−−TVLVGFCVYVFYLR−−KLPPVQRV−−−−−NI−−−−−−−−−−−LL−−R−−−−−−−I−−−P−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SK−−−−−−−−TFLISTHSHYLSVQL−−−SGLLQGG−−−−LSVLEALT−−−−LM−−−−−−−−−−SKQ−−−RHHPFF−−−QYEAA−−−−−−−−−−−−RIEERLMAG−−EPLDSIIMKS−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YYE−−−−−−−−−−−−−−−−−−−−−−ADLSYVIAHGQKNGN−−LA−−−−AELGDYSE−−−−LMIEKMEGKMN−−RIFVVIQPL−−−−−−−LFVCIGIIV−−−VF−−−−MYLAMIMPMFQMMNSI  
fig|592022.4.peg.4480   Bacillus megaterium DSM319                                      GVKTNRQKRWSL−−−−−−−−−−−AQQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KIL−−−−−−−−−−−KQ−−−−−−−−−−−−VSKLLEKGYTLSQ−−−ALSFLTFQVSNKEKTD−−−−−−−−−−−−−−−−−−IEKCLEQLKRG−−ESLHDAF−−VKLQ−−−−−−−−−FHRDILSYL−−−−YFAEQHGNLQFALKESSSMIEE−−−−−−−−−−KVRHRKK−−−−−−FQK−−−−−−−LVQYPVLLL−−−LFILSILFVLST−−−−−−−−V−−−−−LLPQF−−EALYL−−−−−−−−−−−−−−−−−−−−−−−−SFG−−−−−−NKQ−−−−−−SSFI−−−LLFMQAMSF−−−−−−−−−−−−−−−−−−−−−−−−−FPFV−−−−LPAVIS−−−−−−−−−−−−−−−−−−−−−MPIILYLFYVIYIK−−KLPPVIQM−−−−−QL−−−−−−−−−−−FM−−R−−−−−−−V−−−P−−−V−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IR−−−−−−−−TFTRLFNSYFFSVHM−−−SNLLNGG−−−−LSIYECFA−−−−LF−−−−−−−−−−QKQ−−−EHHPFF−−−QVEAF−−−−−−−−−−−−AFTDQLSSG−−MRLDHIVSAK−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HYE−−−−−−−−−−−−−−−−−−−−−−KDLAHVIVHGQQNGE−−LS−−−−QELYDYSL−−−−FMMERMEQFIF−−RILKYVQPL−−−−−−−TFLFIGIVI−−−LL−−−−MYMSVMLPMLEVMSSL  
fig|491915.4.peg.925   Anoxybacillus flavithermus WK1                                                SL−−−−−−−−−−−QEQS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SFF−−−−−−−−−−−IQ−−−−−−−−−−−−LGKLLSKGYSLAQ−−−AIEFLQIQQPVAKQKD−−−−−−−−−−−−−−−−−−LDDCMQALRAG−−VPVHEAF−−SRMQ−−−−−−−−−FHSHLLGYI−−−−FFAEQHGQLAYGFIEAGEIGQM−−−−−−−−−−RAHYVEQ−−−−−−VKR−−−−−−−MLRYPLFLF−−−SFCIVMFFIFQQ−−−−−−−−V−−−−−LAPQF−−SHLLS−−−−−−−−−−−−−−−−−−−−−−−−SFH−−−−−−ARS−−−−−−−AFS−−−TFIFSVAVW−−−−−−−−−−−−−−−−−−−−−−−−−LPRI−−−−FSIALI−−−−−−−−−−−−−−−−−−−−−VFIFFVLFYFFVIR−−SWPIDKQM−−−−−NL−−−−−−−−−−−FM−−N−−−−−−−I−−−P−−−I−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VR−−−−−−−−SWIVSFHTQVFSLQL−−−SHLLKGG−−−−LSIYEAVQ−−−−IF−−−−−−−−−−EQQ−−−SHLPLL−−−REEAK−−−−−−−−−−−−VMKQKLCAG−−EKLDEIIEQR−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YYE−−−−−−−−−−−−−−−−−−−−−−KELPFVIRHGQSNGE−−LV−−−−QELFHYSQ−−−−FSLQKLESRLK−−KIVYVIQPL−−−−−−−LLSLIGIFI−−−VL−−−−MYMAMLWPIFQLLNHM  
fig|495036.3.peg.1418   Geobacillus sp. G11MC16                                                PL−−−−−−−−−−−AEQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LFF−−−−−−−−−−−TR−−−−−−−−−−−−LGRLLERGYPLGQ−−−ALEFLAIQAPMKRRLE−−−−−−−−−−−−−−−−−−LERCLQQLRAG−−LPLFAAI−−EELP−−−−−−−−−VDRLAVSLL−−−−FFAERHGDLPRGMAEAGAALAQ−−−−−−−−−−KARFGEQ−−−−−−LRR−−−−−−−FGRYPLFLF−−−ALLIVMLLLMER−−−−−−−−W−−−−−LLPQF−−ERTAA−−−−−−−−−−−−−−−−−−−−−−−−ALS−−−−−−PEN−−−−−−−EQT−−−SLLIALIAH−−−−−−−−−−−−−−−−−−−−−−−−−APMA−−−−LVVIAS−−−−−−−−−−−−−−−−−−−−−FAIFSWLFYAVFFR−−RWPIARQL−−−−−QL−−−−−−−−−−−SL−−S−−−−−−−I−−−P−−−W−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CA−−−−−−−−SVVKLLVTYVMARQL−−−GRLLQAG−−−−LSVYEALG−−−−VF−−−−−−−−−−SEP−−−FSWPFL−−−QMEGK−−−−−−−−−−−−RIRDGLVKG−−MPLDHLVSVV−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YYE−−−−−−−−−−−−−−−−−−−−−−PELALVIRHGQSNGE−−LG−−−−KELEHYGE−−−−FLLQVIEKKLE−−TALKLVQPL−−−−−−−LLSAVGVLV−−−VG−−−−MYLAILLPMFSMLN    
fig|420246.7.peg.2501   Geobacillus thermodenitrificans NG80-2                                                PL−−−−−−−−−−−AEQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LFF−−−−−−−−−−−AR−−−−−−−−−−−−LGRLLERGYPLGQ−−−ALEFLAIQAPMKRRLE−−−−−−−−−−−−−−−−−−LERCLQQLRAG−−LPLFAAI−−EELP−−−−−−−−−VDRLAVSLL−−−−FFAERHGDLPRGMAEAGAALAQ−−−−−−−−−−KARFGEQ−−−−−−LRR−−−−−−−FGRYPLFLF−−−ALLIVMLLLMER−−−−−−−−W−−−−−LLPQF−−ERTAA−−−−−−−−−−−−−−−−−−−−−−−−ALS−−−−−−PEN−−−−−−−EQT−−−SLLIALIAH−−−−−−−−−−−−−−−−−−−−−−−−−APMA−−−−LVVIAS−−−−−−−−−−−−−−−−−−−−−FAIFSWLFYAVFFR−−RWPIARQL−−−−−QL−−−−−−−−−−−SL−−S−−−−−−−I−−−P−−−W−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CA−−−−−−−−SVVKLLVTYVMARQL−−−GRLLQAG−−−−LSVYEALG−−−−VF−−−−−−−−−−SEP−−−FSWPFL−−−QMEGK−−−−−−−−−−−−RIRDGLVKG−−MTLDHLVSVV−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YYE−−−−−−−−−−−−−−−−−−−−−−PELALVIRHGQSNGE−−LG−−−−KELEHYGE−−−−FLLQVIEKKLE−−TALKLVQPL−−−−−−−LLSAVGVLV−−−VG−−−−MYLAILLPMFSMLN    
