(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00013838

fig|553571.3.peg.1085   Staphylococcus aureus A6300                             VRTYSQAISYLKSLEGKAWNPDNAFGCQCFDTAN−−−−QYWLYLFNHRLKGVGAADIP−−TWNDFTNEATVYENTVSFQALPGDVVIFNRNYGGGYGHVGIVISATLD−−−−SITILEQNWLGGAYWNPP−−−−−−−−EVTTRRTHGYDFPMWFIRPFYAKETTANKLRSAVTPVKQ−−−−−DKLSKGKKIM−−−−−−−LVAGHGIGAYSNDPGAVAN−−−−−−−−−−GENERDFNRKNI−−−IPRVKKYLESVGNTVLLYGGNSMNQDLYQDTL−−−YGQRV−−−−GNYKDYGMYWIKNEVKPDAIIEFHLDSASQQASGGHVIISDRFPADDIDKALSSALDKTVGKIRGVTPRGDLLNANVSADLNLNYRLIELGFITSTKDLNYIKNNLDSFTKR−−−IAEAINGR−−−−−−−−QIDAPSSKPSTDKITWNWK−−−−GVFY−−−−−−−PNPEKAIRVRKTAGLTGTVVEEDSWLYTKDDWVKFDQVIKKDGYWWIRFKYQREGSSTNNFYCAVCRITDKEQKIKNEKYWGTI 
fig|320848.3.peg.27   Bacteriophage 88                                               INIDNYRGSQCWDTPNFIFKRYWGFVT−−−−−−WGNAKDMA−−−NYRYPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGP−−−SNKSYFYSVDQNWVNSNSWTGS−−−PG−−−−−−SLVRHPYVSVTGFVRPPYSKDTSKPSSTDTSSASKANDSTITGEAKKPQFKEVKTVKYTAYSNVLDKEEHFIDHIVVMGDERSDIQGLYIKESMHMRSVDELYTQRNKFISDYEIPHLYVDREATWLARPTN−−−−−−FDDP−−−−RHPNWLVIEVCGGQTDSKRQFLLNQIQALIRGV−−WLLSGIDKNLSETTLKVDPNI−−−−−−WR−−−−−−−−−−−−−SMKDLINYDLIKQGIPDNAKYEQVKKKMLETYIKRDILTRENIKEVTTKTTIRISDKTSVDSASTR                                                                                                            
fig|359786.3.peg.808   Staphylococcus aureus subsp. aureus JH9                                               INIDNYRGSQCWDTPNFIFKRYWGFVT−−−−−−WGNAKDMA−−−NYRYPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGP−−−SNKSYFYSVDQNWVNSNSWTGS−−−PG−−−−−−SLVRHPYVSVTGFVRPPYSKDTSKPSSTDTSSASKANDSTITGEAKKPQFKEVKTVKYTAYSNVLDKEEHFIDHIVVMGDERSDIQGLYIKESMHMRSVDELYTQRNKFISDYEIPHLYVDREATWLARPTN−−−−−−FDDP−−−−RHPNWLVIEVCGGQTDSKRQFLLNQIQALIRGV−−WLLSGIDKNLSETTLKVDPNI−−−−−−WR−−−−−−−−−−−−−SMKDLINYDLIKQGIPDNAKYEQVKKKMLETYIKRDILTRENIKEVTTKTTIRISDKTSVDSASTR                                                                                                            
fig|359787.11.peg.401   Staphylococcus aureus subsp. aureus JH1                                               INIDNYRGSQCWDTPNFIFKRYWGFVT−−−−−−WGNAKDMA−−−NYRYPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGP−−−SNKSYFYSVDQNWVNSNSWTGS−−−PG−−−−−−SLVRHPYVSVTGFVRPPYSKDTSKPSSTDTSSASKANDSTITGEAKKPQFKEVKTVKYTAYSNVLDKEEHFIDHIVVMGDERSDIQGLYIKESMHMRSVDELYTQRNKFISDYEIPHLYVDREATWLARPTN−−−−−−FDDP−−−−RHPNWLVIEVCGGQTDSKRQFLLNQIQALIRGV−−WLLSGIDKNLSETTLKVDPNI−−−−−−WR−−−−−−−−−−−−−SMKDLINYDLIKQGIPDNAKYEQVKKKMLETYIKRDILTRENIKEVTTKTTIRISDKTSVDSASTR                                                                                                            
fig|1158533.3.peg.629   Staphylococcus aureus M0510                                               INIDNYRGSQCWDTPNFIFKRYWGFVT−−−−−−WGNAKDMA−−−NYRYPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGP−−−SNKSYFYSVDQNWVNSNSWTGS−−−PG−−−−−−SLVRHPYVSVTGFVRPPYSKDTSKPSSTDTSSASKANDSTITGEAKKPQFKEVKTVKYTAYSNVLDKEEHFIDHIVVMGDERSDIQGLYIKESMHMRSVDELYTQRNKFISDYEIPHLYVDREATWLARPTN−−−−−−FDDP−−−−RHPNWLVIEVCGGQTDSKRQFLLNQIQALIRGV−−WLLSGIDKNLSETTLKVDPNI−−−−−−WR−−−−−−−−−−−−−SMKDLINYDLIKQGIPDNAKYEQVKKKMLETYIKRDILTRENIKEVTTKTTIRISDKTSVDSASTR                                                                                                            
fig|1157007.3.peg.2147   Staphylococcus aureus M0045                                               INIDNYRGSQCWDTPNFIFKRYWGFVT−−−−−−WGNAKDMA−−−NYRYPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGP−−−SNKSYFYSVDQNWVNSNSWTGS−−−PG−−−−−−RLVRHPYVSVTGFVRPPYSKDTSKPSSTDTSSASKANDSTITGEAKKPQFKEVKTVKYTAYSNVLDKEEHFIDHIVVMGDERSDIQGLYIKESMHMRSVDELYTQRNKFISDYEIPHLYVDREATWLARPTN−−−−−−FDDP−−−−RHPNWLVIEVCGGQTDSKRQFLLNQIQALIRGV−−WLLSGIDKNLSETTLKVDPNI−−−−−−WR−−−−−−−−−−−−−SMKDLINYDLIKQGIPDNAKYEQVKKKMLETYIKRDILTRENIKEVTTKTTIRISDKTSVDSASTR                                                                                                            
fig|1224925.3.peg.1932   Staphylococcus aureus M0273                                               INIDNYRGSQCWDTPNFIFKRYWGFVT−−−−−−WGNAKDMA−−−NYRYPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGP−−−SNKSYFYSVDQNWVNSNSWTGS−−−PG−−−−−−RLVRHPYVSVTGFVRPPYSKDTSKPSSTDTSSASKANDSTITGEAKKPQFKEVKTVKYTAYSNVLDKEEHFIDHIVVMGDERSDIQGLYIKESMHMRSVDELYTQRNKFISDYEIPHLYVDREATWLARPTN−−−−−−FDDP−−−−RHPNWLVIEVCGGQTDSKRQFLLNQIQALIRGV−−WLLSGIDKNLSETTLKVDPNI−−−−−−WR−−−−−−−−−−−−−SMKDLINYDLIKQGIPDNAKYEQVKKKMLETYIKRDILTRENIKEVTTKTTIRISDKTSVDSASTR                                                                                                            
fig|546342.3.peg.722   Staphylococcus aureus subsp. aureus str. JKD6008                                               INIDNYRGSQCWDTPNFIFKRYWGFVT−−−−−−WGNAKDMA−−−NYRYPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGP−−−SNKSYFYSVDQNWVNSNSWTGS−−−PG−−−−−−RLVRHPYVSVTGFVRPPYSKDTSKPSSTDTSSASKANDSTITGEAKKPQFKEVKTIKYTAYSNVLDKEEHFIDHIVVMGDERSDIQGLYIKESMHMRSVDELYTQRNKFISDYEIPHLYVDREATWLARPTN−−−−−−FDDP−−−−RHPNWLVIEVCGGQTDSKRQFLLNQIQALIRGV−−WLLSGIDKNLSETTLKVDPNI−−−−−−WR−−−−−−−−−−−−−SMKDLINYDLIKQGIPDNAKYEQVKKKMLETYIKRDILTRENIKEVTTKTTIRISDKTSVDSASTR                                                                                                            
fig|931452.3.peg.2516   Staphylococcus aureus subsp. aureus CIG1267                                               INIDNYRGSQCWDTPNFIFKRYWGFVT−−−−−−WGNAKDMA−−−NYRYPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGP−−−SNKSYFYSVDQNWVNSNSWTGS−−−PG−−−−−−RLVRHPYVSVTGFVRPPYSKDTSKPSSTDTSSASKANDSTITGEAKKPQFKEVKTVKYTAYSNVLDKEEHFIDHIVVMGDERSDIQGLYIKESMHMRSVDELYTQRNKFISDYEIPHLYVDREATWLARPTN−−−−−−FDDP−−−−RHPNWLVIEVCGGQTDSKRQFLMNQIQALIRGV−−WLLSGIDKELSETTLKVDPNI−−−−−−WR−−−−−−−−−−−−−SMKDLINYDLIKQGIPDNAKYEQVKKKMLEMYIKRDILTRENIKEVTTKTSIRISDKTSVDSASTR                                                                                                            
fig|585155.3.peg.2409   Staphylococcus aureus subsp. aureus H19                                               INIDNYRGSQCWDTPNFIFKRYWGFVT−−−−−−WGNAKDMA−−−NYRYPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGP−−−SNKSYFYSVDQNWVNSNSWTGS−−−PG−−−−−−RLVRHPYVSVTGFVRPPYSKDISKPSSTDTSSASKANDSTITGEAKKPQFKEVKTVKYTAYSNVLDKEEHFIDHIVVMGDERSDIQGLYIKESMHMRSVDELYTQRNKFISDYEIPHLYVDREATWLARPTN−−−−−−FDDP−−−−RHPNWLVIEVCGGQTDSKRQFLMNQIQALIRGV−−WLLSGIDKELSETTLKVDPNI−−−−−−WR−−−−−−−−−−−−−SMKDLINYDLIKQGIPDNAKYEQVKKKMLEMYIKRDILTRENIKEVTTKTSIRISDKTSVDSASTR                                                                                                            
fig|1278075.4.peg.1678   Staphylococcus aureus LVP5                                               INIDNYRGSQCWDTPNFIFKRYWGFVT−−−−−−WGNAKDMA−−−NYRYPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGP−−−SNKSYFYSVDQNWVNSNSWTGS−−−PG−−−−−−SLVRHPYVSVTGFVRPPYSKDTSKPSSTDTSSASKANDSTITGEAKKPQFKEVKTVKYTAYSNVLDKEEHFIDHIVVMGDERSDIQGLYIKESMHMRSVDELYTQRNKFISDYEIPHLYVDREATWLARPTN−−−−−−FDDP−−−−RHPNWLVIEVCGGQTDSKRQFLMNQIQALIRGV−−WLLSGTDKELSETTLKVDPNI−−−−−−WR−−−−−−−−−−−−−SMKDLINYDLIKQGIPDNAKYEQVKKKMLEMYIKRDILTRENIKEVTTKTTIRISDKTSVDSASTR                                                                                                            
fig|553583.3.peg.1934   Staphylococcus aureus A9635                                               INIDNYRGSQCWDTPNFIFKRYWGFVT−−−−−−WGNAKDMA−−−NYRYPKGFRFYRYSSGFVPEPGDIAVWHPGNGIGSDGHTAIVVGP−−−SNKSYFYSVDQNWVNSNSWTGS−−−PG−−−−−−SLVRHPYVSVTGFVRPPYSKDTSKPSSTDTSSASKANDSTITGEAKKPQFKEVKTVKYTAYSNVLDKEEHFIDHIVVMGDERSDIQGLYIKESMHMRSVDELYTQRNKFISDYEIPHLYVDREATWLARPTN−−−−−−FDDP−−−−RHPNWLVIEVCGGQTDSKRQFLMNQIQALIRGV−−WLLSGTDKELSETTLKVDPNI−−−−−−WR−−−−−−−−−−−−−SMKDLINYDLIKQGIPDDAKYEQVKKKMLETYIKRDILKRENIKEVTTKTTIRISDKTSVDSASTR                                                                                                            
fig|279808.3.peg.1853   Staphylococcus haemolyticus JCSC1435     MKTQAEINKRLDAYRKGTVDSPYRVKVWTSYDNRFYPMEPGCIDVDKSFHAQCADLTI−−−−DYILWLTDNEFRIRGNAKDAINPKKNKLPEGWKIVLNRPSTVPRKGWIAVFTDGTYWEYGHIGMVYDG−−−GNTSRFQILEQNW−−−NGWANK−−KP−−−−−−−SLRWDNYYGLTHFIVPPVAKENKAVSSSKQQAPKQ−−−−−KVKKASTKKALPKITKHITGYNMDKRGYNPKGVVLHNDAG−−−−−GMNYKQYYNNLVNANYDRLAR−−−−−GIAHAYVDRTGIWEAIDESRIAWHVADGTRPGSGNHDFYGIEVNQSLRASDKEFLENEQAVFQFAA−−EKLKKWGLPANRNTVRLHNEFSQTSCPHR−−−−−−−−−−−−−SMVLHTGLDPLYHSITEHARLKLK−−−−DYFIKQ−−−IRAYMDGKKPTSKVVVSKPGSASTPATRKDANGYRENPHGTLYKEEHATFTANANIITRYVGPFTNMPQ−−−AGILKAGQTIIYDEVMKQDGYIWVGYT−−−−AYNGKRVYLPVRKWNRETDS−−−VGKLWGVIS
fig|279808.8.peg.2292   Staphylococcus haemolyticus JCSC1435     MKTQAEINKRLDAYRKGTVDSPYRVKVWTSYDNRFYPMEPGCIDVDKSFHAQCADLTI−−−−DYILWLTDNEFRIRGNAKDAINPKKNKLPEGWKIVLNRPSTVPRKGWIAVFTDGTYWEYGHIGMVYDG−−−GNTSRFQILEQNW−−−NGWANK−−KP−−−−−−−SLRWDNYYGLTHFIVPPVAKENKAVSSSKQQAPKQ−−−−−KVKKASTKKALPKITKHITGYNMDKRGYNPKGVVLHNDAG−−−−−GMNYKQYYNNLVNANYDRLAR−−−−−GIAHAYVDRTGIWEAIDESRIAWHVADGTRPGSGNHDFYGIEVNQSLRASDKEFLENEQAVFQFAA−−EKLKKWGLPANRNTVRLHNEFSQTSCPHR−−−−−−−−−−−−−SMVLHTGLDPLYHSITEHARLKLK−−−−DYFIKQ−−−IRAYMDGKKPTSKVVVSKPGSASTPATRKDANGYRENPHGTLYKEEHATFTANANIITRYVGPFTNMPQ−−−AGILKAGQTIIYDEVMKQDGYIWVGYT−−−−AYNGKRVYLPVRKWNRETDS−−−VGKLWGVIS
fig|698737.3.peg.2179   Staphylococcus lugdunensis HKU09-01     MKTQSQINARLDTYKNGTVDSPYRVKTWTSYDPAFSTMEPGCVDVDHFYHAQCADLPT−−−−DYILWLTDNQYKAWGNAKDFP−−−NNKFPTGWKVIENMPETVPQKGWIAVFTSGTYAQYGHIGIVYNG−−−GNTNSFQILEQNW−−−NGYANK−−KP−−−−−−−TLRWDNYYGLTHFIVPPVAKEFKVLKTETKKAPTQ−−−−−TNKTKTKK−−−IEVNTKRITGWTMDKRGYNPHGVVIHNDAG−−−−−SANSQNYYNSLVNANYDRLAR−−−−−GIAHAYADRNGIWEAIDESCIAWHCADGINPGSGNHDFYGIEVNQSLSASDKEFLANEQAVFQFAA−−QKLKKWGLPANRNTVRLHNEFSQTSCPHR−−−−−−−−−−−−−SMKLHAGLDPIHNSITEQARLKLK−−−−DYFIKQ−−−IRAYMAGKQPTSTTIVNKPGSASTPATRANSNGWKVNQYGTYYKAENATFTPNTAIRTRYIGPFTSCPQ−−−AGVLQAGQSIIYDTVCKQDGYIWVSYT−−−−ANNGKDVWLPVRTWDKSTDS−−−KGILWGTIS
fig|553212.3.peg.2157   Staphylococcus capitis SK14     MKTQSQINKRLRDYKNGVVDSPYRVKRWTSYDASFGAMEPGCIDKDHSFHAQCMDLAI−−−−DYVMWLTDNQTEMWGDAKSSI−−−MNKFPKGWKIVENKPSTIPKKGWIAVFTSGTYDKYGHIGIVYNG−−−GNTTSFQILEQNW−−−NGWANK−−KP−−−−−−−SLRWDNYYGLTHFIVPPVAKEIEAPKKDAKSAPKQ−−−−−SIKKNSS−−−IKVNTNHIKGWTMTKRGRKPKGVVIHNDAG−−−−−TMNSKQYYNNLVNADYNRLAR−−−−−GIAHAYADRNGIWEAISEDRIAWHVSDGVQPGSGNFETYGIEVNQSMYVSDKDFLKNEQTALKFAA−−HKLKKWGLPANRNTVRLHNEFSYTACPHR−−−−−−−−−−−−−SAKLHAGIDPTKQAWSKATQLKLK−−−−DYFIKQ−−−IRAYMKGDTPKITTVKNKPGSASTPANRRDMNGWKVNKYGTYYKTEHATFTPNTPIKTHYVGPFRSCPV−−−SGVLQPGQTVRYDTVCKQDGHVWISYT−−−−ANNGKDVWLPVRTWDKNTDS−−−LGKLWGTI 
fig|525375.3.peg.1321   Staphylococcus epidermidis M23864:W2(grey)     MKTQSQINKRLRDYKNGVVDSPYRVKRWTSYDASFGAMEPGCIDKDRAYHAQCMDLAI−−−−DYVMWLTDNQTEMWGDAKSSI−−−KNKFPKGWKIVENKPSTIPKKGWIAVYTAGTYSRYGHIGIVYDG−−−GNTNSFQILEQNW−−−NGWANK−−KP−−−−−−−SLRWDNYYGLTHFIVPPVAKEIEAPKKDVKSAPKQ−−−−−SVKENSN−−−IKVNTNHIKGWNMTKRGHKPKAVVIHNDAG−−−−−TMNSKQYYNNLVNADYNRLAR−−−−−GIAHAYADRNGIWEAISEDRIAWHVSDGVQPGSGNFETYGIEVNQSMYVGDKDFLKNEQTALKFAA−−HKLKKWGLPANRNTVRLHNEFSYTACPHR−−−−−−−−−−−−−SAKLHAGIDPTKQAWNKAAQLKLK−−−−DYFIKQ−−−IRAYMKGDTPKVTTVKSKPGSASTPANRRDMNGWKVNKYGTYYKTEHATFTPNTPIKTHYVGPFRSCPV−−−SGVLQPGQTVRYDTVCKQDGHVWISYT−−−−AYNGKDVWLAVRTWNKNTDS−−−LGKLWGTI 
fig|596319.3.peg.2249   Staphylococcus warneri L37603                                        YNLEGKGWDFDGVYGWQCVDLAN−−−−MYWYKLFGHGLKGEGAADIP−−NVNDFKGEATVYQNTPEFKAKPGDVVIFNRNYGGGYGHVAIVLDGNHDGSYNSFVSLDQNWYGGGLAKT−−−−−−−−EIAQRIVHNYDFPMWFIRPKYKTKTQSRSTQSPTLEKKK−−−−−VTVKKKRKARKLKYIQDYVTGYNLPKRGHNPKGIVIHNDAGSI−−−EATAEAYRNGLVNAPLSRLEA−−−−−GIAHSYISGNTVWQALDESQIGWHTANQS−−−−GNKSFYGVEVCQSIGADDKTFLQNEQAAFQECA−−RLLKKWGLPANRNTIRLHCEFVSTSCPHR−−−−−−−−−−−−−SSELHTGFDPVTQGLLPKNKQLKLK−−−−DYFIKQ−−−IRSYMNGDIPVATV−−VKGTSASSNTKSTVAGAWKRNSYGSWYMSEKARFTNGNQPIAVRTVGPFRSCPY−−−AYDFQPGGYCDYDEVILQDEHVWVGYD−−−−−WEGQRYYLPIREWNGVAPPNQGLGDLWGTIS
fig|158878.14.peg.940   Staphylococcus aureus subsp. aureus Mu50                                                                                   AKDIP−−FANNFDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVIEATLD−−−−YIIVYEQNWLGGGWTDRIEQPGWGWEKVTRRQHAYDFPMWFIRPNFKSETAPRSIQSPTQASKK−−−−−ETAKPQPKAVELKIIKDVVKGYDLPKRGGNPKGIVIHNDAGSK−−−GATAEAYRNGLVNAPLSRLEA−−−−−GIAHSYVSGNTVWQALDESQVGWHTANQL−−−−GNKYYYGIEVCQSMGADNATFLKNEQATFQECA−−RLLKKWGLPANRNTIRLHNEFTSTSCPHR−−−−−−−−−−−−−SSVLHTGFDPVTRGLLPEDKQLQLK−−−−DYFIKQ−−−IRVYMDGKIPVATV−−SNESSASSNTVKPVASAWKRNKYGTYYMEESARFTNGNQPITVRKIGPFLSCPV−−−AYQFQPGGYCDYTEVMLQDGHVWVGYT−−−−−WEGQRYYLPIRTWNGSAPPNQILGDLWGEIS
fig|320848.3.peg.31   Bacteriophage 88                                                                                   AKDIP−−FANNFDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVIEATLD−−−−YIIVYEQNWLGGGWTDRIEQPGWGWEKVTRRQHAYDFPMWFIRPNFKSETAPRSIQSPTQASKK−−−−−ETAKPQPKAVELKIIKDVVKGYDLPKRGGNPKGIVIHNDAGSK−−−GATAEAYRNGLVNAPSSRLEA−−−−−GIAHSYVSGNTVWQALDESQVGWHTANQL−−−−GNKYYYGIEVCQSMGADNATFLKNEQATFQECA−−RLLKKWGLPANRNTIRLHNEFTSTSCPHR−−−−−−−−−−−−−SSVLHTGFDPVTRGLLPEDKQLQLK−−−−DYFIKQ−−−IRVYMDGKIPVATV−−SNESSASSNTVKPVASAWKRNKYGTYYMEESARFTNGNQPITVRKIGPFLSCPV−−−AYQFQPGGYCDYTEVMLQDGHVWVGYT−−−−−WEGQRYYLPIRTWNGSAPPNQILGDLWGEIS
fig|585151.3.peg.1498   Staphylococcus aureus subsp. aureus C427                                                                                   AKDIP−−FANNFDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVIEATLD−−−−YIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRKHAYDFPMWFIRPNFKSEIAPRSVQSPTQAPKK−−−−−ETAKPQPKAVELKIIKDVVKGYDLPKRGSNPKGIVIHNDAGGK−−−GATAEAYRNGLVNAPLSRLEA−−−−−GIAHSYVSGNTVWQALDESQVGWHTANQI−−−−GNKYYYGIEVCQSMGADNATFLKNEQATFQECA−−RLLKKWGLPANRNTIRLHNEFTSTSCPHR−−−−−−−−−−−−−SSVLHTGFDPVTRGLLPEDKQLQLK−−−−DYFIKQ−−−IRVYMDGKIPVATV−−SNESSASSNTVKPVASAWKRNKYGTYYMEESARFTNGNQPITVRKIGPFLSCPV−−−AYQFQPGGYCDYTEVMLQDGHVWVGYT−−−−−WEGQRYYLPIRTWNGSAPPNQILGDLWGEIS
fig|546342.3.peg.726   Staphylococcus aureus subsp. aureus str. JKD6008                                                                                   AKDIP−−FANNFDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVIEATLD−−−−YIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAYDFPMWFIRPNFKSETAPRSVQSPTQAPKK−−−−−ETAKPQPKAIELKIIKDVVKGYDLPKRGGNPKGIVIHNDAGSK−−−GATAEAYRNGLVNAPLSRLEA−−−−−GIAHSYVSGNTVWQALDESQVGWHTANQV−−−−GNKYYYGIEVCQSMGADNATFLKNEQATFQECA−−RLLKKWGLPANRNTIRLHNEFTSTSCPHR−−−−−−−−−−−−−SSVLHTGFDPVTRGLLPEDKRLQLK−−−−DYFIKQ−−−IRAYMDGKIPVATV−−SDESSASSNTVKPVASAWKRNKYGTYYMEESARFTNGNQPITVRKIGPFLSCPV−−−AYQFQPGGYCDYTEVMLQDGHVWVGYT−−−−−WEGQRYYLPIRTWNGSAPPNQILGDLWGEIS
fig|553583.3.peg.1930   Staphylococcus aureus A9635                                                                                   AKDIP−−FANNFDGLATVYQNTPDFLAQPGDVVVFGSNYGAGYGHVAWVIEATLD−−−−YIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAYDFPMWFIRPNFKSETAPRSVQSPTQAPKK−−−−−ETAKPQPKAIELKIIKDVVKGYDLPKRGGNPKGIVIHNDAGSK−−−GATAEAYRNGLVNAPLSRLEA−−−−−GIAHSYVSGNTVWQALDESQVGWHTANQV−−−−GNKYYYGIEVCQSMGADNATFLKNEQATFQECA−−RLLKKWGLPANRNTIRLHNEFTSTSCPHR−−−−−−−−−−−−−SSVLHTGFDPVTRGLLPEDKRLQLK−−−−DYFIKQ−−−IRAYMDGKIPVATV−−SNESSASSNTVKPVASAWKRNKYGTYYMEESARFTNGNQPITVRKIGPFLSCPV−−−AYQFQPGGYCDYTEVMLQDCHVWVGYT−−−−−WEGQRYYLPIRTWNGSAPPNQILGDLWGEIS
fig|585155.3.peg.2405   Staphylococcus aureus subsp. aureus H19                                                                                   AKDIP−−FANNFDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVIEATLD−−−−YIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAYDFPMWFIRPNFKSEIAPRSVQSPTQAPKK−−−−−ETAIPQPKAVELKIIKDVVKGYDLPKRGGNPKGIVIHNDAGSK−−−GATAEAYRNGLVNAPLSRLEA−−−−−GIAHSYVSGNTVWQALDESQVGWHTANQL−−−−GNKHYYGIEVCQSMGADNATFLKNEQATFQECA−−RLLKKWGLPANRNTIRLHNEFTSTSCPHR−−−−−−−−−−−−−SSVLHTGFDPVTRGLLPEDKRLQLK−−−−DYFIKQ−−−IRAYMDGKIPVATV−−SNDSSASSNTVKPVASAWKRNKYGTYYMEESARFTNGNQPITVRKVGPFLSCPV−−−GYQFQPGGYCDYTEVMLQDGHVWVGYT−−−−−WEGQRYYLPIRTWNGSAPPNQILGDLWGEIS
fig|359786.3.peg.356   Staphylococcus aureus subsp. aureus JH9                                                                                   AKDIP−−FANNFDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVIEATLD−−−−YIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAYDFPMWFIRPNFKSEITPRSVQSPTQAPKK−−−−−ETAIPQPKAVELKIIKDVVKGYDLPKRGGNPKGIVIHNDAGSK−−−GATAEAYRNGLVNAPLSRLEA−−−−−GIAHSYVSGNTVWQALDESQVGWHTANQL−−−−GNKYYYGIEVCQSMGADNATFLKNEQATFQECA−−RLLKKWGLPANRNTIRLHNEFTSTSCPHR−−−−−−−−−−−−−SSVLHTGFDPVTRGLLPEDKRLQLK−−−−DYFIKQ−−−IRAYMDGKIPVATV−−SNESSASSNTVKPVASAWKRNKYGTYYMEESARFTNGNQPITVRKVGPFLSCPV−−−GYQFQPGGYCDYTEVMLQDGHVWVGYT−−−−−WEGQRYYLPIRTWNGSAPPNQILGDLWGEIS
fig|359787.11.peg.1134   Staphylococcus aureus subsp. aureus JH1                                                                                   AKDIP−−FANNFDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVIEATLD−−−−YIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAYDFPMWFIRPNFKSEITPRSVQSPTQAPKK−−−−−ETAIPQPKAVELKIIKDVVKGYDLPKRGGNPKGIVIHNDAGSK−−−GATAEAYRNGLVNAPLSRLEA−−−−−GIAHSYVSGNTVWQALDESQVGWHTANQL−−−−GNKYYYGIEVCQSMGADNATFLKNEQATFQECA−−RLLKKWGLPANRNTIRLHNEFTSTSCPHR−−−−−−−−−−−−−SSVLHTGFDPVTRGLLPEDKRLQLK−−−−DYFIKQ−−−IRAYMDGKIPVATV−−SNESSASSNTVKPVASAWKRNKYGTYYMEESARFTNGNQPITVRKVGPFLSCPV−−−GYQFQPGGYCDYTEVMLQDGHVWVGYT−−−−−WEGQRYYLPIRTWNGSAPPNQILGDLWGEIS
fig|359786.3.peg.805   Staphylococcus aureus subsp. aureus JH9                                                                                   AKDIP−−FANNFDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVIEASLD−−−−YIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAYDFPMWFIRPNFKSETAPRSVQSPTQAPKK−−−−−ETAIPQPKAVELKIIKDVVKGYDLPKRGGNPKGIVIHNDAGSK−−−GATAEAYRNGLVNAPLSRLEA−−−−−GIAHSYVSGNTVWQALDESQVGWHTANQI−−−−GNKYYYGIEVCQSMGADNATFLKNEQATFQECA−−RLLKKWGLPANRNTIRLHNEFTSTSCPHR−−−−−−−−−−−−−SSVLHTGFDPVTRGLLPEDKRLQLK−−−−DYFIKQ−−−IRAYMDGKIPVATV−−SNESSASSNTVKPVASAWKRNKYGTYYMEESARFTNGNQPITVRKVGPFLSCPV−−−GYQFQPGGYCDYTEVMLQDGHVWVGYT−−−−−WEGQRYYLPIRTWNGSAPPNQILGDLWGEIS
