(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00012175

fig|649189.3.peg.6739   Streptomyces sp. ACT-1                                           AD−−−−−−−−−GLNWSA−−LAACESGGRPGA−−−−−−−VDASGTY−−−GGLYRLDTQTWQSLGG−−−SGRPQDAPAAEQTHRA−−−−−−−−−KKLYVQRGA−−−SPWP−−−−HCGR                        
fig|455632.3.peg.4443   Streptomyces griseus subsp. griseus NBRC 13350                                           AD−−−−−−−−−GLNWSA−−LAACESGGRPGA−−−−−−−VDASGTY−−−GGLYRLDTQTWQSLGG−−−SGRPQDAPAAEQTHRA−−−−−−−−−KKLYVQRGA−−−SPWP−−−−HCGR                        
fig|457429.3.peg.2448   Streptomyces pristinaespiralis ATCC 25486                                    PPSSVRGAD−−−−−−−−−DLNWAA−−LAECESGGRPGA−−−−−−−VDPSGTY−−−GGLYQFDTATWRSLGG−−−TGRPQDAPAEEQTYRA−−−−−−−−−KKLYVQRGA−−−SPWP−−−−HCGR                        
fig|680198.5.peg.5294   Streptomyces scabiei 87.22                                   AMPTSVAGAE−−−−−−−−−GLNWAG−−LAACESGGRANA−−−−−−−VDASGTY−−−GGLYQFDTRTWQSLGG−−−SGRPQDASAGEQTLRA−−−−−−−−−KKLYVQRGA−−−SPWP−−−−HCGARLRG                    
fig|457431.3.peg.958   Streptomyces roseosporus NRRL 15998                                           AD−−−−−−−−−GLNWSG−−LAACESGGRADA−−−−−−−VDPSGTY−−−GGLYQFDTQTWQSLGG−−−SGRPQDAPAAEQTYRA−−−−−−−−−KKLYVQRGA−−−SPWP−−−−HCGR                        
fig|457430.3.peg.700   Streptomyces roseosporus NRRL 11379                                           AD−−−−−−−−−GLNWSG−−LAACESGGRADA−−−−−−−VDPSGTY−−−GGLYQFDTQTWQSLGG−−−SGRPQDAPAAEQTYRA−−−−−−−−−KKLYVQRGA−−−SPWP−−−−HCGR                        
fig|253839.3.peg.2362   Streptomyces sp. C                                    LPTSVAGAD−−−−−−−−−GLNWSG−−LAQCESGGRPSA−−−−−−−TDPSGTY−−−GGLYQFDVSTWQALGG−−−SGRPQDAPASEQTYRA−−−−−−−−−KKLYVQRGA−−−SPWP−−−−HCGR                        
fig|465541.3.peg.4375   Streptomyces sp. Mg1                                    LPASVAGAD−−−−−−−−−GLDWAA−−LAQCESGGRPDA−−−−−−−TDPSGTY−−−GGLYQFDVRTWQALGG−−−SGRPQDAPGQEQTYRA−−−−−−−−−KKLYVQRGA−−−TPWP−−−−HCGR                        
fig|463191.3.peg.5   Streptomyces sviceus ATCC 29083                                      TSVQGAD−−−−−−−−−HLNWQG−−LAHCESGGRPNA−−−−−−−VDPSGTY−−−GGLYQFDTRTWQALGG−−−SGRPQDAPAVEQTFRA−−−−−−−−−KKLYVRRGA−−−SPWP−−−−HCGA                        
fig|591159.3.peg.1007   Streptomyces viridochromogenes DSM 40736                                           AD−−−−−−−−−HLDWQG−−LAACESGGRPDA−−−−−−−VDSSGTY−−−GGLYQFDTHTWQSLGG−−−RGRPQDAPAAEQTYRA−−−−−−−−−KKLYVKQGT−−−SPWP−−−−HCG                         
fig|227882.1.peg.3591   Streptomyces avermitilis MA-4680                                      PSVAGAD−−−−−−−−−DLNWGG−−LAACESGGRPGA−−−−−−−VDPSGTY−−−GGLYQFDTRTWHDLGG−−−SGRPQDAPAAEQTYRA−−−−−−−−−KKLYVRRGA−−−SPWP−−−−HCGS                        
fig|227882.9.peg.3835   Streptomyces avermitilis MA-4680                                      PSVAGAD−−−−−−−−−DLNWGG−−LAACESGGRPGA−−−−−−−VDPSGTY−−−GGLYQFDTRTWHDLGG−−−SGRPQDAPAAEQTYRA−−−−−−−−−KKLYVRRGA−−−SPWP−−−−HCGS                        
fig|645465.3.peg.1312   Streptomyces sp. e14                                           AD−−−−−−−−−GLDWEG−−LARCESGGRPDA−−−−−−−VDPSGTY−−−GGLYQFDAATWHGLGG−−−RGRPEDAPAAEQTYRA−−−−−−−−−KKLYVRRGA−−−SPWP−−−−HCG                         