fig|550542.3.peg.1314   Geobacillus sp. Y412MC52                                                                A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LFF−−−−−−−−−−−TR−−−−−−−−−−−−LGRLLERGYPLGQ−−−ALEFLAIQAPTHRRLE−−−−−−−−−−−−−−−−−−IERCLQQLRAG−−LPLFAAV−−EALS−−−−−−−−−VDRMAVNLL−−−−FFAERHGDLPRGMAETGETLAQ−−−−−−−−−−KARFHEQ−−−−−−LRR−−−−−−−FSRYPMFLL−−−SLLIIMLVLMEW−−−−−−−−W−−−−−LLPQF−−ERAAA−−−−−−−−−−−−−−−−−−−−−−−−AFS−−−−−−PQR−−−−−−−GHT−−−AWLLAVVAH−−−−−−−−−−−−−−−−−−−−−−−−−APMA−−−−MAAIAV−−−−−−−−−−−−−−−−−−−−−LAVFSGLFYTACFR−−RWPVSRKL−−−−−QF−−−−−−−−−−−AL−−R−−−−−−−I−−−P−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LA−−−−−−−−SFLRLFVTCLTARQL−−−GRLLQAG−−−−LSVYDALG−−−−VF−−−−−−−−−−SEP−−−SSWPFL−−−QMEGR−−−−−−−−−−−−RLRDGLMKG−−MTLDGLIGAA−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YYE−−−−−−−−−−−−−−−−−−−−−−QELALVIRHGQSNGE−−LG−−−−KELEHYSE−−−−FLLQVMEQRIE−−SVLKCMQPL−−−−−−−LLAVVGSFV−−−VG−−−−MYLAILLPMFSMLN    
fig|471223.3.peg.2497   Geobacillus sp. WCH70                                            KRKWPL−−−−−−−−−−−RQQG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AFL−−−−−−−−−−−VR−−−−−−−−−−−−LGDLLEKGYSLSQ−−−AIEFLEIQQPLSRRSD−−−−−−−−−−−−−−−−−−LQHCLSHLRSG−−LPFYQSL−−APLH−−−−−−−−−FHREAIGYL−−−−FFAEQHGDLSHGIAEAGKMLLH−−−−−−−−−−KAEYLQR−−−−−−FRK−−−−−−−TSSYPLFLL−−−FFMVLMLAIVQH−−−−−−−−V−−−−−LLPQF−−FQFSA−−−−−−−−−−−−−−−−−−−−−−−−SLS−−−−−−SS−−−−−−−−−SIT−−−SIFIQVVSI−−−−−−−−−−−−−−−−−−−−−−−−−IPNM−−−−FGVLGV−−−−−−−−−−−−−−−−−−−−−FAIACFLLYISWFQ−−KLEIPTQI−−−−−NI−−−−−−−−−−−IM−−K−−−−−−−I−−−P−−−F−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IR−−−−−−−−SFAKLYFTHMFAMQL−−−GHLLQGG−−−−LSIYESLQ−−−−IF−−−−−−−−−−ERQ−−−EKLPFL−−−REEGK−−−−−−−−−−−−RMKQQLVKG−−ISLDAIVASR−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YYE−−−−−−−−−−−−−−−−−−−−−−QELALVVRHGQSNGE−−LA−−−−KELSHYSE−−−−IVFQTMEDRIE−−TSMKLVQPI−−−−−−−LLSFVGILV−−−IC−−−−MYLAILLPMFSMMNNL  
fig|581103.5.peg.1205   Geobacillus sp. Y4.1MC1                                            KRKWSL−−−−−−−−−−−RQQG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TFL−−−−−−−−−−−VR−−−−−−−−−−−−LGNMLDKGYSLSQ−−−AIEFLEMQQPLSHRRD−−−−−−−−−−−−−−−−−−LQRCLDHLRSG−−LPFYQSL−−DALH−−−−−−−−−FHREAIGCL−−−−FFAEQHGDLPHGIAEAGKMLLH−−−−−−−−−−KADYLQR−−−−−−LRK−−−−−−−TSSYPLLLL−−−LFMVMMLAMVQH−−−−−−−−M−−−−−LLPQF−−FKFSA−−−−−−−−−−−−−−−−−−−−−−−−SFA−−−−−−SSS−−−−−−PSFT−−−VFFLQIISF−−−−−−−−−−−−−−−−−−−−−−−−−IPDM−−−−FLIFCI−−−−−−−−−−−−−−−−−−−−−LCIGCFCLYVSWFQ−−KLTVAAQI−−−−−RI−−−−−−−−−−−VM−−K−−−−−−−I−−−P−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IR−−−−−−−−SFARLYFTHMFATQL−−−GHLLQSG−−−−LSIYESLQ−−−−VF−−−−−−−−−−ARQ−−−KKLAFL−−−QEEGK−−−−−−−−−−−−RMKEQLVKG−−IALDVILSSR−−M−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YYE−−−−−−−−−−−−−−−−−−−−−−QELALVVRHGQSNGE−−LA−−−−KELSHYGE−−−−FIFQTMEERIE−−KWMKFIQPI−−−−−−−LLSFVGVLV−−−IC−−−−MYLAILLPMFSMMSHL  
fig|634956.3.peg.298   Geobacillus thermoglucosidasius C56-YS93                                            KRKWSL−−−−−−−−−−−RQQG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TFL−−−−−−−−−−−VR−−−−−−−−−−−−LGNMLDKGYSLSQ−−−AIEFLEMQQPLSHRRD−−−−−−−−−−−−−−−−−−LQRCLDHLRSG−−LPFYQSL−−DALH−−−−−−−−−FHREAIGCL−−−−FFAEQHGDLPHGIAEAGKMLLH−−−−−−−−−−KADYLQR−−−−−−LRK−−−−−−−TSSYPLLLL−−−LFMVMMLAMVQH−−−−−−−−M−−−−−LLPQF−−FKFSA−−−−−−−−−−−−−−−−−−−−−−−−SFA−−−−−−SSS−−−−−−PSFT−−−VFFLQIISF−−−−−−−−−−−−−−−−−−−−−−−−−IPDM−−−−FLVFCI−−−−−−−−−−−−−−−−−−−−−LCIGCFCLYVSWFQ−−KLTVAAQI−−−−−RI−−−−−−−−−−−IM−−K−−−−−−−I−−−P−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IR−−−−−−−−SFARLYFTHMFATQL−−−GHLLQSG−−−−LSIYESLQ−−−−VF−−−−−−−−−−ARQ−−−EKLAFL−−−QEEGK−−−−−−−−−−−−RMKEQLVKG−−IALDVILSSR−−M−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YYE−−−−−−−−−−−−−−−−−−−−−−QELALVVRHGQSNGE−−LA−−−−KELSHYGE−−−−FIFQTMEERIE−−KWMKFIQPI−−−−−−−LLSFVGVLV−−−IC−−−−MYLAILLPMFSMMSHL  