fig|359787.11.peg.405   Staphylococcus aureus subsp. aureus JH1                                                                                   AKDIP−−FANNFDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVIEASLD−−−−YIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAYDFPMWFIRPNFKSETAPRSVQSPTQAPKK−−−−−ETAIPQPKAVELKIIKDVVKGYDLPKRGGNPKGIVIHNDAGSK−−−GATAEAYRNGLVNAPLSRLEA−−−−−GIAHSYVSGNTVWQALDESQVGWHTANQI−−−−GNKYYYGIEVCQSMGADNATFLKNEQATFQECA−−RLLKKWGLPANRNTIRLHNEFTSTSCPHR−−−−−−−−−−−−−SSVLHTGFDPVTRGLLPEDKRLQLK−−−−DYFIKQ−−−IRAYMDGKIPVATV−−SNESSASSNTVKPVASAWKRNKYGTYYMEESARFTNGNQPITVRKVGPFLSCPV−−−GYQFQPGGYCDYTEVMLQDGHVWVGYT−−−−−WEGQRYYLPIRTWNGSAPPNQILGDLWGEIS
fig|553571.3.peg.5   Staphylococcus aureus A6300                                                                                   AKDIP−−FANNFDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVIEASLD−−−−YIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAYDFPMWFIRPNFKSETAPRSVQSPTQAPKK−−−−−ETAIPQPKAVELKIIKDVVKGYDLPKRGGNPKGIVIHNDAGSK−−−GATAEAYRNGLVNAPLSRLEA−−−−−GIAHSYVSGNTVWQALDESQVGWHTANQI−−−−GNKYYYGIEVCQSMGADNATFLKNEQATFQECA−−RLLKKWGLPANRNTIRLHNEFTSTSCPHR−−−−−−−−−−−−−SSVLHTGFDPVTRGLLPEDKRLQLK−−−−DYFIKQ−−−IRAYMDGKIPVATV−−SNESSASSNTVKPVASAWKRNKYGTYYMEESARFTNGNQPITVRKVGPFLSCPV−−−GYQFQPGGYCDYTEVMLQDGHVWVGYT−−−−−WEGQRYYLPIRTWNGSAPPNQILGDLWGEIS
fig|585152.3.peg.1775   Staphylococcus aureus subsp. aureus D139                                                                                   AKDIP−−FANNFDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVIEATLD−−−−YIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAYDFPMWFIRPNFKSETAPRSVQSPTQAPKK−−−−−ETAKPQPKAVELKIIKDVVKGYDLPKRGSNPKGIVIHNDAGSK−−−GATAEAYRNGLVNAPLSRLEA−−−−−GIAHSYVSGNTVWQALDESQVGWHTANQI−−−−GNKYYYGIEVCQSMGADNATFLKNEQATFQECA−−RLLKKWGLPANRNTIRLHNEFTSTSCPHR−−−−−−−−−−−−−SSVLHTGFDPVTRGLLPEDKRLQLK−−−−DYFIKQ−−−IRAYMDGKIPVATV−−SNESSASSNTVKPVASAWKRNKYGTYYMEESARFTNGNQPITVRKVGPFLSCPV−−−GYQFQPGGYCDYTEVMLQDDHVWVGYT−−−−−WEGQRYYLPIRTWNGSAPPNQILGDLWGEIS
fig|273036.3.peg.1646   Staphylococcus aureus RF122                                                                                   AKDIP−−FANNFDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVIEATLD−−−−YIIVYEQNWLGGGWTDGVQQPGSGWEKVTRRQHAYDFPMWFIRPNFKSETAPRSVQSPTQASKK−−−−−ETAKPQPKAVELKIIKDVVKGYDLPKRGSNPNFIVIHNDAGSK−−−GATAEAYRNGLVNAPLSRLEA−−−−−GIAHSYVSGNTVWQALDESQVGWHTANQI−−−−GNKYGYGIEVCQSMGADNATFLKNEQATFQECA−−RLLKKWGLPANRNTIRLHNEFTSTSCPHR−−−−−−−−−−−−−SSVLHTGFDPVTRGLLPEDKRLQLK−−−−DYFIKQ−−−IRAYMDGKIPVATV−−SNDSSASSNTVKPVASAWKRNKYGTYYMEESARFTNGNQPITVRKVGPFLSCPV−−−GYQFQPGGYCDYTEVMLQDGHVWVGYT−−−−−WEGQRYYLPIRTWNGSAPPNQILGDLWGEIS
fig|1157007.3.peg.2150   Staphylococcus aureus M0045                                                                                   AKDIP−−FANNFDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVIEATLD−−−−YIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAYDFPMWFIRPNFKSETAPRSIQSPTQAPKK−−−−−ETAKPQPKAVELKIIKDVVKGYDLPKRGSNPKGIVIHNDAGSK−−−GATAEAYRNGLVNAPLSRLEA−−−−−GIAHSYVSGNTVWQALDESQVGWHTANQI−−−−GNKYYYGIEVCQSMGADNATFLKNEQATFQECA−−RLLKKWGLPANRNTIRLHNEFTSTSCPHR−−−−−−−−−−−−−SSVLHTGFDPVTRGLLPEDKRLQLK−−−−DYFIKQ−−−IRAYMDGKIPVATV−−SNESSASSNTVKPVASAWKRNKYGTYYMEESARFTNGNQPITVRKVGPFLSCPV−−−GYQFQPGGYCDYTEVMLQDGHVWVGYT−−−−−WEGQRYYLPIRTWNGSAPPNQILGDLWGEIS
