(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00014282

fig|629742.3.peg.499   Staphylococcus hominis SK119       DKDIEVIKSIYKTLDYAVKDKRTEYTHIVEEGNQEWKETLNREQQLQFICEWVMQQIENNFEWED    
fig|525376.3.peg.1178   Staphylococcus epidermidis W23144     MEQEQLKVIEEIYDMLESAINDKRTEYAHTISDGNKEWKETLNREEQLQFVCEVVLQQIEN          
fig|279808.8.peg.2067   Staphylococcus haemolyticus JCSC1435     MEQEQKDVIQDIYTTLGTTVGDKATEYEHHFKEGHNEWTETVNREEHLQAMIEWAIQQIENNFDGVK    
fig|681288.4.peg.793   Staphylococcus aureus subsp. aureus ED98     MNNEQKEVIKDIYSSLESVVNNESTEYIHKIKDGKKEWTETVNREQHLQAIIEWTLQQI            
fig|585151.3.peg.1732   Staphylococcus aureus subsp. aureus C427     MNNEQKEVIKDIYSSLESVANNKSEVYIHEFKCGEKERTETVNREQHLQAIIEWTLQQI            
fig|904738.3.peg.1365   Staphylococcus aureus subsp. aureus 21235     MNNEQKEVIKDIYSSLESVANNKSEVYIHEFKCGEKEWTETVNREQHLQAIIEWTLQQI            
fig|1303785.3.peg.1009   Staphylococcus aureus M1228     MNNEQKEVIQDIYNTLEAVAYNTSMEYIHNCVDGKKEWMENVNREEHLQAIIEWALQQIENNFNFENDTEM
fig|904728.3.peg.287   Staphylococcus aureus subsp. aureus 21195     MNNEQKEVIQDIYNTLEAVAYNTSMEYIHNCVDGKKELIENVNREEHLQAIIEWALQQIENNFDFENDTEM
fig|596319.3.peg.1420   Staphylococcus warneri L37603     MNQEQIDVLENVNYQLKTSIYNHFESYEHTEYKDGQEVVSQINREKHLELIMKWAVQELEKNFNINEENE 
fig|525374.3.peg.2045   Staphylococcus epidermidis BCM-HMP0060     MNKKQRVTLEVIKYQLKLSINNKFDMYEHIEERNGVEKITEISREKHLEYIMKWCLQELENNFNYEEEK  
fig|158878.1.peg.788   Staphylococcus aureus subsp. aureus Mu50     MNNEQKEVIEHVVYQLELSIMNNFESYEHTEYVDGIEVVSEISPEKHLELIMKWCAQELKNNFQLEKGE  
fig|452948.4.peg.2813   Staphylococcus aureus 930918-3     MNNEQKEVIEHVVYQLELSVMNNLESYEHTEYVDGIEVVSEVSREKHLELIMKWCAQELKNNFQLGKGE  
fig|904346.3.peg.846   Staphylococcus lugdunensis VCU139     MNNEQKEVIEHVVYQLELSVMNNLESYEHTEYVDGIEVVSEVSREKHLELIMKWCAQELKNNFQLEKGE  
fig|158878.1.peg.2024   Staphylococcus aureus subsp. aureus Mu50     MNNEQKEVIEHVVYQLELSVVNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE  
fig|452948.4.peg.2817   Staphylococcus aureus 930918-3     MNNEQKEVIEHLVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE  
fig|585151.3.peg.2256   Staphylococcus aureus subsp. aureus C427     MNNEQKEVIEHLVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE  
fig|663951.4.peg.952   Staphylococcus aureus subsp. aureus TW20     MNNEQKEVIEHVVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE