(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00013520

fig|233413.1.peg.391   Mycobacterium bovis AF2122/97                                                         PSAVGGRHRVVIIGSGFGGLNAAK−−−−ALKR−−−−A−−−−−−−D−−−−−−−−−−VDITLI−−SKTTTH−−−LF−−−−QPLLY−−−−−−−QVATGILSE−−GDIAPTTRLILRR−−−QK−−−−−−−−−−NV−−−RVLLGE−−−VNAI−−−−−−DLKAQ−−−−−−TVTS−−−−−−−−−−−−−−−−−−−−−K−−LMDM−−−−−−TTVTPY−−DSLIVAAGAQ−−−−−−−−−QSYFGNDEFA−−−−TFAPG−−MKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEAAEVST−−−−−DHAE−−−RE−−−−−−−−−−RRL−−−−−TFVVV−−−GAG−−−−−PTGVEVAGQIVE−−−−−−−LAERTL−−−AGAFRTIT−−−−−−PSE−−−−−−−−−CRVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGPKLG−−−−−−−−−L−−−KA−−QRRLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MDAEV−−−QLNAMVTAVDY−−−−−−−−−−−−−−−−−−−−−−−−−KG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−IKEKDGGERR−−−−−IEC−−−−−−−−−−−−−−−−ACKVWAAGVAAS−−−PLGKMIAEGSDGTEI−−−−−DRAGRVI−−−−VEP−−−−−−−−−−−−−−−−−−−DLTV−−−−−−−−−KG−−−−−−HP−−NVFVVGD−−LMFV−−−−−−−−−P−−−−−−−−−−−−−−−−−−GVPGVAQGAIQGARYATTVIKHMVKGN−−DDPANRKP                                                                                                  
fig|410289.13.peg.422   Mycobacterium bovis BCG str. Pasteur 1173P2                                                         PSAVGGRHRVVIIGSGFGGLNAAK−−−−ALKR−−−−A−−−−−−−D−−−−−−−−−−VDITLI−−SKTTTH−−−LF−−−−QPLLY−−−−−−−QVATGILSE−−GDIAPTTRLILRR−−−QK−−−−−−−−−−NV−−−RVLLGE−−−VNAI−−−−−−DLKAQ−−−−−−TVTS−−−−−−−−−−−−−−−−−−−−−K−−LMDM−−−−−−TTVTPY−−DSLIVAAGAQ−−−−−−−−−QSYFGNDEFA−−−−TFAPG−−MKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEAAEVST−−−−−DHAE−−−RE−−−−−−−−−−RRL−−−−−TFVVV−−−GAG−−−−−PTGVEVAGQIVE−−−−−−−LAERTL−−−AGAFRTIT−−−−−−PSE−−−−−−−−−CRVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGPKLG−−−−−−−−−L−−−KA−−QRRLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MDAEV−−−QLNAMVTAVDY−−−−−−−−−−−−−−−−−−−−−−−−−KG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−IKEKDGGERR−−−−−IEC−−−−−−−−−−−−−−−−ACKVWAAGVAAS−−−PLGKMIAEGSDGTEI−−−−−DRAGRVI−−−−VEP−−−−−−−−−−−−−−−−−−−DLTV−−−−−−−−−KG−−−−−−HP−−NVFVVGD−−LMFV−−−−−−−−−P−−−−−−−−−−−−−−−−−−GVPGVAQGAIQGARYATTVIKHMVKGN−−DDPANRKP                                                                                                  
fig|561275.4.peg.433   Mycobacterium bovis BCG str. Tokyo 172                                                         PSAVGGRHRVVIIGSGFGGLNAAK−−−−ALKR−−−−A−−−−−−−D−−−−−−−−−−VDITLI−−SKTTTH−−−LF−−−−QPLLY−−−−−−−QVATGILSE−−GDIAPTTRLILRR−−−QK−−−−−−−−−−NV−−−RVLLGE−−−VNAI−−−−−−DLKAQ−−−−−−TVTS−−−−−−−−−−−−−−−−−−−−−K−−LMDM−−−−−−TTVTPY−−DSLIVAAGAQ−−−−−−−−−QSYFGNDEFA−−−−TFAPG−−MKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEAAEVST−−−−−DHAE−−−RE−−−−−−−−−−RRL−−−−−TFVVV−−−GAG−−−−−PTGVEVAGQIVE−−−−−−−LAERTL−−−AGAFRTIT−−−−−−PSE−−−−−−−−−CRVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGPKLG−−−−−−−−−L−−−KA−−QRRLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MDAEV−−−QLNAMVTAVDY−−−−−−−−−−−−−−−−−−−−−−−−−KG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−IKEKDGGERR−−−−−IEC−−−−−−−−−−−−−−−−ACKVWAAGVAAS−−−PLGKMIAEGSDGTEI−−−−−DRAGRVI−−−−VEP−−−−−−−−−−−−−−−−−−−DLTV−−−−−−−−−KG−−−−−−HP−−NVFVVGD−−LMFV−−−−−−−−−P−−−−−−−−−−−−−−−−−−GVPGVAQGAIQGARYATTVIKHMVKGN−−DDPANRKP                                                                                                  
fig|1765.164.peg.2141   Mycobacterium bovis str. 09-5872                                                                   VIIGSGFGGLNAAK−−−−ALKR−−−−A−−−−−−−D−−−−−−−−−−VDITLI−−SKTTTH−−−LF−−−−QPLLY−−−−−−−QVATGILSE−−GDIAPTTRLILRR−−−QK−−−−−−−−−−NV−−−RVLLGE−−−VNAI−−−−−−DLKAQ−−−−−−TVTS−−−−−−−−−−−−−−−−−−−−−K−−LMDM−−−−−−TTVTPY−−DSLIVAAGAQ−−−−−−−−−QSYFGNDEFA−−−−TFAPG−−MKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEAAEVST−−−−−DHAE−−−RE−−−−−−−−−−RRL−−−−−TFVVV−−−GAG−−−−−PTGVEVAGQIVE−−−−−−−LAERTL−−−AGAFRTIT−−−−−−PSE−−−−−−−−−CRVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGPKLG−−−−−−−−−L−−−KA−−QRRLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MDAEV−−−QLNAMVTAVDY−−−−−−−−−−−−−−−−−−−−−−−−−KG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−IKEKDGGERR−−−−−IEC−−−−−−−−−−−−−−−−ACKVWAAGVAAS−−−PLGKMIAEGSDGTEI−−−−−DRAGRVI−−−−VEP−−−−−−−−−−−−−−−−−−−DLTV−−−−−−−−−KG−−−−−−HP−−NVFVVGD−−LMFV−−−−−−−−−P−−−−−−−−−−−−−−−−−−GVPGVAQGAIQGARYATTVIKHMVKGN−−DDPANRKP                                                                                                  
fig|1765.207.peg.2661   Mycobacterium bovis str. 11-4782                                                                   VIIGSGFGGLNAAK−−−−ALKR−−−−A−−−−−−−D−−−−−−−−−−VDITLI−−SKTTTH−−−LF−−−−QPLLY−−−−−−−QVATGILSE−−GDIAPTTRLILRR−−−QK−−−−−−−−−−NV−−−RVLLGE−−−VNAI−−−−−−DLKAQ−−−−−−TVTS−−−−−−−−−−−−−−−−−−−−−K−−LMDM−−−−−−TTVTPY−−DSLIVAAGAQ−−−−−−−−−QSYFGNDEFA−−−−TFAPG−−MKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEAAEVST−−−−−DHAE−−−RE−−−−−−−−−−RRL−−−−−TFVVV−−−GAG−−−−−PTGVEVAGQIVE−−−−−−−LAERTL−−−AGAFRTIT−−−−−−PSE−−−−−−−−−CRVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGPKLG−−−−−−−−−L−−−KA−−QRRLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MDAEV−−−QLNAMVTAVDY−−−−−−−−−−−−−−−−−−−−−−−−−KG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−IKEKDGGERR−−−−−IEC−−−−−−−−−−−−−−−−ACKVWAAGVAAS−−−PLGKMIAEGSDGTEI−−−−−DRAGRVI−−−−VEP−−−−−−−−−−−−−−−−−−−DLTV−−−−−−−−−KG−−−−−−HP−−NVFVVGD−−LMFV−−−−−−−−−P−−−−−−−−−−−−−−−−−−GVPGVAQGAIQGARYATTVIKHMVKGN−−DDPANRKP                                                                                                  
fig|1806.1.peg.3198   Mycobacterium microti OV254                                                         PSAVGGRHRVVIIGSGFGGLNAAK−−−−ALKR−−−−A−−−−−−−D−−−−−−−−−−VDITLI−−SKTTTH−−−LF−−−−QPLLY−−−−−−−QVATGILSE−−GDIAPTTRLILRR−−−QK−−−−−−−−−−NV−−−RVLLGE−−−VNAI−−−−−−DLKAQ−−−−−−TVTS−−−−−−−−−−−−−−−−−−−−−K−−LMDM−−−−−−TTVTPY−−DSLIVAAGAQ−−−−−−−−−QSYFGNDEFA−−−−TFAPG−−MKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEAAEVST−−−−−DHAE−−−RE−−−−−−−−−−RRL−−−−−TFVVV−−−GAG−−−−−PTGVEVAGQIVE−−−−−−−LAERTL−−−AGAFRTIT−−−−−−PSE−−−−−−−−−CRVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGPKLG−−−−−−−−−L−−−KA−−QRRLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MDVEV−−−QLNAMVTAVDY−−−−−−−−−−−−−−−−−−−−−−−−−KG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−IKEKDGGERR−−−−−IEC−−−−−−−−−−−−−−−−ACKVWAAGVAAS−−−PLGKMIAEGSDGTEI−−−−−DRAGRVI−−−−VEP−−−−−−−−−−−−−−−−−−−DLTV−−−−−−−−−KG−−−−−−HP−−NVFVVGD−−LMFV−−−−−−−−−P−−−−−−−−−−−−−−−−−−GVPGVAQGGIQGARYATTVIKHMVKGN−−DDPANRKP                                                                                                  