fig|387908.2.peg.66   Siphoviridae Staphylococcus aureus phage phiNM2                                                                                   AKDIP−−FANNFDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVIEATLD−−−−YIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAYDFPMWFIRPNFKSETAPRSVQSPTQAPKK−−−−−ETAKPQPKAVELKIIKDVVKGYDLPKRGSNPKGIVIHNDAGSK−−−GATAEAYRNGLVNAPLSRLEA−−−−−GIAHSYVSGNTVWQALDESQVGWHTANQI−−−−GNKYYYGIEVCQSMGADNATFLKNEQATFQECA−−RLLKKWGLPANRNTIRLHNEFTSTSCPHR−−−−−−−−−−−−−SSVLHTGFDPVTRGLLPEDKRLQLK−−−−DYFIKQ−−−IRAYMDGKIPVATV−−SNESSASSNTVKPVASAWKRNKYGTYYMEESARFTNGNQPITVRKVGPFLSCPV−−−GYQFQPGGYCDYTEVMLQDGHVWVGYT−−−−−WEGQRYYLPIRTWNGSSPPNQILGDLWGEIS
fig|1224925.3.peg.1936   Staphylococcus aureus M0273                                                NVDLWYAFQCFDYAN−−−−AGWKALFGLLLKGVGAKDIP−−FANNFDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVIEATLD−−−−YIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAYDFPMWFIRPNFKSETAPRSVQSPTQAPKK−−−−−ETAKPQPKAVELKIIKDVVKGYDLPKRGSNPKGIVIHNDAGSK−−−GATAEAYRNGLVNAPLSRLEA−−−−−GIAHSYVSGNTVWQALDESQVGWHTANQI−−−−GNKYYYGIEVCQSMGADNATFLKNEQATFQECA−−RLLKKWRLPANRNTIRLHNEFTSTSCPHR−−−−−−−−−−−−−SSVLHTGFDPVTRGLLPEDKRLQLK−−−−DYFIKQ−−−IRAYMDGKIPVATV−−SNESSASSNTVKPVASAWKRNKYGTYYMEESARFTNGNQPITVRKVGPFLSCPV−−−GYQFQPGGYCDYTEVMLQDGHVWVGYT−−−−−WEGQRYYLPIRTWNGSAPPNQILGDLWGEIS
fig|931452.3.peg.2512   Staphylococcus aureus subsp. aureus CIG1267                                                                                   AKDIP−−FANNFDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVIEATLD−−−−YIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAYDFPMWFIRPNFKSETAPRSVQSPTQAPKK−−−−−ETAKPQPKAVELKIIKDVVKGYDLPKRGSNPKGIVIHNDAGSK−−−GATAEAYRNGLVNAPLSRLEA−−−−−GIAHSYVSGNTVWQALDESQVGWHTANQI−−−−GNKYYYGIEVCQSMGADNATFLKNEQATFQECA−−RLLKKWGLPANRNTIRLHNEFTSTSCPHR−−−−−−−−−−−−−SSVLHTGFDPVTRGLLPEDKRLQLK−−−−DYFIKQ−−−IRAYMDGKIPVATV−−SNESSASSNTVKPVASAWKRNKYGTYYMEESARFTNGNQPITVRKVGPFLSCPV−−−GYQFQPGGYCDYTEVMLQDGHVWVGYT−−−−−WEGQRYYLPIRTWNGSAPPNQILGDLWGEIS
fig|904725.3.peg.1663   Staphylococcus aureus subsp. aureus 21189                                                                                   AKDIP−−FANNFDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVIEATLD−−−−YIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAYDFPMWFIRPNFKSETAPRSVQSPTQAPKK−−−−−ETAKPQPKAVELKIIKDVVKGYDLPKRGSNPKGIVIHNDAGSK−−−GATAEAYRNGLVNAPLSRLEA−−−−−GIAHSYVSGNTVWQALDESQVGWHTANQI−−−−GNKYYYGIEVCQSMGADNATFLKNEQATFQECA−−RLLKKWGLPANRNTIRLHNEFTSTSCPHR−−−−−−−−−−−−−SSVLHTGFDPVTRGLLPEDKRLQLK−−−−DYFIKQ−−−IRAYMDGKIPVATV−−SNESSASSNTVKPVASAWKRNKYGTYYMEESARFTNGNQPITVRKVGPFLSCPV−−−GYQFQPGGYCDYTEVMLQDGHVWVGYT−−−−−WEGQRYYLPIRTWNGSAPPNQILGDLWGEIS