fig|655816.3.peg.2494   Bacillus subtilis subsp. spizizenii str. W23                                                KL−−−−−−−−−−−KDQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QLL−−−−−−−−−−−KR−−−−−−−−−−−−LGEMTEGGYTLLD−−−GIRLMELQMNKRQVAD−−−−−−−−−−−−−−−−−−LADAITRLREG−−APFYQVL−−KSLS−−−−−−−−−FHKEAVGIC−−−−YFAEIHGELPASMIQSGELLER−−−−−−−−−−KIAQADQ−−−−−−LKR−−−−−−−VLRYPLFLI−−−FTVAVMFYMLQA−−−−−−−−V−−−−−IIPQF−−SGIYQ−−−−−−−−−−−−−−−−−−−−−−−−SMN−−−−−−MET−−−−−−TRST−−−DMLFAFFQH−−−−−−−−−−−−−−−−−−−−−−−−−IDLV−−−−IILLAL−−−−−−−−−−−−−−−−−−−−−FAAGIGLYYWLVFK−−KKSPARQM−−−−−LI−−−−−−−−−−−WV−−R−−−−−−−I−−−P−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VG−−−−−−−−NLVRLFNSYFFSLQL−−−SSLLQSG−−−−LSIYDSLN−−−−AF−−−−−−−−−−KHQ−−−TFLPFY−−−RCEAE−−−−−−−−−−−−QVIERLKAG−−ESIETAICES−−P−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YYE−−−−−−−−−−−−−−−−−−−−−−TDFSKVISHGQLSGR−−LD−−−−RELFTYSQ−−−−FILQRLEHKAQ−−KWTGILQPM−−−−−−−IYGFVAAMI−−−LI−−−−VYLSMLLPMYQMMNQM  
fig|66692.6.peg.2672   Bacillus clausii KSM-K16                                                                                                                                                                                                                                             FL−−−−−−−−−−−KR−−−−−−−−−−−−LGELLNKGYEMDQ−−−ALSFLAVHASRELQGK−−−−−−−−−−−−−−−−−−ITGLKKDLREG−−KTLWQSI−−EPFS−−−−−−−−−LPGEAQSFV−−−−YFYEEQGELAEGLVSAAQLAEK−−−−−−−−−−RAYTKKQ−−−−−−LQK−−−−−−−LLRYPIFLL−−−WGAAVVLIVLNQ−−−−−−−−F−−−−−VVPHF−−KSLYA−−−−−−−−−−−−−−−−−−−−−−−−TME−−−−−−SAP−−−−−−PWLT−−−QFFFQFLTY−−−−−−−−−−−−−−−−−−−−−−−−−IPYM−−−−LIGLAV−−−−−−−−−−−−−−−−−−−−−VGFIASMLIWKQYK−−KRSPHDQI−−−−−AV−−−−−−−−−−−FL−−K−−−−−−−I−−−K−−−P−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IK−−−−−−−−ATVQQAISYYFSLQL−−−GRLLETG−−−−MSLQQALN−−−−VF−−−−−−−−−−EGQ−−−DYLRFF−−−KEEAR−−−−−−−−−−−−WMNNELERG−−ESFIAYIKEK−−P−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YYL−−−−−−−−−−−−−−−−−−−−−−DELAAIVENGMRTGT−−IA−−−−SDLQQYSE−−−−WLYQEMDDRLQ−−KGVVWLQPV−−−−−−−LLLAIGAFV−−−FG−−−−LFLVVMLPMFEMIGSLE 
fig|272558.1.peg.2831   Bacillus halodurans C-125                                                                                                                                                                                                                                                                           MLEQGYHLYE−−−AVQFLAIHAPSSAQKK−−−−−−−−−−−−−−−−−−MNAMLMDLRSG−−YPLHKAL−−DHLQ−−−−−−−−−LPQDVQLLL−−−−YVSERNGDLAQGFRKSGELFKK−−−−−−−−−−REEMKRK−−−−−−WEG−−−−−−−AMRYPLLLI−−−IVTLLLMFILMY−−−−−−−−F−−−−−VLPHH−−QTLYR−−−−−−−−−−−−−−−−−−−−−−−−SLQ−−−−−−IEL−−−−−−PVIT−−−KLVIACSEK−−−−−−−−−−−−−−−−−−−−−−−−−LPWL−−−−FTAFFV−−−−−−−−−−−−−−−−−−−−−VAILLVLTYFVTFH−−RFPPTKKV−−−−−TV−−−−−−−−−−−LL−−R−−−−−−−I−−−P−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LS−−−−−−−−QWTKEVITCLFCLTL−−−GGLLKGG−−−−LSIMEALS−−−−IC−−−−−−−−−−KEQ−−−DFFLFF−−−RSEGE−−−−−−−−−−−−EMMLELENG−−ERLYECLRRR−−P−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HYL−−−−−−−−−−−−−−−−−−−−−−KELPFVVENGEKTGN−−LA−−−−KDLLYFSD−−−−YQLEEFERRVK−−KWLVAIQPI−−−−−−−VFSMIGAVI−−−LV−−−−LFLAMMLPVFQMIGAI  
fig|272558.8.peg.2941   Bacillus halodurans C-125                                                                                                                                                                                                                                                                           LLEQGYHLYE−−−AVQFLAIHAPSSAQKK−−−−−−−−−−−−−−−−−−MNAMLMDLRSG−−YPLHKAL−−DHLQ−−−−−−−−−LPQDVQLLL−−−−YVSERNGDLAQGFRKSGELFKK−−−−−−−−−−REEMKRK−−−−−−WEG−−−−−−−AMRYPLLLI−−−IVTLLLMFILMY−−−−−−−−F−−−−−VLPHH−−QTLYR−−−−−−−−−−−−−−−−−−−−−−−−SLQ−−−−−−IEL−−−−−−PVIT−−−KLVIACSEK−−−−−−−−−−−−−−−−−−−−−−−−−LPWL−−−−FTAFFV−−−−−−−−−−−−−−−−−−−−−VAILLVLTYFVTFH−−RFPPTKKV−−−−−TV−−−−−−−−−−−LL−−R−−−−−−−I−−−P−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LS−−−−−−−−QWTKEVITCLFCLTL−−−GGLLKGG−−−−LSIMEALS−−−−IC−−−−−−−−−−KEQ−−−DFFLFF−−−RSEGE−−−−−−−−−−−−EMMLELENG−−ERLYECLRRR−−P−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HYL−−−−−−−−−−−−−−−−−−−−−−KELPFVVENGEKTGN−−LA−−−−KDLLYFSD−−−−YQLEEFERRVK−−KWLVAIQPI−−−−−−−VFSMIGAVI−−−LV−−−−LFLAMMLPVFQMIGAI  
fig|596319.3.peg.1793   Staphylococcus warneri L37603                                                                                                                                                                                                                                                                        LYQLLTNGFTLYE−−−SFKFLNLHFKYKGTKT−−−−−−−−−−−−−−−−−−QMELMAKIENG−−AHCYEIF−−QYLD−−−−−−−−−YANDIITQI−−−−YLAEKFGNLEAILNESILFLKK−−−−−−−−−−QIQVKQS−−−−−−VIK−−−−−−−TIHYPVVLI−−−FIFFLILLILNI−−−−−−−−T−−−−−VIPQF−−KDLYQ−−−−−−−−−−−−−−−−−−−−−−−−TMN−−−−−−IEL−−−−−−SSLQ−−−LVLSSFISG−−−−−−−−−−−−−−−−−−−−−−−−−LPYF−−−−ILFLSC−−−−−−−−−−−−−−−−−−−−−FILVIFIIFHISYR−−KMPIIKQI−−−−−HL−−−−−−−−−−−MS−−N−−−−−−−L−−−P−−−I−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IK−−−−−−−−SYYKILKTYQLSTEL−−−AHFYRNG−−−−INLQLIVE−−−−IF−−−−−−−−−−QQP−−−NSNQFH−−−KYLGE−−−−−−−−−−−−IILKQSNQG−−EKLPNILKQL−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CYE−−−−−−−−−−−−−−−−−−−−−−NDLIKFIEQGEKSGK−−LD−−−−IELTLYSQ−−−−ILVHQFEILAK−−RHIKFIQPI−−−−−−−IFLMLGIFI−−−VS−−−−LYLSIMLPMFDMLQSI  
fig|546270.5.peg.1397   Gemella haemolysans ATCC 10379                                                                                                                                                                                                                                             FI−−−−−−−−−−−KR−−−−−−−−−−−−LYELINHGYMLED−−−SLEFLLIQYEVADDEI−−−−−−−−−−−−−−−−−−K−−KIKEKLSNG−−NKLSDIL−−GYLG−−−−−−−−−YSQLIISKI−−−−KFAEDYGRIEDMLLEVETYLSI−−−−−−−−−−QKIQQEK−−−−−−IIK−−−−−−−TLRYPLFLT−−−LTLVCLIMVFNA−−−−−−−−L−−−−−VIPQF−−ENIYT−−−−−−−−−−−−−−−−−−−−−−−−SSN−−−−−−IKM−−−−−−−DLQ−−−TII−−LIKS−−−−−−−−−−−−−−−−−−−−−−−−−LYYI−−−−PKIIS−−−−−−−−−−−−−−−−−−−−−−−IIILFILLGISYL−−FYTIRYKP−−−−−HLFLKT−−−−−−−LL−−Y−−−−−−−I−−−P−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IR−−−−−−−−NYSKLYFSYRFSMEL−−−SLFLMSG−−−−FSLKTALE−−−−VM−−−−−−−−−−VEE−−−NYDYYL−−−TEFAK−−−−−−−−−−−−EILYELDKG−−ISFEDAIGKI−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YFD−−−−−−−−−−−−−−−−−−−−−−KSIRKFVSHGRNNGL−−ID−−−−KELKLFSE−−−−LMLDTFLTSLD−−RTLKKLQPI−−−−−−−LFGILAVVI−−−VG−−−−LYMVILLPIFNMASSL  
fig|221109.4.peg.1938   Oceanobacillus iheyensis HTE831                                           RPHKLSS−−−−−−−−−−−SNQL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RFL−−−−−−−−−−−QI−−−−−−−−−−−−LSRMLSKGLTISE−−−SLDTLSFYAEYKHIAD−−−−−−−−−−−−−−−−−−−−−RIKHDLKNG−−LHLDESL−−EKVH−−−−−−−−−FHDSIVTHL−−−−YVVRNNGNLENRIKQSVHLYQN−−−−−−−−−−RINYQKR−−−−−−FQQ−−−−−−−VIRYPLILI−−−ITFTIILYFVYN−−−−−−−−Q−−−−−VLPSF−−QFLFV−−−−−−−−−−−−−−−−−−−−−−−−SDL−−−−−−SPA−−−−−−IQLT−−−FFVLQWFS−−−−−−−−−−−−−−−−−−−−−−−−−−−−YF−−−−ILIVII−−−−−−−−−−−−−−−−−−−−−LILLLFIFWSVYKK−−RISTDLKI−−−−−KF−−−−−−−−−−−LS−−R−−−−−−−I−−−P−−−I−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LS−−−−−−−−SYYRKQTSFHFATQL−−−SSLLQTG−−−−MSFNTLLS−−−−YM−−−−−−−−−−ANQ−−−DKLPIV−−−IYYSK−−−−−−−−−−−−QMHLQLARG−−KSLESLFTSF−−V−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FIE−−−−−−−−−−−−−−−−−−−−−−KQLKAIMSNRVDANT−−LA−−−−KDLHVFAE−−−−LSIEDLYHQLN−−KVITYIQPI−−−−−−−FFIIVGAFI−−−IF−−−−IYISVLSPMFDIMNSI  
fig|592026.3.peg.385   Catonella morbi ATCC 51271                                  RLNQPKKLPLVQQAYV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LSV−−−−−−−−−−−−−−−−−−−−−−−−−LADLLGQGFALST−−−ALQFLAL−−−−−LMPK−−−−−−−−−−YQ−−AL−−LLKVDAALVEG−−QSLEKSL−−AQLG−−−−−−−−−FGTKIVAQL−−−−FYASRQNRLQQALVQAAQRLDQ−−−−−−−−−−ARLFRKE−−−−−−MAK−−−−−−−QLAYPGMMGL−−−CL−−VGMLFGMRT−−−−−−−−F−−−−−ILPQV−−TSFIS−−−−−−−QEVYEREWLVRFLIGFFTY−−−−−−−−−−−L−−−−−−PQLS−−−LVLLAVGLLGLGVGGLL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LQKASYL−−−−−−−KRYAWLRPL−−−P−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LG−−−−−−−−KWLSWQLTQQVAYEL−−−GYFLAGG−−−−LSLQQMLQ−−−−VWMDYPVDPF−−−−−−−−−−−LAEL−−−A−−−H−−−−−−−−−−−−YLMTGCLEG−−RPLTQQMSQL−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LFTRQFPLII−−−−−−−−−−−−−−−−−−−−−−EQ−−−−−−−GELTSQ−−LS−−−−AKCLVYAD−−−−KLGRDLQEDMT−−KKIHFIQPI−−−−−−−LFIFIGLLV−−−VA−−−−MYLVMMLPMLTIQGL   
fig|486410.3.peg.94   Streptococcus dysgalactiae subsp. equisimilis GGS_124                                                                                                                                                                                                                                                                                                                          VLRMEEALLKG−−RGLADML−−AGIG−−−−−−−−−FSDAILTQI−−−−SLADGHGNIETTLVNIQGYLNQ−−−−−−−−−−MAKLKRK−−−−−−TIE−−−−−−−VVTYPIILL−−−VFLFVMILGLRH−−−−−−−−Y−−−−−VMPQ−−−−−LEA−−−−−−−−−−−−−−−−−−−−−−−−QN−−−−−−−−−−−−−−−−−−−−−−−−−−QLTIFLTH−−−−−−−−−−−−−−−−−−−−−−−−−FPAI−−−−FFGIIL−−−−−−−−−−−−−−−−−−−−−FIGVLLGGIWLHWR−−SQSRLKLF−−−−−TH−−−−−−−−−−−FS−−A−−−−−−−Y−−−P−−−V−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LG−−−−−−−−KLLQQYLTAYYAREW−−−GTLIGQG−−−−LELPVIL−−−−DI−−−−−−−−−−MAM−−−EKSLFM−−−QELAE−−−−−−−−−−−−DIRVSLLAG−−QAFHDKVATY−−P−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFK−−−−−−−−−−−−−−−−−−−−−−KELSLMITYGEIKSK−−LG−−−−SELEIYAQ−−−−ESWTQFFSQLH−−QATQFIQPI−−−−−−−IFLVIALTI−−−VM−−−−IYAAILLPIYQ       
fig|218495.3.peg.103   Streptococcus uberis 0140J                                                                                                                                                                                                                                                                                                                          VQRMKIDLMNG−−RDISEMM−−AHLG−−−−−−−−−FSDALVTQL−−−−SLAEVHGNTTNCLAKIEDYMAQ−−−−−−−−−−SNRIRQK−−−−−−TIE−−−−−−−VITYPMVLM−−−TFLIVILMGLRH−−−−−−−−Y−−−−−LLPQ−−−−−IEE−−−−−−−−−−−−−−−−−−−−−−−−EN−−−−−−−−−−−−−−−−−−−−−−−−−−QLTHFLNL−−−−−−−−−−−−−−−−−−−−−−−−−FPTVLLLTFFAMIA−−−−−−−−−−−−−−−−−−−−−VVIFLR−−−−LCWR−−KKSQLKQL−−−−−LV−−−−−−−−−−−YS−−K−−−−−−−I−−−P−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LS−−−−−−−−AVLQLYLTAYYAREW−−−GNLIAQG−−−−VELATIL−−−−QL−−−−−−−−−−MQK−−−EKSVLM−−−REMGS−−−−−−−−−−−−TMEKALLEG−−KSFDQSVGIF−−P−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFK−−−−−−−−−−−−−−−−−−−−−−RELSLMIEYGEIKGK−−LG−−−−QELDIYAQ−−−−VSWENYFRKLR−−QMTQWLQPL−−−−−−−IFILVAIII−−−VM−−−−IYAAMLLPMYQ       
fig|565659.3.peg.1641   Enterococcus faecium 1,141,733                                 KLRKKLGSQNYFKGLTR−−−−−−−−−−−SQQN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QFA−−−−−−−−−−−QT−−−−−−−−−−−−MGELLLTGFSLQE−−−SLYLLLTIRSFQPAI−−−−−−−−−−−−−−−−−−LANIQHQLKEG−−QPFSEVL−−SQTG−−−−−−−−−YGAEQLVQI−−−−ELAELHGNLPATLLEIAKQLRL−−−−−−−−−−VEGFRND−−−−−−LKK−−−−−−−LLAYPMLLL−−−TFLLGILFSMRL−−−−−−−−I−−−−−VLPQ−−−−−LIG−−−−−−−−−−−−−−−−−−−−−−−−SGM−−−−−−VIE−−−−−−EHWG−−−IQLIQVFHW−−−−−−−−−−−−−−−−−−−−−−−−−YVLL−−−−FILMVT−−−−−−−−−−−−−−−−−−−−−LLTLL−−−−−VRYRLMKLSPIDRS−−−−−EW−−−−−−−−−−−IS−−R−−−−−−−Q−−−L−−−V−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IG−−−−−−−−PIYSLYQSAYLSLEI−−−GKLFHEG−−−−FELRQIIV−−−−CL−−−−−−−−−−KET−−−KQESLI−−−QHLAS−−−−−−−−−−−−KMIQGLEAG−−IPLADQFQNY−−H−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FLS−−−−−−−−−−−−−−−−−−−−−−EEFSKIILQGEAKGN−−LG−−−−KELIFYSE−−−−WTRKQLFKRLQ−−HWLHFIQPI−−−−−−−IFLGVAVLI−−−LL−−−−VYAAVLLPVY        
fig|791161.5.peg.1668   Enterococcus faecium PC4.1                                 KLRKKLGSQNYFKGLTR−−−−−−−−−−−SQQN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QFA−−−−−−−−−−−QT−−−−−−−−−−−−MGELLLTGFSLQE−−−SLYLLLTIRSFQPAI−−−−−−−−−−−−−−−−−−LANIQHQLKEG−−QPFSEVL−−SQTG−−−−−−−−−YGAEQLVQI−−−−ELAELHGNLPATLLEIAKQLRL−−−−−−−−−−VEGFRND−−−−−−LKK−−−−−−−LLAYPMLLL−−−TFLLGILFSMRL−−−−−−−−I−−−−−VLPQ−−−−−LIG−−−−−−−−−−−−−−−−−−−−−−−−SGM−−−−−−VIE−−−−−−EHWG−−−IQLIQVFHW−−−−−−−−−−−−−−−−−−−−−−−−−YVLL−−−−FILVVT−−−−−−−−−−−−−−−−−−−−−LLTLL−−−−−VRYRLMKLSPIDRS−−−−−EW−−−−−−−−−−−IS−−R−−−−−−−Q−−−L−−−V−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IG−−−−−−−−PIYSLYQSAYLSLEI−−−GKLFHEG−−−−FELRQIIV−−−−CL−−−−−−−−−−KET−−−KQESLI−−−QHLAS−−−−−−−−−−−−KMIQGLEAG−−IPLADQFQNY−−H−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FLS−−−−−−−−−−−−−−−−−−−−−−EEFSKIILQGEAKGN−−LG−−−−KELIFYSE−−−−WTRKQLFKRLQ−−HWLHFIQPI−−−−−−−IFLGVAVLI−−−LL−−−−VYAAVLLPVY        