fig|515617.4.peg.846   Mycobacterium tuberculosis T92                                                         PSAVGGRHRVVIIGSGFGGLNAAK−−−−ALKR−−−−A−−−−−−−D−−−−−−−−−−VDITLI−−SKTTTH−−−LF−−−−QPLLY−−−−−−−QVATGILSE−−GDIAPTTRLILRR−−−QK−−−−−−−−−−NV−−−RVLLGE−−−VNAI−−−−−−DLKAQ−−−−−−TVTS−−−−−−−−−−−−−−−−−−−−−K−−LMDM−−−−−−TTVTPY−−DSLIVAAGAQ−−−−−−−−−QSYFGNDEFA−−−−TFAPG−−MKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEAAEVST−−−−−DHAE−−−RE−−−−−−−−−−RRL−−−−−TFVVV−−−GAG−−−−−PTGVEVAGQIVE−−−−−−−LAERTL−−−AGAFRTIT−−−−−−PSE−−−−−−−−−CRVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGPKLG−−−−−−−−−L−−−KA−−QRRLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MDVEV−−−QLNAMVTAVDY−−−−−−−−−−−−−−−−−−−−−−−−−KG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−IKEKDGGERR−−−−−IEC−−−−−−−−−−−−−−−−ACKVWAAGVAAS−−−PLGKMIAEGSDGTEI−−−−−DRAGRVI−−−−VEP−−−−−−−−−−−−−−−−−−−DLTV−−−−−−−−−KG−−−−−−HP−−NVFVVGD−−LTFV−−−−−−−−−P−−−−−−−−−−−−−−−−−−GVPGVAQGAIQGARYATTVIKHMVKGN−−DDPANRKP                                                                                                  
fig|520140.3.peg.465   Mycobacterium tuberculosis EAS054                                                                   VIIGSGFGGLNAAK−−−−ALKR−−−−A−−−−−−−D−−−−−−−−−−VDITLI−−SKTTTH−−−LF−−−−QPLLY−−−−−−−QVATGILSE−−GDIAPTTRLILRR−−−QK−−−−−−−−−−NV−−−RVLLGE−−−VNAI−−−−−−DLKAQ−−−−−−TVTS−−−−−−−−−−−−−−−−−−−−−K−−LMDM−−−−−−TTVTPY−−DSLIVAAGAQ−−−−−−−−−QSYFGNDEFA−−−−TFAPG−−MKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEAAEVST−−−−−DHAE−−−RE−−−−−−−−−−RRL−−−−−TFVVV−−−GAG−−−−−PTGVEVAGQIVE−−−−−−−LAERTL−−−AGAFRTIT−−−−−−PSE−−−−−−−−−CRVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGPKLG−−−−−−−−−L−−−KA−−QRRLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MDVEV−−−QLNAMVTAVDY−−−−−−−−−−−−−−−−−−−−−−−−−KG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−IKEKDGGERR−−−−−IEC−−−−−−−−−−−−−−−−ACKVWAAGVAAS−−−PLGKMIAEGSDGTEI−−−−−DRAGRVI−−−−VEP−−−−−−−−−−−−−−−−−−−DLTV−−−−−−−−−KG−−−−−−HP−−NVFVVGD−−LTFV−−−−−−−−−P−−−−−−−−−−−−−−−−−−GVPGVAQGAIQGARYATTVIKHMVKGN−−DDPANRKP                                                                                                  
fig|336982.3.peg.405   Mycobacterium tuberculosis F11                                                         PSAVGGRHRVVIIGSGFGGLNAAK−−−−ALKR−−−−A−−−−−−−D−−−−−−−−−−VDITLI−−SKTTTH−−−LF−−−−QPLLY−−−−−−−QVATGILSE−−GDIAPTTRLILRR−−−QK−−−−−−−−−−NV−−−RVLLGE−−−VNAI−−−−−−DLKAQ−−−−−−TVTS−−−−−−−−−−−−−−−−−−−−−K−−LMDM−−−−−−TTVTPY−−DSLIVAAGAQ−−−−−−−−−QSYFGNDEFA−−−−TFAPG−−MKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEAAEVST−−−−−DHAE−−−RE−−−−−−−−−−RRL−−−−−TFVVV−−−GAG−−−−−PTGVEVAGQIVE−−−−−−−LAERTL−−−AGAFRTIT−−−−−−PSE−−−−−−−−−CRVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGPKLG−−−−−−−−−L−−−KA−−QRRLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MDVEV−−−QLNAMVTAVDY−−−−−−−−−−−−−−−−−−−−−−−−−KG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−IKEKDGGERR−−−−−IEC−−−−−−−−−−−−−−−−ACKVWAAGVAAS−−−PLGKMIAEGSDGTEI−−−−−DRAGRVI−−−−VEP−−−−−−−−−−−−−−−−−−−DLTV−−−−−−−−−KG−−−−−−HP−−NVFVVGD−−LMFV−−−−−−−−−P−−−−−−−−−−−−−−−−−−GVPGVAQGAIQGARYATTVIKHMVKGN−−DDPANRKP                                                                                                  
fig|611304.3.peg.3195   Mycobacterium tuberculosis K85                                                                   VIIGSGFGGLNAAK−−−−ALKR−−−−A−−−−−−−D−−−−−−−−−−VDITLI−−SKTTTH−−−LF−−−−QPLLY−−−−−−−QVATGILSE−−GDIAPTTRLILRR−−−QK−−−−−−−−−−NV−−−RVLLGE−−−VNAI−−−−−−DLKAQ−−−−−−TVTS−−−−−−−−−−−−−−−−−−−−−K−−LMDM−−−−−−TTVTPY−−DSLIVAAGAQ−−−−−−−−−QSYFGNDEFA−−−−TFAPG−−MKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEAAEVST−−−−−DHAE−−−RE−−−−−−−−−−RRL−−−−−TFVVV−−−GAG−−−−−PTGVEVAGQIVE−−−−−−−LAERTL−−−AGAFRTIT−−−−−−PSE−−−−−−−−−CRVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGPKLG−−−−−−−−−L−−−KA−−QRRLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MDVEV−−−QLNAMVTAVDY−−−−−−−−−−−−−−−−−−−−−−−−−KG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−IKEKDGGERR−−−−−IEC−−−−−−−−−−−−−−−−ACKVWAAGVAAS−−−PLGKMIAEGSDGTEI−−−−−DRAGRVI−−−−VEP−−−−−−−−−−−−−−−−−−−DLTV−−−−−−−−−KG−−−−−−HP−−NVFVVGD−−LMFV−−−−−−−−−P−−−−−−−−−−−−−−−−−−GVPGVAQGAIQGARYATTVIKHMVKGN−−DDPANRKP                                                                                                  
fig|216594.1.peg.3282   Mycobacterium marinum M                                                          SAAGRRHHVVIIGSGFGGLSAAR−−−−ALKR−−−−A−−−−−−−D−−−−−−−−−−VDITLI−−SKTTTH−−−LF−−−−QPLLY−−−−−−−QVATGILSE−−GDIAPTTRLILRR−−−QK−−−−−−−−−−NV−−−RVLLGE−−−VMGI−−−−−−DLNAQ−−−−−−TVTS−−−−−−−−−−−−−−−−−−−−−K−−LMDM−−−−−−TTVSPY−−DSLIVAAGAQ−−−−−−−−−QSYFGNDDFA−−−−IFAPG−−MKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEAAEVAT−−−−−DHDE−−−RE−−−−−−−−−−RRL−−−−−TFVVV−−−GAG−−−−−PTGVELAGEIVQ−−−−−−−LAERTL−−−AGAFRTIT−−−−−−PSE−−−−−−−−−CRVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGPKLG−−−−−−−−−L−−−KA−−QKKLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MDVEI−−−QLNAMVTAVDY−−−−−−−−−−−−−−−−−−−−−−−−−KG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VKDKDGTERR−−−−−IDC−−−−−−−−−−−−−−−−ACKVWAAGVQAS−−−PLGKMIAEQSDGTET−−−−−DRAGRVI−−−−VEP−−−−−−−−−−−−−−−−−−−DLTV−−−−−−−−−KG−−−−−−HP−−HVFVIGD−−LMSV−−−−−−−−−P−−−−−−−−−−−−−−−−−−GVPGMAQGAIQGAHYATKTIKQAVKGH−−DDPANRKP                                                                                                  
fig|557599.3.peg.2335   Mycobacterium kansasii ATCC 12478                                                             GRRHHVVIIGSGFGGLNAAK−−−−RLKR−−−−A−−−−−−−D−−−−−−−−−−VDITLI−−SKTTTH−−−LF−−−−QPLLY−−−−−−−QVATGILSE−−GDIAPTTRLILRN−−−QK−−−−−−−−−−NV−−−RVLLGE−−−IIDM−−−−−−DLNAK−−−−−−TVTS−−−−−−−−−−−−−−−−−−−−−K−−LMDM−−−−−−QTVTPF−−DSLIVAAGAQ−−−−−−−−−QSYFGNDDFA−−−−IFAPG−−MKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEAAEVAT−−−−−DHAE−−−RK−−−−−−−−−−RRL−−−−−TFVVV−−−GAG−−−−−PTGVELAGEIVQ−−−−−−−LAERTL−−−AGAFRTIT−−−−−−PSE−−−−−−−−−CRVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGPKLG−−−−−−−−−L−−−KA−−QRKLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MDVEV−−−QLNAMVTAVDY−−−−−−−−−−−−−−−−−−−−−−−−−KG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VRDKDGTERR−−−−−IDC−−−−−−−−−−−−−−−−ACKVWAAGVQAS−−−PLGKMVAEQSEGTET−−−−−DRAGRVV−−−−VEP−−−−−−−−−−−−−−−−−−−DLTV−−−−−−−−−KG−−−−−−HP−−YVFVIGD−−LMAV−−−−−−−−−P−−−−−−−−−−−−−−−−−−GVPGMAQGAIQGARYATTIIKHAVKGH−−DDPANRKP                                                                                                  
fig|525368.3.peg.1037   Mycobacterium parascrofulaceum ATCC BAA-614                                                              SRHRVVIIGSGFGGLNAAK−−−−ALKR−−−−A−−−−−−−D−−−−−−−−−−VDVTLI−−SKTTTH−−−LF−−−−QPLLY−−−−−−−QVATGILSE−−GDIAPTTRLILRR−−−QK−−−−−−−−−−NV−−−RVLWGE−−−VSEI−−−−−−DLTAK−−−−−−TVTS−−−−−−−−−−−−−−−−−−−−−H−−LMGM−−−−−−QTVTPF−−DSLIVAAGAQ−−−−−−−−−QSYFGHDEYA−−−−AFAPG−−MKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDD−−−−−−−−AL−−−−−−−−−ELRARI−−−−−−−LGA−−−−−−FEAAEVAT−−−−−DPAE−−−RQ−−−−−−−−−−RRL−−−−−TFVVV−−−GAG−−−−−PTGVELAGEIVQ−−−−−−−LAERTL−−−AGAFRTIT−−−−−−PSE−−−−−−−−−CRVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGENLG−−−−−−−−−L−−−KA−−QRRLQ−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MDVEI−−−QLNAMVTAVDY−−−−−−−−−−−−−−−−−−−−−−−−−LG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VKDADGSQRR−−−−−IEC−−−−−−−−−−−−−−−−ACKVWAAGVQAS−−−ELGKMLAEQSAGTET−−−−−DRAGRVI−−−−VEP−−−−−−−−−−−−−−−−−−−DLTV−−−−−−−−−KG−−−−−−HP−−YVFVVGD−−LMSV−−−−−−−−−P−−−−−−−−−−−−−−−−−−GVPGMAQGAIQGAHYVTRLIKQAVKGQ−−DDPANRKP                                                                                                  
fig|553481.3.peg.4170   Mycobacterium avium subsp. avium ATCC 25291                                                              SRHRVVIIGSGFGGLTAAK−−−−ALKRVPKGT−−−−−−−Q−−−−−−−−−−VDITLI−−SKTTTH−−−LF−−−−QPLLY−−−−−−−QVATGILSE−−GDIAPTTRLILRK−−−QK−−−−−−−−−−NV−−−RVLWGD−−−VSAI−−−−−−DLTAR−−−−−−TVTS−−−−−−−−−−−−−−−−−−−−−H−−LMGM−−−−−−DTVTPY−−DSLIVAAGAQ−−−−−−−−−QSYFGHDEYA−−−−AFAPG−−MKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEAAEVAT−−−−−DPAE−−−RR−−−−−−−−−−RRL−−−−−TFVVV−−−GAG−−−−−PTGVELAGEIVQ−−−−−−−LAERTL−−−AGAFRTIT−−−−−−PSE−−−−−−−−−CRVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGPKLG−−−−−−−−−L−−−KA−−QRRLQ−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MDVEV−−−QLNAMVTAVDY−−−−−−−−−−−−−−−−−−−−−−−−−MG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VKEKDGAERR−−−−−IEC−−−−−−−−−−−−−−−−ACKVWAAGVQAS−−−ALGAMIAEQSDGTET−−−−−DRAGRVI−−−−VEP−−−−−−−−−−−−−−−−−−−DLTV−−−−−−−−−KG−−−−−−HP−−YVFVVGD−−LMSV−−−−−−−−−P−−−−−−−−−−−−−−−−−−GVPGMAQGAIQGAKYAAGIIKQAVKGQ−−DNPAERKP                                                                                                  
fig|262316.1.peg.3874   Mycobacterium avium subsp. paratuberculosis str. k10                                                              SRHRVVIIGSGFGGLTAAK−−−−ALKRVPEGT−−−−−−−Q−−−−−−−−−−VDITLI−−SKTTTH−−−LF−−−−QPLLY−−−−−−−QVATGILSE−−GDIAPTTRLILRK−−−QK−−−−−−−−−−NV−−−RVLWGD−−−VSAI−−−−−−DLTAR−−−−−−TVTS−−−−−−−−−−−−−−−−−−−−−H−−LMGM−−−−−−DTVTPY−−DSLIVAAGAQ−−−−−−−−−QSYFGHDEYA−−−−AFAPG−−MKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEAAEVAT−−−−−DPAE−−−RR−−−−−−−−−−RRL−−−−−TFVVV−−−GAG−−−−−PTGVELAGEIVQ−−−−−−−LAERTL−−−AGAFRTIT−−−−−−PSE−−−−−−−−−CRVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGPKLG−−−−−−−−−L−−−KA−−QRRLQ−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MDVEV−−−QLNAMVTAVDY−−−−−−−−−−−−−−−−−−−−−−−−−MG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VKEKDGAERR−−−−−IEC−−−−−−−−−−−−−−−−ACKVWAAGVQAS−−−ALGAMIAEQSDGTET−−−−−DRAGRVI−−−−VEP−−−−−−−−−−−−−−−−−−−DLTV−−−−−−−−−KG−−−−−−HP−−YVFVVGD−−LMSV−−−−−−−−−P−−−−−−−−−−−−−−−−−−GVPGMAQGAIQGAKYAAGIIKQAVKGQ−−DNPAERKP                                                                                                  
fig|1247747.5.peg.4337   Mycobacterium avium subsp. paratuberculosis S5                                                              SRHRVVIIGSGFGGLTAAK−−−−ALKRVPEGT−−−−−−−Q−−−−−−−−−−VDITLI−−SKTTTH−−−LF−−−−QPLLY−−−−−−−QVATGILSE−−GDIAPTTRLILRK−−−QK−−−−−−−−−−NV−−−RVLWGD−−−VSAI−−−−−−DLTAR−−−−−−TVTS−−−−−−−−−−−−−−−−−−−−−H−−LMGM−−−−−−DTVTPY−−DSLIVAAGAQ−−−−−−−−−QSYFGHDEYA−−−−AFAPG−−MKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEAAEVAT−−−−−DPAE−−−RR−−−−−−−−−−RRL−−−−−TFVVV−−−GAG−−−−−PTGVELAGEIVQ−−−−−−−LAERTL−−−AGAFRTIT−−−−−−PSE−−−−−−−−−CRVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGPKLG−−−−−−−−−L−−−KA−−QRRLQ−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MDVEV−−−QLNAMVTAVDY−−−−−−−−−−−−−−−−−−−−−−−−−MG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VKEKDGAERR−−−−−IEC−−−−−−−−−−−−−−−−ACKVWAAGVQAS−−−ALGAMIAEQSDGTET−−−−−DRAGRVI−−−−VEP−−−−−−−−−−−−−−−−−−−DLTV−−−−−−−−−KG−−−−−−HP−−YVFVVGD−−LMSV−−−−−−−−−P−−−−−−−−−−−−−−−−−−GVPGMAQGAIQGAKYAAGIIKQAVKGQ−−DNPAERKP                                                                                                  
fig|247156.8.peg.2592   Nocardia farcinica IFM 10152                                                               RHQVVVIGSGFGGLFGTK−−−−HLKR−−−−A−−−−−−−D−−−−−−−−−−VDVTLI−−SKTSTH−−−LF−−−−QPLLY−−−−−−−QVATGILSV−−GEIAPATRLVLRK−−−QK−−−−−−−−−−NA−−−RVLLGE−−−VIDI−−−−−−DLEAK−−−−−−TVTS−−−−−−−−−−−−−−−−−−−−−R−−LLNQ−−−−−−NTVTPF−−DSLIVATGAQ−−−−−−−−−QSYFGNDQFA−−−−TYAPG−−MKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEGAELAT−−−−−TQEM−−−RD−−−−−−−−−−RLL−−−−−TFVVI−−−GAG−−−−−PTGVELAGQIAE−−−−−−−LADRTL−−−EGTFDNID−−−−−−PRD−−−−−−−−−ARVILIEGA−−−−−−GAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LGPMGPKLG−−−−−−−−−G−−−KA−−QRRLE−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MGVEI−−−QLNAMVTDVDA−−−−−−−−−−−−−−−−−−−−−−−−−HG−−−−−−−−−−−−−−−−−−−−−−−VT−−−−−−−−−VKDADGTIRR−−−−−IES−−−−−−−−−−−−−−−−SCKVWSAGVQAS−−−PLGKMLAERSAGTEV−−−−−DRAGRVI−−−−VEP−−−−−−−−−−−−−−−−−−−DLTI−−−−−−−−−KG−−−−−−HP−−NVFVVGD−−LMSV−−−−−−−−−P−−−−−−−−−−−−−−−−−−GVPGQAQGAIQGATYAAKQIKAGLHGQ−−−RPEDRKPFKY−−−−−FN                                                                                        
fig|526226.5.peg.917   Gordonia bronchialis DSM 43247                                                        SSPTPHARKHVVIIGSGFGGLFAAQ−−−−RLRK−−−−A−−−−−−−D−−−−−−−−−−VDVTLI−−AKTTHH−−−LF−−−−QPMLY−−−−−−−QVATGIVAE−−GEIAPATRVVLRK−−−QR−−−−−−−−−−NT−−−KVLMGD−−−VFEI−−−−−−NLEAK−−−−−−TVTS−−−−−−−−−−−−−−−−−−−−−R−−LLER−−−−−−VTVTPY−−DSLIIAAGAD−−−−−−−−−QSYFGNDHFA−−−−EYAPG−−MKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDH−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEQAELSD−−−−−DPAE−−−RA−−−−−−−−−−KLL−−−−−TFVVV−−−GAG−−−−−PTGVELAGQIAE−−−−−−−MSDKTL−−−KGAFRNID−−−−−−PTE−−−−−−−−−ARVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPFGEKLG−−−−−−−−−G−−−KA−−ARRLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MGVEV−−−QLNAMVVDLDY−−−−−−−−−−−−−−−−−−−−−−−−−DG−−−−−−−−−−−−−−−−−−−−−−−LV−−−−−−−−−VKEKDGTTRR−−−−−IES−−−−−−−−−−−−−−−−QCKVWSAGVQAS−−−PLGKQLAEQSGVEL−−−−−DRAGRVK−−−−VQP−−−−−−−−−−−−−−−−−−−DLSI−−−−−−−−−PG−−−−−−HP−−DVFVVGD−−MMAV−−−−−−−−−D−−−−−−−−−−−−−−−−−−GVPGVAQGAIQGGRYAADAIKAELKGH−−−SPADRKPFSY−−−−−YDKGSMA−−−−TISRFSAVMQVPIPGTKKKFETEGYFAW                                                   
fig|521096.4.peg.2420   Tsukamurella paurometabola DSM 20162                                                               RHKVVVIGSGFGGLFGTK−−−−ALKR−−−−A−−−−−−−D−−−−−−−−−−VDVTVI−−AKTQHH−−−LF−−−−QPLLY−−−−−−−QVATGILSE−−GEIAPASRVVLRK−−−QK−−−−−−−−−−NA−−−QVLLGE−−−VTDI−−−−−−DLENR−−−−−−TVTS−−−−−−−−−−−−−−−−−−−−−H−−LLDR−−−−−−VTVTPF−−DSLIVAAGAN−−−−−−−−−QSYFGNDRFA−−−−EFAPG−−MKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEQAELSH−−−−−DHDE−−−RE−−−−−−−−−−RLL−−−−−TFVVI−−−GAG−−−−−PTGVELAGQIAE−−−−−−−MSDNTL−−−KGAFRNID−−−−−−PTE−−−−−−−−−ARVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGEKLG−−−−−−−−−N−−−AA−−ADRLR−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MGVEI−−−QLNAMVVDVDA−−−−−−−−−−−−−−−−−−−−−−−−−DG−−−−−−−−−−−−−−−−−−−−−−−LV−−−−−−−−−VKEKDGTERR−−−−−IEA−−−−−−−−−−−−−−−−QCKVWSAGVSAS−−−PLGKIIAEQSGAEV−−−−−DRAGRVK−−−−VLP−−−−−−−−−−−−−−−−−−−DLTV−−−−−−−−−PG−−−−−−NP−−NVFVVGD−−MMAV−−−−−−−−−D−−−−−−−−−−−−−−−−−−GVPGMAQGAIQGSTYAAKAIKAGLAGQ−−−SP                                                                                                       
fig|632772.3.peg.7128   Rhodococcus opacus B4                                                                    VIGSGFGGLFGTQ−−−−ALKN−−−−A−−−−−−−D−−−−−−−−−−VDITMI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGILSV−−GDIAPATRLVLRK−−−QK−−−−−−−−−−NT−−−QVLLGD−−−VEKI−−−−−−DLEAK−−−−−−TITS−−−−−−−−−−−−−−−−−−−−−R−−FLDR−−−−−−TTVTPY−−DSLIVAAGAG−−−−−−−−−QSYFGNDHFS−−−−EFAPG−−MKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEQAELSS−−−−−DPAE−−−RA−−−−−−−−−−RLL−−−−−TFVVV−−−GAG−−−−−PTGVELAGQIAE−−−−−−−LSRRTL−−−SGAFRNID−−−−−−PRE−−−−−−−−−ARVILLDGA−−−−−−DDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPVYGGKLS−−−−−−−−−R−−−KA−−RQQLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LGVEI−−−QLGAMVTDVDV−−−−−−−−−−−−−−−−−−−−−−−−−DG−−−−−−−−−−−−−−−−−−−−−−−LV−−−−−−−−−VKDKDGTHRR−−−−−IES−−−−−−−−−−−−−−−−QCKVWSAGVQAS−−−PLGKQIADQSDAEI−−−−−DRAGRVM−−−−VNP−−−−−−−−−−−−−−−−−−−DLSV−−−−−−−−−PG−−−−−−HP−−DVFVIGD−−MMSL−−−−−−−−−D−−−−−−−−−−−−−−−−−−KLPGLAQVAMQGGKYAAKQIKAGLNGG−−−KPEDRPPF                                                                                                 
fig|101510.15.peg.7307   Rhodococcus jostii RHA1                                                             SRRHRVVVIGSGFGGLFGTQ−−−−ALKN−−−−A−−−−−−−D−−−−−−−−−−VDITMI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGILSV−−GDIAPATRLVLRK−−−QK−−−−−−−−−−NT−−−KVLLGD−−−VDKI−−−−−−DLEAK−−−−−−TITS−−−−−−−−−−−−−−−−−−−−−R−−FLDR−−−−−−TTVTPY−−DSLIVAAGAG−−−−−−−−−QSYFGNDHFS−−−−EFAPG−−MKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEQAELSS−−−−−DPAE−−−RA−−−−−−−−−−RLL−−−−−TFVVV−−−GAG−−−−−PTGVELAGQIAE−−−−−−−LSRRTL−−−SGAFRNID−−−−−−PRE−−−−−−−−−ARVILLDGA−−−−−−DDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPVYGGKLS−−−−−−−−−R−−−KA−−RQQLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LGIEI−−−QLGAMVVDVDV−−−−−−−−−−−−−−−−−−−−−−−−−DG−−−−−−−−−−−−−−−−−−−−−−−LV−−−−−−−−−VKDKDGTQRR−−−−−IES−−−−−−−−−−−−−−−−QCKVWSAGVQAS−−−PLGKQIAEQSDAEI−−−−−DRAGRVL−−−−VKP−−−−−−−−−−−−−−−−−−−DLSV−−−−−−−−−PG−−−−−−HP−−EVFVIGD−−MMAL−−−−−−−−−D−−−−−−−−−−−−−−−−−−KLPGLAQVAMQGGKYAAKQIQAGLSGH−−−KPEDRPPF                                                                                                 
fig|186196.5.peg.1187   Rhodococcus sp. DK17                                                             SRRHRVVVIGSGFGGLFGTQ−−−−ALKN−−−−A−−−−−−−D−−−−−−−−−−VDITMI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGILSV−−GDIAPATRLVLRK−−−QK−−−−−−−−−−NT−−−KVLLGD−−−VDKI−−−−−−DLEAK−−−−−−TITS−−−−−−−−−−−−−−−−−−−−−R−−FLDR−−−−−−TTVTPY−−DSLIVAAGAG−−−−−−−−−QSYFGNDHFS−−−−EFAPG−−MKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEQAELSS−−−−−DPAE−−−RA−−−−−−−−−−RLL−−−−−TFVVV−−−GAG−−−−−PTGVELAGQIAE−−−−−−−LSRRTL−−−SGAFRNID−−−−−−PRE−−−−−−−−−ARVILLDGA−−−−−−DDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPVYGGKLS−−−−−−−−−R−−−KA−−RQQLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LGIEI−−−QLGAMVVDVDV−−−−−−−−−−−−−−−−−−−−−−−−−DG−−−−−−−−−−−−−−−−−−−−−−−LV−−−−−−−−−VKDKDGTQRR−−−−−IES−−−−−−−−−−−−−−−−QCKVWSAGVQAS−−−PLGKQIAEQSDAEI−−−−−DRAGRVL−−−−VKP−−−−−−−−−−−−−−−−−−−DLSV−−−−−−−−−PG−−−−−−HP−−EVFVIGD−−MMAL−−−−−−−−−D−−−−−−−−−−−−−−−−−−KLPGLAQVAMQGGKYAAKQIQAGLSGH−−−KPEDRPPF                                                                                                 
fig|234621.6.peg.3615   Rhodococcus erythropolis PR4                                                               RHRVVVIGSGFGGLFGTQ−−−−ALKK−−−−A−−−−−−−D−−−−−−−−−−ADITMI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGILSV−−GDIAPATRLVLRK−−−QK−−−−−−−−−−NA−−−QVLLGE−−−VETI−−−−−−DLENQ−−−−−−TVTS−−−−−−−−−−−−−−−−−−−−−R−−LLER−−−−−−VTVTPF−−DSLIVAAGAG−−−−−−−−−QSYFGNDQFA−−−−EFAPG−−MKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEQAELSD−−−−−DPAE−−−RA−−−−−−−−−−RLL−−−−−TFVVV−−−GAG−−−−−PTGVELAGQIAE−−−−−−−LSRRTL−−−DGAFRKID−−−−−−PRE−−−−−−−−−ARVVLLDGA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPVYGGKLS−−−−−−−−−R−−−KA−−AETLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LGVEI−−−QLDAMVTDVDN−−−−−−−−−−−−−−−−−−−−−−−−−DG−−−−−−−−−−−−−−−−−−−−−−−LI−−−−−−−−−IREKDGTLRR−−−−−IES−−−−−−−−−−−−−−−−QCKVWSAGVQAS−−−PLGKQLAEQSGGET−−−−−DRAGRVM−−−−VNP−−−−−−−−−−−−−−−−−−−DLSL−−−−−−−−−PG−−−−−−HP−−NVFVIGD−−MMSL−−−−−−−−−D−−−−−−−−−−−−−−−−−−KLPGLAQVAMQGGKYAAKQIKASLDGK−−−SP                                                                                                       
fig|1278077.4.peg.3681   Rhodococcus qingshengii BKS 20-40                                                               RHRVVVIGSGFGGLFGTQ−−−−ALKK−−−−A−−−−−−−D−−−−−−−−−−ADITMI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGILSV−−GDIAPATRLVLRK−−−QK−−−−−−−−−−NA−−−QVLLGE−−−VETI−−−−−−DLENQ−−−−−−TVTS−−−−−−−−−−−−−−−−−−−−−R−−LLER−−−−−−VTVTPF−−DSLIVAAGAG−−−−−−−−−QSYFGNDQFA−−−−EFAPG−−MKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEQAELSD−−−−−DPAE−−−RA−−−−−−−−−−RLL−−−−−TFVVV−−−GAG−−−−−PTGVELAGQIAE−−−−−−−LSRRTL−−−DGAFRKID−−−−−−PRE−−−−−−−−−ARVVLLDGA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPVYGGKLS−−−−−−−−−R−−−KA−−AETLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LGVEI−−−QLDAMVTDVDN−−−−−−−−−−−−−−−−−−−−−−−−−DG−−−−−−−−−−−−−−−−−−−−−−−LI−−−−−−−−−IKEKDGTLRR−−−−−IES−−−−−−−−−−−−−−−−QCKVWSAGVQAS−−−PLGKQLAEQSGGET−−−−−DRAGRVM−−−−VNP−−−−−−−−−−−−−−−−−−−DLSL−−−−−−−−−PG−−−−−−HP−−NVFVIGD−−MMSL−−−−−−−−−D−−−−−−−−−−−−−−−−−−KLPGLAQVAMQGGKYAAKQIKASLDGK−−−SP                                                                                                       
fig|640132.3.peg.1805   Segniliparus rotundus DSM 44985                                                        AQAAQQTPHRVVVIGSGFGGINVTQ−−−−ALDG−−−−A−−−−−−−P−−−−−−−−−−VEVTLI−−AKTTHH−−−LF−−−−QPLLY−−−−−−−QVATGILSE−−GEIAPPTRLILAK−−−QK−−−−−−−−−−NA−−−KVLLGD−−−VEQI−−−−−−DTEAK−−−−−−TVVS−−−−−−−−−−−−−−−−−−−−−R−−IAGSRRRPATVVTTPY−−DTLVVAAGAD−−−−−−−−−QSYFGNDHFS−−−−EFAPG−−MKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−VGA−−−−−−FELAEATS−−−−−DPVE−−−QE−−−−−−−−−−RAL−−−−−TFVVV−−−GAG−−−−−PTGVEVAGQIAE−−−−−−−LASRTF−−−KGAFKNIN−−−−−−ALD−−−−−−−−−ARIILLDGA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGKKLG−−−−−−−−−L−−−KA−−QQHLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IGVDV−−−RLDAIVVDVDQ−−−−−−−−−−−−−−−−−−−−−−−−−DG−−−−−−−−−−−−−−−−−−−−−−−VT−−−−−−−−−YKDKEGNLHT−−−−−IAT−−−−−−−−−−−−−−−−KCKVWSAGVAAS−−−PLGKQLAAQTGVEL−−−−−DRAGRVV−−−−VDK−−−−−−−−−−−−−−−−−−−DLSL−−−−−−−−−PG−−−−−−HP−−EIFVIGD−−MASV−−−−−−−−−P−−−−−−−−−−−−−−−−−−GVPGMAQGAIQGGKHAAKMIKGDFKGA−−−−−−PRTPFKY                                                                                               
fig|36809.5.peg.2473   Mycobacterium abscessus                                                             TPKHRVVIIGSGFGGLTAAK−−−−TLKR−−−−A−−−−−−−N−−−−−−−−−−ADVTLI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGIISE−−GEIAPPTRQILKD−−−QD−−−−−−−−−−NA−−−QVVLGD−−−VTSI−−−−−−DLEKQ−−−−−−VVHS−−−−−−−−−−−−−−−−−−−−−S−−LLGH−−−−−−DYSTPY−−DSLIVAAGAG−−−−−−−−−QSYFGNDHFA−−−−EWAPG−−MKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEQAERSS−−−−−DPVR−−−RR−−−−−−−−−−KLM−−−−−TFTVV−−−GAG−−−−−PTGVEMAGQIAE−−−−−−−LANETL−−−KGTFRHID−−−−−−PTD−−−−−−−−−ARVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPFGPKLG−−−−−−−−−D−−−KA−−RKRLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LGVEI−−−QLSAMVTDVDR−−−−−−−−−−−−−−−−−−−−−−−−−NG−−−−−−−−−−−−−−−−−−−−−−−LT−−−−−−−−−VKHADGSIER−−−−−IES−−−−−−−−−−−−−−−−WCKVWSAGVSAS−−−PLGKNLAEQSGVEL−−−−−DRAGRVK−−−−VGP−−−−−−−−−−−−−−−−−−−DLSI−−−−−−−−−PG−−−−−−HP−−NVFVVGD−−MMAV−−−−−−−−−D−−−−−−−−−−−−−−−−−−GVPGVAQGAIQGGRYAAKQIKAELKGR−−−SPAERAPF                                                                                                 
fig|246196.19.peg.3569   Mycobacterium smegmatis str. MC2 155                                                        PGATASDRHKVVIIGSGFGGLTAAK−−−−TLKR−−−−A−−−−−−−D−−−−−−−−−−VDVKLI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGIISE−−GEIAPATRVILRK−−−QK−−−−−−−−−−NA−−−QVLLGD−−−VTHI−−−−−−DLENK−−−−−−TVDS−−−−−−−−−−−−−−−−−−−−−V−−LLGH−−−−−−TYSTPY−−DSLIIAAGAG−−−−−−−−−QSYFGNDHFA−−−−EFAPG−−MKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEQAERSS−−−−−DPVR−−−RA−−−−−−−−−−KLL−−−−−TFTVV−−−GAG−−−−−PTGVEMAGQIAE−−−−−−−LADQTL−−−RGSFRHID−−−−−−PTE−−−−−−−−−ARVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGEKLG−−−−−−−−−K−−−KA−−RARLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MGVEV−−−QLGAMVTDVDR−−−−−−−−−−−−−−−−−−−−−−−−−NG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VKDSDGTIRR−−−−−IES−−−−−−−−−−−−−−−−ACKVWSAGVSAS−−−PLGKDLAEQSGVEL−−−−−DRAGRVK−−−−VQP−−−−−−−−−−−−−−−−−−−DLTL−−−−−−−−−PG−−−−−−HP−−NVFVVGD−−MAAV−−−−−−−−−E−−−−−−−−−−−−−−−−−−GVPGVAQGAIQGGRYAAKIIKREVSGT−−−SPKIRTPF                                                                                                 
fig|350058.5.peg.3029   Mycobacterium vanbaaleni vanbaalenii PYR-1                                                        PGATPSDRHKVVIIGSGFGGLTAAK−−−−TLKR−−−−A−−−−−−−D−−−−−−−−−−VDIKLI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGIISE−−GEIAPATRVILRN−−−QK−−−−−−−−−−NA−−−QVLLGD−−−VTGI−−−−−−DLQTK−−−−−−TVRS−−−−−−−−−−−−−−−−−−−−−E−−LLGH−−−−−−TYVTPF−−DSLIVAAGAG−−−−−−−−−QSYFGNDHFA−−−−EWAPG−−MKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEQAERSS−−−−−DPAR−−−RE−−−−−−−−−−KLL−−−−−TFVVV−−−GAG−−−−−PTGVEMAGQIAE−−−−−−−LADHTL−−−KGAFRHID−−−−−−STK−−−−−−−−−ARVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGEKLG−−−−−−−−−K−−−KA−−QARLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LGVEI−−−QLNAMVTDVDR−−−−−−−−−−−−−−−−−−−−−−−−−NG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VKDPDGTIRR−−−−−IEA−−−−−−−−−−−−−−−−ACKVWSAGVSAS−−−PLGRDLAEGSGVEL−−−−−DRAGRVK−−−−VLP−−−−−−−−−−−−−−−−−−−DLSL−−−−−−−−−PG−−−−−−HP−−NVFVVGD−−MAAV−−−−−−−−−E−−−−−−−−−−−−−−−−−−GVPGMAQGAIQGGKYAAKAIAAGLKGA−−−DPTEREPF                                                                                                 