fig|360911.3.peg.526   Exiguobacterium sp. AT1b                                                                                                                                                                                                                                                                           LQSRGVSLKV−−−TMETLELH−−−−EKGK−−−−−−−−−−MK−−DC−−IREMRIRLEAG−−VSLSEVF−−SILI−−−−−−−−−TNRQMQEIL−−−−HTADHNGRFMDGLSQVAMVLEM−−−−−−−−−−RQRLKQE−−−−−−LRR−−−−−−−LIRYPLIIFF−−−ILLALGMIYAL−−−−−−−−−−Y−−−−−IFPKL−−MGMVDVSSHGGVGSILLSNW−−−−−−−−−−F−−−−−−−−−−−F−−−−−−PVLF−−−SIFVAISVLIYG−−−−F−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HRRGVEL−−−−−−−PFYVWRR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−KTL−−−−−−−−−−YM−−−TYVFVSE−−−−LSLLQHTE−−−−TNIRQIISRL−−AEE−−−QGEMAEM−−−AKRIH−−−−−−−−−−−−HRMS−−−−EG−−EGIEAA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TRCEPFID−−−−−−−−−−−−−−−−−−−−−−HEVVSLLGVGSMSGE−−LG−−−−KLMSLHRD−−−−LVFEEMEQYSR−−GLIEKIEPS−−−−−−−LY−−−GILS                           
fig|762051.3.peg.994   Leuconostoc kimchii IMSNU11154                                                                                                                                                                                                                                                                            MQSGYSISQ−−−SLDILAS−−−−−−AH−−−SKWY−−−−−−−QW−−LTEVRYGLNQG−−LALHLIL−−−−−−−Q−−−−−KNVSSQILLQL−−−−KLADQHGNLSETLVAIGQNLAK−−−−−−−−−−LQQQQNK−−−−−−VMQ−−−−−−−VMRYPLILL−−−SILGAMLVGLKY−−−−−−−−L−−−−−LYPIL−−NQWQD−−−−−−−−−−−−−−−−−−−−−−−−KAASSD−−−−IPN−−−−−−PAYT−−−YFFGGVACL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LLFGLIII−−WHRK−−−−−−TARQ−−−−−R−−−−−−−−L−−−IILVK−−−−−−−L−−−P−−−V−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IR−−−−−−−−TIAKTIVTYQVTQQL−−−ATLLASG−−−−LTVPEILE−−−−EMVQSDLQNAR−−−S−−−TVFAIV−−−N−−−−−−−−−−−−−−−−HAHISLKQG−−QTIENYVLAQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YFN−−−−−−−−−−−−−−−−−−−−−−RSLAGYFSRGHKPKE−−LA−−−−KYLSYYAK−−−−TQFQLLMQQTD−−RLISTMQPL−−−−−−−FFGIIGVAI−−−VG−−−−LYMSMLLPMYQ       
fig|349519.10.peg.380   Leuconostoc citreum KM20                                         KRFKQQQQI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VFF−−−−−−−−−−−QS−−−−−−−−−−−−LGALLQSGYDMAQ−−−SLDTLFL−−−−−−AH−−−HSWR−−−−−−−SW−−LSDIQKDLAAG−−QSFSDSL−−−−−−−R−−−−−PYVSLDILLQL−−−−RLADQHGNLSESLILIGKNLRQ−−−−−−−−−−IQRQKNK−−−−−−IKQ−−−−−−−VMRYPMILL−−−IILGALLVGIKY−−−−−−−−F−−−−−ISPIL−−NQWQN−−−−−−−−−−−−−−−−−−−−−−−−VDMSENKSLFVSM−−−−−−P−−−−−−−−FVVTTIL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LIVSVMVMICWFKI−−−−−−SSRK−−−−−K−−−−−−−−L−−−LILVK−−−−−−−L−−−P−−−I−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IG−−−−−−−−AIIRTIVTYQVSQQL−−−TVLLANG−−−−LTLPQVLE−−−−SL−−SDVPQRKVLSK−−−TASVII−−−A−−−−−−−−−−−−−−−−HAKQYLADG−−ESVENYILRQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YFN−−−−−−−−−−−−−−−−−−−−−−ESLAGYFARGQAPKI−−IA−−−−KHLSYYAK−−−−TQFEMAMRQID−−RLINTIQPI−−−−−−−CFGVIGLSI−−−IG−−−−VYMSMLLPM         
fig|379360.3.peg.800   Oenococcus oeni ATCC BAA-1163                                                                                    M−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PRRQQ−−−−−V−−−EFL−−−−−−−−−−−SL−−−−−−−−−−−−LGQLIQSGYSINQ−−−ATNFIQ−−−−−−QISR−−−E−−−−−−−S−−SW−−VKNLNLELAKG−−KNFAFAI−−KPY−−−−−−−−−−LNNSLNFQI−−−−GMADRYGNLEKILLQLADFSEK−−−−−−−−−−CLKQENK−−−−−−IKQ−−−−−−−ILRYPLVLV−−−FLLIGIAVAVKI−−−−−−−−F−−−−−LLPIL−−SSWSN−−−−−−−−−−−−−−−−−−−−−−−−QQR−−−−−−VD−−−−−−−−−−−−−−−−−−−−−−−FVDEY−−−−−−−−−−−−−−−−−−−−FWF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVLGVVLMTLLFLFYRWQSFKKMS−−−−−K−−LKQ−−−L−−−AFYTK−−−−−−−I−−−P−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FG−−−−−−−−KTLNHLINYQFSLQL−−−SMLTASG−−−−LQISQIAK−−−−DI−−−−−−−−−−SKN−−−NSHSVE−−−SDFAE−−−−−−−−−−−−KLVEMLEDG−−HSFSDYFHEL−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FLD−−−−−−−−−−−−−−−−−−−−−−PTINIYFQQGANKEL−−LN−−−−RNLKIYSK−−−−ISYENFLTSVD−−RLISLIQPL−−−−−−−SFAIVGIGI−−−VL−−−−LYLSML            