fig|350054.11.peg.3402   Mycobacterium gilvum PYR-GCK                                                        PGATPSDRHKVVIIGSGFGGLTAAK−−−−ALKK−−−−A−−−−−−−D−−−−−−−−−−VDIKMI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGIISE−−GEIAPATRVILRN−−−QK−−−−−−−−−−NA−−−QVLLGD−−−VTRI−−−−−−DLKTN−−−−−−TVRS−−−−−−−−−−−−−−−−−−−−−E−−LLGH−−−−−−TYITPF−−DSLIVAAGAG−−−−−−−−−QSYFGNDHFA−−−−EWAPG−−MKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGS−−−−−−FEQAERSS−−−−−DPAR−−−RE−−−−−−−−−−KLL−−−−−TFVVV−−−GAG−−−−−PTGVEMAGQIAE−−−−−−−LADHTL−−−KGAFRHID−−−−−−STK−−−−−−−−−ARVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGEKLG−−−−−−−−−K−−−QA−−QKRLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MGVEI−−−QLNAMVTDVDR−−−−−−−−−−−−−−−−−−−−−−−−−NG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VKDPDGTMRR−−−−−IEA−−−−−−−−−−−−−−−−ACKVWSAGVSAS−−−PLGRDLADQSGVEL−−−−−DRAGRVK−−−−VLP−−−−−−−−−−−−−−−−−−−DLSI−−−−−−−−−PG−−−−−−HP−−NVFVVGD−−MAAV−−−−−−−−−E−−−−−−−−−−−−−−−−−−DVPGMAQGAIQGGRYAAKAIAAGLKGA−−−EVSEREPF                                                                                                 
fig|164756.15.peg.2876   Mycobacterium sp. MCS                                                        PGATPTDRHKVVIIGSGFGGLSAAK−−−−TLKR−−−−A−−−−−−−D−−−−−−−−−−VDIKLI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGIISE−−GEIAPATRVVLRK−−−QK−−−−−−−−−−NV−−−QVLLGD−−−VTHV−−−−−−DLQNR−−−−−−LVHS−−−−−−−−−−−−−−−−−−−−−E−−LLGH−−−−−−DYATPY−−DSLVIAAGAG−−−−−−−−−QSYFGNDHFA−−−−EWAPG−−MKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEQAERSS−−−−−DPKR−−−RE−−−−−−−−−−KLL−−−−−TFVVV−−−GAG−−−−−PTGVEMAGQIAE−−−−−−−LADYTL−−−KGTFRHID−−−−−−PTS−−−−−−−−−ARVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGEKLG−−−−−−−−−K−−−KA−−AARLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MGVEI−−−QLNAMVTDVDR−−−−−−−−−−−−−−−−−−−−−−−−−NG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VKDPDGKLRR−−−−−IES−−−−−−−−−−−−−−−−ACKVWSAGVSAS−−−PLGRDLANQCDVEV−−−−−DRAGRVK−−−−VLP−−−−−−−−−−−−−−−−−−−DLSI−−−−−−−−−PG−−−−−−HP−−NVFVVGD−−MAAV−−−−−−−−−E−−−−−−−−−−−−−−−−−−GVPGQAQGAIQGARYAAKLIKNEVKGA−−−NP                                                                                                       
fig|164757.10.peg.2847   Mycobacterium sp. JLS                                                        PGATPTDRHKVVIIGSGFGGLSAAK−−−−TLKR−−−−A−−−−−−−D−−−−−−−−−−VDIKLI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGIISE−−GEIAPATRVVLRK−−−QK−−−−−−−−−−NV−−−QVLLGD−−−VTHV−−−−−−DLQNR−−−−−−LVHS−−−−−−−−−−−−−−−−−−−−−E−−LLGH−−−−−−DYATPY−−DSLVIAAGAG−−−−−−−−−QSYFGNDHFA−−−−EWAPG−−MKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEQAERSS−−−−−DPKR−−−RE−−−−−−−−−−KLL−−−−−TFVVV−−−GAG−−−−−PTGVEMAGQIAE−−−−−−−LADYTL−−−KGTFRHID−−−−−−PTS−−−−−−−−−ARVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGEKLG−−−−−−−−−K−−−RA−−AARLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MGVEI−−−QLNAMVTDVDR−−−−−−−−−−−−−−−−−−−−−−−−−NG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VKDPDGKLRR−−−−−IES−−−−−−−−−−−−−−−−ACKVWSAGVSAS−−−PLGRDLANQCDVEV−−−−−DRAGRVK−−−−VLP−−−−−−−−−−−−−−−−−−−DLSI−−−−−−−−−PG−−−−−−HP−−NVFVVGD−−MAAV−−−−−−−−−E−−−−−−−−−−−−−−−−−−GVPGQAQGAIQGARYAAKLIKNEVKGA−−−NP                                                                                                       
fig|164757.7.peg.2795   Mycobacterium sp. JLS                                                        PGATPTDRHKVVIIGSGFGGLSAAK−−−−TLKR−−−−A−−−−−−−D−−−−−−−−−−VDIKLI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGIISE−−GEIAPATRVVLRK−−−QK−−−−−−−−−−NV−−−QVLLGD−−−VTHV−−−−−−DLQNR−−−−−−LVHS−−−−−−−−−−−−−−−−−−−−−E−−LLGH−−−−−−DYATPY−−DSLVIAAGAG−−−−−−−−−QSYFGNDHFA−−−−EWAPG−−MKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LGA−−−−−−FEQAERSS−−−−−DPKR−−−RE−−−−−−−−−−KLL−−−−−TFVVV−−−GAG−−−−−PTGVEMAGQIAE−−−−−−−LADYTL−−−KGTFRHID−−−−−−PTS−−−−−−−−−ARVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGEKLG−−−−−−−−−K−−−RA−−AARLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MGVEI−−−QLNAMVTDVDR−−−−−−−−−−−−−−−−−−−−−−−−−NG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VKDPDGKLRR−−−−−IES−−−−−−−−−−−−−−−−ACKVWSAGVSAS−−−PLGRDLANQCDVEV−−−−−DRAGRVK−−−−VLP−−−−−−−−−−−−−−−−−−−DLSI−−−−−−−−−PG−−−−−−HP−−NVFVVGD−−MAAV−−−−−−−−−E−−−−−−−−−−−−−−−−−−GVPGQAQGAIQGARYAAKLIKNEVKGA−−−NP                                                                                                       
fig|272631.5.peg.3882   Mycobacterium leprae TN                                                  MNAQPAATAAQDRRHQVVIIGSGFGGLNAAK−−−−KLKR−−−−A−−−−−−−N−−−−−−−−−−VDIKLI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGIISE−−GEIAPPTRVVLRK−−−QR−−−−−−−−−−NI−−−QVLLGN−−−VTHI−−−−−−DLANQ−−−−−−CVVS−−−−−−−−−−−−−−−−−−−−−E−−LLGH−−−−−−TYETLY−−DSLIVAAGAG−−−−−−−−−QSYFGNDQFA−−−−EFAPG−−MKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LSA−−−−−−FEQAERSN−−−−−DPER−−−RE−−−−−−−−−−KLL−−−−−TFTVV−−−GAG−−−−−PTGVEMAGQIAE−−−−−−−LADHTL−−−KGAFRRID−−−−−−STK−−−−−−−−−ARVVLLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGEKLG−−−−−−−−−Q−−−RA−−AARLQ−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MGVEI−−−QLSAMVTDVDR−−−−−−−−−−−−−−−−−−−−−−−−−NG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VQDSDGTVRR−−−−−IES−−−−−−−−−−−−−−−−ACKVWSAGVSAS−−−RLGRDLAEQSLVEL−−−−−DWAGRVK−−−−VLP−−−−−−−−−−−−−−−−−−−DLSI−−−−−−−−−PG−−−−−−YR−−NVFVVGD−−MAAI−−−−−−−−−D−−−−−−−−−−−−−−−−−−GVPGVAQGAIQGAKYVANNIKAELGEA−−−NPAEREPF                                                                                                 
fig|262316.1.peg.1561   Mycobacterium avium subsp. paratuberculosis str. k10                                                      SGSTAGPERRHQVVIIGSGFGGLNAAK−−−−KLKH−−−−A−−−−−−−N−−−−−−−−−−VDIKLI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGIVSE−−GDIAPPTRVVLRR−−−QR−−−−−−−−−−NV−−−QVLLGD−−−VTHI−−−−−−DLAGK−−−−−−FVVS−−−−−−−−−−−−−−−−−−−−−D−−LLGH−−−−−−TYETPY−−DTLIVAAGAG−−−−−−−−−QSYFGNDHFA−−−−EFAPG−−MKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−EVRGRI−−−−−−−LSA−−−−−−FEQAERSR−−−−−DPER−−−RA−−−−−−−−−−KLL−−−−−TFTVI−−−GAG−−−−−PTGVEMAGQIAE−−−−−−−LATYTL−−−KGSFRHID−−−−−−PTK−−−−−−−−−ARVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPFGDKLG−−−−−−−−−K−−−RA−−ADRLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MGVEI−−−QLGAMVTDVDR−−−−−−−−−−−−−−−−−−−−−−−−−NG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VKDSDGTVRR−−−−−IES−−−−−−−−−−−−−−−−ACKVWSAGVSAS−−−PLGRDLAEQSTVEL−−−−−DRAGRVK−−−−VLP−−−−−−−−−−−−−−−−−−−DLSI−−−−−−−−−PG−−−−−−HP−−NVFVIGD−−LAAV−−−−−−−−−E−−−−−−−−−−−−−−−−−−GVPGVAQGAIQGAKYVANTIKAELGGA−−−DPAEREPF                                                                                                 
fig|553481.3.peg.2318   Mycobacterium avium subsp. avium ATCC 25291                                                      SGSTAGPERRHQVVIIGSGFGGLNAAK−−−−KLKH−−−−A−−−−−−−N−−−−−−−−−−VDIKLI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGIVSE−−GDIAPPTRVVLRR−−−QR−−−−−−−−−−NV−−−QVLLGD−−−VTHI−−−−−−DLAGK−−−−−−FVVS−−−−−−−−−−−−−−−−−−−−−D−−LLGH−−−−−−TYETPY−−DTLIVAAGAG−−−−−−−−−QSYFGNDHFA−−−−EFAPG−−MKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−EVRGRI−−−−−−−LSA−−−−−−FEQAERSR−−−−−DPER−−−RA−−−−−−−−−−KLL−−−−−TFTVI−−−GAG−−−−−PTGVEMAGQIAE−−−−−−−LATYTL−−−KGSFRHID−−−−−−PTK−−−−−−−−−ARVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPFGDKLG−−−−−−−−−K−−−RA−−ADRLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MGVEI−−−QLGAMVTDVDR−−−−−−−−−−−−−−−−−−−−−−−−−NG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VKDSDGTVRR−−−−−IES−−−−−−−−−−−−−−−−ACKVWSAGVSAS−−−PLGRDLAEQSTVEL−−−−−DRAGRVK−−−−VLP−−−−−−−−−−−−−−−−−−−DLSI−−−−−−−−−PG−−−−−−HP−−NVFVIGD−−LAAV−−−−−−−−−E−−−−−−−−−−−−−−−−−−GVPGVAQGAIQGAKYVANTIKAELGGA−−−DPAEREPF                                                                                                 
fig|525368.3.peg.3395   Mycobacterium parascrofulaceum ATCC BAA-614                                                                   VIIGSGFGGLNAAK−−−−KLKH−−−−A−−−−−−−D−−−−−−−−−−VDIKLI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGIVSE−−GDIAPPTRVVLRR−−−QR−−−−−−−−−−NV−−−QVLLGD−−−VTHI−−−−−−DLARK−−−−−−FVVS−−−−−−−−−−−−−−−−−−−−−D−−LLGH−−−−−−TYETPY−−DSLIIAAGAG−−−−−−−−−QSYFGNDHFA−−−−EFAPG−−MKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−EVRGRI−−−−−−−LSA−−−−−−FEQAERSR−−−−−DPER−−−RA−−−−−−−−−−KLL−−−−−TFTVI−−−GAG−−−−−PTGVEMAGQIAE−−−−−−−LAAHTL−−−KGSFRGID−−−−−−STK−−−−−−−−−ARVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPFGEKLG−−−−−−−−−D−−−RA−−RARLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MGVEI−−−QLGAMVTDVDR−−−−−−−−−−−−−−−−−−−−−−−−−NG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VKDSDGTVRR−−−−−IES−−−−−−−−−−−−−−−−ACKVWSAGVQAS−−−GLGRDLAEQSSVEL−−−−−DRAGRVK−−−−VLP−−−−−−−−−−−−−−−−−−−DLSV−−−−−−−−−PG−−−−−−HP−−NVFVIGD−−MAAV−−−−−−−−−E−−−−−−−−−−−−−−−−−−GVPGVAQGAIQGAKYVAGMIKAELGGA−−−DPAEREPF                                                                                                 
fig|557599.3.peg.5384   Mycobacterium kansasii ATCC 12478                                                   SPQPDPTAETRRRHRVVIIGSGFGGLNAAK−−−−KLKR−−−−A−−−−−−−D−−−−−−−−−−VDIKLI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGIVSE−−GDIAPPTRVVLRR−−−QR−−−−−−−−−−NV−−−QVLLGD−−−VTHI−−−−−−DLAGQ−−−−−−FVVS−−−−−−−−−−−−−−−−−−−−−D−−LLGH−−−−−−TYETPY−−DSLIVAAGAG−−−−−−−−−QSYFGNDHFA−−−−EFAPG−−MKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−EVRGRI−−−−−−−LSA−−−−−−FEQAERSR−−−−−DPER−−−RA−−−−−−−−−−KLL−−−−−TFTVI−−−GAG−−−−−PTGVEMAGQIAE−−−−−−−LASHTL−−−KGSFRHID−−−−−−STR−−−−−−−−−ARVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPFGEKLG−−−−−−−−−Q−−−RA−−AARLE−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MGVEI−−−QLGAMVTDVDR−−−−−−−−−−−−−−−−−−−−−−−−−NG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VKDSDGTIRR−−−−−IES−−−−−−−−−−−−−−−−QCKVWSAGVSAS−−−ALGHDLAEQSSVEL−−−−−DRAGRVK−−−−VLP−−−−−−−−−−−−−−−−−−−DLTI−−−−−−−−−PG−−−−−−HP−−NVFVIGD−−MAAV−−−−−−−−−E−−−−−−−−−−−−−−−−−−GVPGVAQGAIQGAKYAAGTIKAELAGA−−−DPTQREPF                                                                                                 
fig|216594.1.peg.1745   Mycobacterium marinum M                                                        TTAQARPRHRVVIIGSGFGGLNAAK−−−−KLKR−−−−A−−−−−−−D−−−−−−−−−−VDIKLI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGIISE−−GDIAPPTRVVLRR−−−QR−−−−−−−−−−NA−−−QVLLGN−−−VTHI−−−−−−DLAKQ−−−−−−SVVS−−−−−−−−−−−−−−−−−−−−−D−−LLGH−−−−−−TYETPY−−DTLIVAAGAG−−−−−−−−−QSYFGNDHFA−−−−EFAPG−−MKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LSA−−−−−−FEQAERSR−−−−−DAER−−−RA−−−−−−−−−−KLL−−−−−TFTVV−−−GAG−−−−−PTGVEMAGQIAE−−−−−−−LAEHTL−−−KGAFRHID−−−−−−STR−−−−−−−−−ARVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPFGDKLG−−−−−−−−−E−−−RA−−AARLQ−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LGVEI−−−QLGAMVTDVDR−−−−−−−−−−−−−−−−−−−−−−−−−NG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VKDSDGTIRR−−−−−IES−−−−−−−−−−−−−−−−ACKVWSAGVQAS−−−RLGRDLAEQSEVEL−−−−−DRAGRVQ−−−−VLP−−−−−−−−−−−−−−−−−−−DLSV−−−−−−−−−PG−−−−−−HP−−NVFVIGD−−MAAV−−−−−−−−−E−−−−−−−−−−−−−−−−−−GVPGVAQGAIQGAKYVATTIKSELAGA−−−NAAEREPFQY                                                                                               
fig|1765.164.peg.4167   Mycobacterium bovis str. 09-5872                                                                    IIGSGFGGLNAAK−−−−KLKR−−−−A−−−−−−−D−−−−−−−−−−VDIKLI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGIISE−−GEIAPPTRVVLRK−−−QR−−−−−−−−−−NV−−−QVLLGN−−−VTHI−−−−−−DLAGQ−−−−−−CVVS−−−−−−−−−−−−−−−−−−−−−E−−LLGH−−−−−−TYQTPY−−DSLIVAAGAG−−−−−−−−−QSYFGNDHFA−−−−EFAPG−−MKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LSA−−−−−−FEQAERSS−−−−−DPER−−−RA−−−−−−−−−−KLL−−−−−TFTVV−−−GAG−−−−−PTGVEMAGQIAE−−−−−−−LAEHTL−−−KGAFRHID−−−−−−STK−−−−−−−−−ARVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGAKLG−−−−−−−−−Q−−−RA−−AARLQ−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LGVEI−−−QLGAMVTDVDR−−−−−−−−−−−−−−−−−−−−−−−−−NG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VKDSDGTVRR−−−−−IES−−−−−−−−−−−−−−−−ACKVWSAGVSAS−−−RLGRDLAEQSRVEL−−−−−DRAGRVQ−−−−VLP−−−−−−−−−−−−−−−−−−−DLSI−−−−−−−−−PG−−−−−−YP−−NVFVVGD−−MAAV−−−−−−−−−E−−−−−−−−−−−−−−−−−−GVPGVAQGAIQGAKYVASTIKAELAGA−−−NPAEREPF                                                                                                 