fig|1160703.3.peg.1326   Oenococcus oeni AWRIB202                                                                                    M−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PRRQQ−−−−−V−−−EFL−−−−−−−−−−−SL−−−−−−−−−−−−LGQLIQSGYSINQ−−−ATNFIQ−−−−−−QISR−−−E−−−−−−−S−−SW−−VKNLNLELAKG−−KNFAFAI−−KPY−−−−−−−−−−LNNSLNFQI−−−−GMADRYGNLEKILLQLADFSEK−−−−−−−−−−CLKQENK−−−−−−IKQ−−−−−−−ILRYPLVLV−−−FLLIGIAVAVKI−−−−−−−−F−−−−−LLPIL−−SSWSN−−−−−−−−−−−−−−−−−−−−−−−−QQR−−−−−−VD−−−−−−−−−−−−−−−−−−−−−−−FVDEY−−−−−−−−−−−−−−−−−−−−FWF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVLGVVLMTLLFLFYRWQSFKKMS−−−−−K−−LKQ−−−L−−−AFYTK−−−−−−−I−−−P−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FG−−−−−−−−KTLNHLINYQFSLQL−−−LMLTASG−−−−LQISQIAK−−−−DI−−−−−−−−−−SKN−−−NSHSVE−−−SDFAE−−−−−−−−−−−−KLVEMLEDG−−HSFSDYFHEL−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FLD−−−−−−−−−−−−−−−−−−−−−−PTINIYFQQGANKEL−−LN−−−−RNLKIYSK−−−−ISYEKFLTSVD−−RLISLIQPL−−−−−−−SFAIVGIGI−−−V                       
fig|203123.7.peg.1267   Oenococcus oeni PSU-1                                                                                    M−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PRRQQ−−−−−V−−−EFL−−−−−−−−−−−SL−−−−−−−−−−−−LGQLIQSGYSINQ−−−ATNFIQ−−−−−−QISR−−−E−−−−−−−S−−SW−−VKNLNLELAKG−−KNFAFAI−−KPY−−−−−−−−−−LNNSLNFQI−−−−GMADRYGNLEKILLQLADFSEK−−−−−−−−−−CLKQENK−−−−−−IKQ−−−−−−−ILRYPLVLV−−−FLLIGIAVAVKI−−−−−−−−F−−−−−LLPIL−−SSWSN−−−−−−−−−−−−−−−−−−−−−−−−QQR−−−−−−VD−−−−−−−−−−−−−−−−−−−−−−−FVDEY−−−−−−−−−−−−−−−−−−−−FWF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVLGVVLMTLLFLFYRWQSFKKMS−−−−−K−−LKQ−−−L−−−AFYTK−−−−−−−I−−−P−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FG−−−−−−−−KTLNHLINYQFSLQL−−−SMLTASG−−−−LQISQIAK−−−−DI−−−−−−−−−−SKN−−−NSHSVE−−−SDFAE−−−−−−−−−−−−KLVEMLEDG−−HSFSDYFHEL−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FLD−−−−−−−−−−−−−−−−−−−−−−PTINIYFQQGANKEL−−LN−−−−RNLKIYSK−−−−ISYEKFLTSVD−−RLISLIQPL−−−−−−−SFAIVGIGI−−−VL−−−−LYLSML            
fig|525306.3.peg.409   Lactobacillus acidophilus ATCC 4796                                                                                                                                                                                                                             PK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−−−−−−−−−−−−−−RV−−LMGKLARRMKNG−−ASLSEELIKLGFSR−−−−−−−−−−−−TMVTQV−−−−NLSLQQGNLTECLEQLAILSRL−−−−−−−−−−KQEQIKK−−−−−−LRA−−−−−−−ELSYPLVLA−−−IMMIVL−−−−−−−−−−−−−−−−−−−−−−−−−LMFMQSFI−−−−−−−−−−−−−−−−−−−−−−−−SMQF−−−−−−NNTS−−−−−−−−−−−−−E−−−−−−−−−−HSG−−−−−−−−−−−−−−−−−−−−DLVILILIILIGS−−−−−−−−−−−−−−−−−−−−−GIYFFTRIISLLNKQDYIS−−−−−−−−−−−−−MKK−−−−−−−LI−−R−−−−−−−Y−−−P−−−I−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IG−−−−−−−RIILLYVNYLLVYDI−−−GMLLAGG−−−−FSLQKMCE−−−−YA−−−−−−−−−−IKQ−−−EKDSLQ−−−HTLGQ−−−−−−−−−−−−NIGQQLVKG−−KSIEEIIKKE−−D−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FLP−−−−−−−−−−−−−−−−−−−−−−TSLLILLKTGSQRSD−−LS−−−−KRCLILGR−−−−SLFLDLTAKVE−−KLVVNIQPI−−−−−−−CFILIGVCI−−−IG−−−−MYLKLLLPMYSMMQNI  
fig|146919.6.peg.1368   Salinibacter ruber                            GTVKTGEQKAFSAEEVEE−−AL−−−ENMGLEVVKVQKKWFDFEFSPP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QDDLI−−−MFV−−−−−−−−−−−RL−−−−−−−−−−−−AANLLRENLPFDE−−−VLEMLV−−−−−−−−−−−−−NDVSSKSLQ−−QV−−IRDLNSDLKGG−−MNAEKAF−−NKHRD−−−−−KLGKFTAYML−−−−GIASKSGNMAEIYEATARFLER−−−−−−−−−−KDEFSSR−−−−−−VRS−−−−−−−AMIMPAVTT−−−VAMIGAMVWYIW−−−−−−−−Y−−−−−IVPATAG−−LFE−−−−−−−−−−−−−−−−−−−−−−−−GMDV−−−−−−TM−−−−−−−−PPLT−−−SFSLDMAAW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LDQYWVW−−−−−−−−−−−−−−−−−−−−−VLIGTVGPLLAFVVWARTEQGKFY−−−−−−−−LHK−−−Y−−−MI−−K−−−−−−−V−−−P−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VG−−−−−−−−KLLHKINIEIFCRVF−−−SILYSGA−−−−GDNLRVIR−−−−IA−−−−−−−−−−AEA−−−CGNKYM−−−EYRIR−−−−−−−−−−−−NVTIPMMTAQGASLVQALKAS−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VFT−−−−−−−−−−−−−−−−−−−−−−SMAITRFKSGAETGS−−VR−−−−ESARQMAD−−−−YYEQETELSLD−−AAVESIQTG−−−−−−−VSIIIALGV−−−L                       