fig|515617.4.peg.2540   Mycobacterium tuberculosis T92                                                                    IIGSGFGGLNAAK−−−−KLKR−−−−A−−−−−−−D−−−−−−−−−−VDIKLI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGIISE−−GEIAPPTRVVLRK−−−QR−−−−−−−−−−NV−−−QVLLGN−−−VTHI−−−−−−DLAGQ−−−−−−CVVS−−−−−−−−−−−−−−−−−−−−−E−−LLGH−−−−−−TYQTPY−−DSLIVAAGAG−−−−−−−−−QSYFGNDHFA−−−−EFAPG−−MKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LSA−−−−−−FEQAERSS−−−−−DPER−−−RA−−−−−−−−−−KLL−−−−−TFTVV−−−GAG−−−−−PTGVEMAGQIAE−−−−−−−LAEHTL−−−KGAFRHID−−−−−−STK−−−−−−−−−ARVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGAKLG−−−−−−−−−Q−−−RA−−AARLQ−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LGVEI−−−QLGAMVTDVDR−−−−−−−−−−−−−−−−−−−−−−−−−NG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VKDSDGTVRR−−−−−IES−−−−−−−−−−−−−−−−ACKVWSAGVSAS−−−RLGRDLAEQSRVEL−−−−−DRAGRVQ−−−−VLP−−−−−−−−−−−−−−−−−−−DLSI−−−−−−−−−PG−−−−−−YP−−NVFVVGD−−MAAV−−−−−−−−−E−−−−−−−−−−−−−−−−−−GVPGVAQGAIQGAKYVASTIKAELAGA−−−NPAEREPF                                                                                                 
fig|520140.3.peg.1732   Mycobacterium tuberculosis EAS054                                                                    IIGSGFGGLNAAK−−−−KLKR−−−−A−−−−−−−D−−−−−−−−−−VDIKLI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGIISE−−GEIAPPTRVVLRK−−−QR−−−−−−−−−−NV−−−QVLLGN−−−VTHI−−−−−−DLAGQ−−−−−−CVVS−−−−−−−−−−−−−−−−−−−−−E−−LLGH−−−−−−TYQTPY−−DSLIVAAGAG−−−−−−−−−QSYFGNDHFA−−−−EFAPG−−MKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LSA−−−−−−FEQAERSS−−−−−DPER−−−RA−−−−−−−−−−KLL−−−−−TFTVV−−−GAG−−−−−PTGVEMAGQIAE−−−−−−−LAEHTL−−−KGAFRHID−−−−−−STK−−−−−−−−−ARVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGAKLG−−−−−−−−−Q−−−RA−−AARLQ−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LGVEI−−−QLGAMVTDVDR−−−−−−−−−−−−−−−−−−−−−−−−−NG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VKDSDGTVRR−−−−−IES−−−−−−−−−−−−−−−−ACKVWSAGVSAS−−−RLGRDLAEQSRVEL−−−−−DRAGRVQ−−−−VLP−−−−−−−−−−−−−−−−−−−DLSI−−−−−−−−−PG−−−−−−YP−−NVFVVGD−−MAAV−−−−−−−−−E−−−−−−−−−−−−−−−−−−GVPGVAQGAIQGAKYVASTIKAELAGA−−−NPAEREPF                                                                                                 
fig|1806.1.peg.1104   Mycobacterium microti OV254                                                        PTAQPPRRHRVVIIGSGFGGLNAAK−−−−KLKR−−−−A−−−−−−−D−−−−−−−−−−VDIKLI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGIISE−−GEIAPPTRVVLRK−−−QR−−−−−−−−−−NV−−−QVLLGN−−−VTHI−−−−−−DLAGQ−−−−−−CVVS−−−−−−−−−−−−−−−−−−−−−E−−LLGH−−−−−−TYQTPY−−DSLIVAAGAG−−−−−−−−−QSYFGNDHFA−−−−EFAPG−−MKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LSA−−−−−−FEQAERSS−−−−−DPER−−−RA−−−−−−−−−−KLL−−−−−TFTVV−−−GAG−−−−−PTGVEMAGQIAE−−−−−−−LAEHTL−−−KGAFRHID−−−−−−STK−−−−−−−−−ARVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGAKLG−−−−−−−−−Q−−−RA−−AARLQ−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LGVEI−−−QLGAMVTDVDR−−−−−−−−−−−−−−−−−−−−−−−−−NG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VKDSDGTVRR−−−−−IES−−−−−−−−−−−−−−−−ACKVWSAGVSAS−−−RLGRDLAEQSRVEL−−−−−DRAGRVQ−−−−VLP−−−−−−−−−−−−−−−−−−−DLSI−−−−−−−−−PG−−−−−−YP−−NVFVVGD−−MAAV−−−−−−−−−E−−−−−−−−−−−−−−−−−−GVPGVAQGAIQGAKYVASTIKAELAGA−−−NPAEREPF                                                                                                 
fig|336982.3.peg.1970   Mycobacterium tuberculosis F11                                                        PTAQPPRRHRVVIIGSGFGGLNAAK−−−−KLKR−−−−A−−−−−−−D−−−−−−−−−−VDIKLI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGIISE−−GEIAPPTRVVLRK−−−QR−−−−−−−−−−NV−−−QVLLGN−−−VTHI−−−−−−DLAGQ−−−−−−CVVS−−−−−−−−−−−−−−−−−−−−−E−−LLGH−−−−−−TYQTPY−−DSLIVAAGAG−−−−−−−−−QSYFGNDHFA−−−−EFAPG−−MKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LSA−−−−−−FEQAERSS−−−−−DPER−−−RA−−−−−−−−−−KLL−−−−−TFTVV−−−GAG−−−−−PTGVEMAGQIAE−−−−−−−LAEHTL−−−KGAFRHID−−−−−−STK−−−−−−−−−ARVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGAKLG−−−−−−−−−Q−−−RA−−AARLQ−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LGVEI−−−QLGAMVTDVDR−−−−−−−−−−−−−−−−−−−−−−−−−NG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VKDSDGTVRR−−−−−IES−−−−−−−−−−−−−−−−ACKVWSAGVSAS−−−RLGRDLAEQSRVEL−−−−−DRAGRVQ−−−−VLP−−−−−−−−−−−−−−−−−−−DLSI−−−−−−−−−PG−−−−−−YP−−NVFVVGD−−MAAV−−−−−−−−−E−−−−−−−−−−−−−−−−−−GVPGVAQGAIQGAKYVASTIKAELAGA−−−NPAEREPF                                                                                                 
fig|410289.13.peg.1885   Mycobacterium bovis BCG str. Pasteur 1173P2                                                        PTAQPPRRHRVVIIGSGFGGLNAAK−−−−KLKR−−−−A−−−−−−−D−−−−−−−−−−VDIKLI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGIISE−−GEIAPPTRVVLRK−−−QR−−−−−−−−−−NV−−−QVLLGN−−−VTHI−−−−−−DLAGQ−−−−−−CVVS−−−−−−−−−−−−−−−−−−−−−E−−LLGH−−−−−−TYQTPY−−DSLIVAAGAG−−−−−−−−−QSYFGNDHFA−−−−EFAPG−−MKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LSA−−−−−−FEQAERSS−−−−−DPER−−−RA−−−−−−−−−−KLL−−−−−TFTVV−−−GAG−−−−−PTGVEMAGQIAE−−−−−−−LAEHTL−−−KGAFRHID−−−−−−STK−−−−−−−−−ARVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGAKLG−−−−−−−−−Q−−−RA−−AARLQ−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LGVEI−−−QLGAMVTDVDR−−−−−−−−−−−−−−−−−−−−−−−−−NG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VKDSDGTVRR−−−−−IES−−−−−−−−−−−−−−−−ACKVWSAGVSAS−−−RLGRDLAEQSRVEL−−−−−DRAGRVQ−−−−VLP−−−−−−−−−−−−−−−−−−−DLSI−−−−−−−−−PR−−−−−−YP−−NVFVVGD−−MAAV−−−−−−−−−E−−−−−−−−−−−−−−−−−−GVPGVAQGAIQGAKYVASTIKAELAGA−−−NPAEREPF                                                                                                 
fig|561275.4.peg.2047   Mycobacterium bovis BCG str. Tokyo 172                                                                    IIGSGFGGLNAAK−−−−KLKR−−−−A−−−−−−−D−−−−−−−−−−VDIKLI−−ARTTHH−−−LF−−−−QPLLY−−−−−−−QVATGIISE−−GEIAPPTRVVLRK−−−QR−−−−−−−−−−NV−−−QVLLGN−−−VTHI−−−−−−DLAGQ−−−−−−CVVS−−−−−−−−−−−−−−−−−−−−−E−−LLGH−−−−−−TYQTPY−−DSLIVAAGAG−−−−−−−−−QSYFGNDHFA−−−−EFAPG−−MKS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDD−−−−−−−−AL−−−−−−−−−ELRGRI−−−−−−−LSA−−−−−−FEQAERSS−−−−−DPER−−−RA−−−−−−−−−−KLL−−−−−TFTVV−−−GAG−−−−−PTGVEMAGQIAE−−−−−−−LAEHTL−−−KGAFRHID−−−−−−STK−−−−−−−−−ARVILLDAA−−−−−−PAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPPMGAKLG−−−−−−−−−Q−−−RA−−AARLQ−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LGVEI−−−QLGAMVTDVDR−−−−−−−−−−−−−−−−−−−−−−−−−NG−−−−−−−−−−−−−−−−−−−−−−−IT−−−−−−−−−VKDSDGTVRR−−−−−IES−−−−−−−−−−−−−−−−ACKVWSAGVSAS−−−RLGRDLAEQSRVEL−−−−−DR