fig|309807.25.peg.1321   Salinibacter ruber DSM 13855                            GTVKTGEQKAFSAEEVEE−−AL−−−ENMGLEVVKVQKKWFDFEFSPP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QDDLI−−−MFV−−−−−−−−−−−RL−−−−−−−−−−−−AANLLRENLPFDE−−−VLEMLV−−−−−−−−−−−−−NDVSSKSLQ−−QV−−IRDLNSDLKGG−−MNAEKAF−−NKHRD−−−−−KLGKFTAYML−−−−GIASKSGNMAEIYEATARFLER−−−−−−−−−−KDEFSSR−−−−−−VRS−−−−−−−AMIMPAVTT−−−VAMIGAMVWYIW−−−−−−−−Y−−−−−IVPATAG−−LFE−−−−−−−−−−−−−−−−−−−−−−−−GMDV−−−−−−TM−−−−−−−−PPLT−−−SFSLDMAAW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LDQYWVW−−−−−−−−−−−−−−−−−−−−−ALIGTVGPLLAFVVWARTEQGKFY−−−−−−−−LHK−−−Y−−−MI−−K−−−−−−−V−−−P−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IG−−−−−−−−KLLHKINIEIFCRVF−−−SILYSGA−−−−GDNLRVIR−−−−IA−−−−−−−−−−AEA−−−CGNKYM−−−EYRIR−−−−−−−−−−−−NVTIPMMTAQGASLVQALKAS−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VFT−−−−−−−−−−−−−−−−−−−−−−SMAITRFKSGAETGS−−VR−−−−ESARQMAD−−−−YYEQETELSLD−−AAVESIQTG−−−−−−−VSIIIAIGV−−−L                       
fig|391615.3.peg.554   gamma proteobacterium HTCC5015                            GTRDQGEILAPSRGQARR−−QL−−−NCDGA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FLI−−−−−−−−−−−RL−−−−−−−−−−−−KAPRSHAVSRRQ−−−−−−−−−−−−−−−−−−−−−−−−WRQSWP−−LV−−VRQLRQLSAAG−−VPLAEAM−−DALSQE−−−−−AEPVAWAQLLQDLARDLSAGQRLSQAL−−−ARFEEHLPEPSMSLIQAGENSGT−−−−−−LER−−−−−−−−−−−−−−−−−−−−−QLDTLA−−−−−−−−−−−−−−Q−−−−−ILEWREA−−−−R−−−−−−−−−−−−−−−−−−−−−−−−RSEA−−−−−−IN−−−−−−−−ALFY−−−PAVAALAT−−−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−AAAGFLLL−−−−−−−−−−−−−−−−−−−−−YLVPKLAPFL−−−−−−−−−−−−−−−−−−−−−−−RE−−−L−−−GV−−D−−−−−−−L−−−P−−−FYSRFLFAFSDWLLLYGLWLLPLLPLLFSALWISSVWRFLPGVG−−−−−−−−KVLHELSLSQFSAQM−−−RVLYAAG−−−−MALPRALERAGALL−−−−−−−−−−VDR−−−−−−−−−−−−−RGAVG−−−−−−−−−−−−VAAQALESG−−QSLSQALQST−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QFS−−−−−−−−−−−−−−−−−−−−−−PLFLRVVRVGEHSGG−−LE−−−−ESFAQLEV−−−−YHSERAQRRLQ−−KLQAMLAPS−−−−−−−VSVMLALLL−−−LW−−−−IVAAVFLPLYDAMEVM  
fig|137722.3.peg.3369   Azospirillum sp. B510                            GRARSIEVEAEDERRARD−−AI−−−−−−−−−−−SGRG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−R−−−−−−−−−−−−−VLSVRRRRKVGGWGRPLDRNERHILFIRLAAMLDSRVGLAE−−−ALRRIA−−−−−−−−TA−−−FRGR−−−IR−−RT−−AERMADAVELG−−DDLADAM−−LRQPRS−−−−−−−FSPVLVALV−−−−RAGGFGEGTPAALRTAADFERQ−−−−−−−−−−IAGARQG−−−−−−FRS−−−−−−−GLALAVLYVMTSGVVMVGTSFV−−−−−−−−−−−−−−−−−−LTPLLLDTEVFR−−−−−−−−−−−−−−−−−−−−−−−−RAGEEVNVGWVYLL−−−−−−SDLT−−−TGLVAM−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLAGLTLLGGLATV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GRRLAPRR−−−−−−−−VDQ−−−L−−−VM−−R−−−−−−−I−−−P−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YR−−−−−−−−DIALGIQHHVIFREL−−−SLLVAGG−−−−VPVDRALR−−−−LA−−−−−−−−−−LDG−−−APAGAL−−−AADLE−−−−−−−−−−−−EATRAVAAG−−LPWTDAM−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ALP−−−−−−−−−−−−−−−−−−−−−−GTDRASLAAAENRVE−−LA−−−−QSLSALAE−−−−QYRDLYLHAVS−−VAEPVLRGL−−−−−−−SVVVVGVAG−−−−−−−−−IVMF              
fig|272630.7.peg.5716   Methylobacterium extorquens AM1       VDAPDPHAAEALCRRSGTVIEVRRERNSPLRRGMGAADR−−YT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FLV−−−−−−−−−−−RL−−−−−−−−−−−−SGMLSSRMPTDK−−−ALENMA−−−−−−−−−−−−−GSFGGKIG−−HA−−AKDMLERIRGG−−MSYVEAM−−EFDRR−−−−−NFPPALIALV−−−−RAGGAGKTSAEALRGAAEFEIQ−−−−−MTRIKRTSTKDV−−−−−−WTA−−−−−−−MFSFALAMG−−−VMISTTE−−−−−−−−−−−−−−I−−−−−FAPWVLDSNLFK−−−−−−−−−−−−−−−−−−−−−−−−QNKE−−−−−−ID−−−−−−−−VAWI−−−KTAASISTWGIGL−−−−−−−−−−−−−−−−−−−−−−−−−−VFAGFFVL−−−−−−−−−−−−−−−−−−−−−FMLGTIGRFL−−−−−−−−−−APLF−−−−−−−−CEE−−−A−−−VI−−Q−−−−−−−I−−−P−−−YYRELVMGQDQYIAYYRF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AKLVEFG−−−−VPVAEALQ−−−−IL−−−−−−−−−−VGS−−−TKKGII−−−REDLK−−−−−−−−−−−−AALEAVNVG−−REWAPAMTR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LP−−−−−−−−−−−−−−−−−−−−−−PTDRAALAFALDKKD−−VA−−−−QTLDILAS−−−−TTRDIYTSRVE−−NFGPALNIA−−−−−−−AAVAMGLSS−−−VI−−−−MFGLTVLPM         
fig|396595.4.peg.2805   Thioalkalivibrio sp. K90mix                                                 M−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LFQ−−−−−−−−−−−RL−−−−−−−−−−−−AAMIGSRVGTGE−−−ALRLIQ−−−−−−−−−−−−−ETFKGKIA−−RI−−AGALRKRIESG−−DSLVAAM−−QAIGAR−−−−−AFPETTLAII−−−−RTGSQGGNMAEALREAIRFEQE−−−−−SAAIRKESSKGM−−−−−−WSA−−−−−−−VGGFAAGVI−−−TLLATTL−−−−−−−−−−−−−−Y−−−−−VVPEMEASPMVQ−−−−−−−−−−−−−−−−−−−−−−−−QMGA−−−−−−GQ−−−−−−−−PLWV−−−TITANTLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLAMFITL−−−−−−−−−−−−−−−−−−−−−VMMFVGALLFVV−−−−RPVAAAA−−−−−−−−VDR−−−F−−−IM−−G−−−−−−−V−−−P−−−FFKDVALAKKNYIAFYGL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SILLRAG−−−−LRVEEALR−−−−LS−−−−−−−−−−KES−−−APKGQT−−−RDDFG−−−−−−−−−−−−NA