fig|457428.4.peg.2388   Streptomyces lividans TK24                                           AD−−−−−−−−−HLNWQG−−LAACESGGRADA−−−−−−−VDPSGTY−−−GGLYQFDSATWHGLGG−−−EGRPEDASAAEQTYRA−−−−−−−−−QKLYVRSGA−−−DAWP−−−−HCGA                        
fig|100226.1.peg.3111   Streptomyces coelicolor A3(2)                                           AD−−−−−−−−−HLNWQG−−LAACESGGRADA−−−−−−−VDPSGTY−−−GGLYQFDSATWHGLGG−−−EGRPEDASAAEQTYRA−−−−−−−−−QKLYVRSGA−−−DAWP−−−−HCGA                        
fig|526225.5.peg.3735   Geodermatophilus obscurus DSM 43160                RVTREPVDELVTVGTKQRPVSAGNKPSAD−−−−−−−−−GLNWAA−−LAACESGGRPNA−−−−−−−VSGTGKY−−−RGMYQFSQGTWNAVGG−−−SGDPAAASADEQTYRA−−−−−−−−−QLLYQRSGA−−−GQWP−−−−HCG                         
fig|526225.7.peg.895   Geodermatophilus obscurus DSM 43160                RVTREPVDELVTVGTKQRPVSAGNKPSAD−−−−−−−−−GLNWAA−−LAACESGGRPNA−−−−−−−VSGTGKY−−−RGMYQFSQGTWNAVGG−−−SGDPAAASADEQTYRA−−−−−−−−−QLLYQRSGA−−−GQWP−−−−HCG                         
fig|446466.7.peg.852   Cellulomonas flavigena DSM 20109                                            D−−−−−−−−−SLNWAA−−LAKCESGGRVDV−−−−−−−VSSTGKY−−−HGLYQFSVSTWQSVGG−−−AGLPSQASAEEQTARA−−−−−−−−−KMLYNRSGA−−−GQWP−−−−HCG                         
fig|471852.4.peg.1490   Thermomonospora curvata DSM 43183                KILRKPVTQILEIG−−PQPASVGGP−−VA−−−−−−−−−GLNWAA−−LAKCESGGRPNA−−−−−−−VNPAGY−−−YGLYQFSLQTWASVGG−−−TGLPSQASPEEQTYRA−−−−−−−−−QLLYNKVGGRWQGQWP−−−−HCG                         
fig|351607.5.peg.176   Acidothermus cellulolyticus 11B                                 APTYSVK−−−SD−−−−−−−−−GLNWAA−−LARCESGGRPNL−−−−−−−VDPP−−Y−−−YGLYQFTLPTWRAVGG−−−RGLPSDASPSEQTYRA−−−−−−−−−QLLYQRS−−−DWRRQWP−−−−VCG                         
fig|351607.8.peg.194   Acidothermus cellulolyticus 11B                                 APTYSVK−−−SD−−−−−−−−−GLNWAA−−LARCESGGRPNL−−−−−−−VDPP−−Y−−−YGLYQFTLPTWRAVGG−−−RGLPSDASPSEQTYRA−−−−−−−−−QLLYQRS−−−DWRRQWP−−−−VCG                         
fig|266940.11.peg.1200   Kineococcus radiotolerans SRS30216                                           SD−−−−−−−−−GLNWGA−−LAACESGGNPSI−−−−−−−VSSSGKY−−−HGLYQFSVSTWRAVGG−−−SGLPSQASPAEQTHRA−−−−−−−−−QLLYQRAGA−−−GQWP−−−−VCG                         
fig|266940.5.peg.1122   Kineococcus radiotolerans SRS30216                                           SD−−−−−−−−−GLNWGA−−LAACESGGNPSI−−−−−−−VSSSGKY−−−HGLYQFSVSTWRAVGG−−−SGLPSQASPAEQTHRA−−−−−−−−−QLLYQRAGA−−−GQWP−−−−VCG                         
fig|479433.4.peg.7727   Catenulispora acidiphila DSM 44928                      VNAVVKVGTKPVPTTVAG−−−AD−−−−−−−−−NLNWAG−−VAQCESGGNPKS−−−−−−−VGGGGLY−−−FGLYQFSVSTWAAMGG−−−SGLPSNATPAEQTYRA−−−−−−−−−KLLYVRSGA−−−GQWP−−−−VCGR                        
fig|458233.11.peg.1891   Macrococcus caseolyticus JCSC5402                                     APAVRVNN−−−−−−−−−GLNWAA−−LARCESGGNPSI−−−−−−−NTGNGY−−−YGMYQFNLQTWRGVGG−−−SGYPHQASAAEQTKRA−−−−−−−−−QILYNMRGA−−−QPWP−−−−VCGA                        
fig|479431.5.peg.2323   Nakamurella multipartita DSM 44233                                                       VNWDG−−LAYCESTNNPHAV−−−−−−−NNPAGYLSTYGLFQFDLPTWASVGGSG−−−−NPGDASPEEQLTRA−−−−−−−−−KLLYQSRGL−−−EPWLCGYAASGP                        
fig|479431.6.peg.4599   Nakamurella multipartita DSM 44233                                                       VNWDG−−LAYCESTNNPHAV−−−−−−−NNPAGYLSTYGLFQFDLPTWASVGGSG−−−−NPGDASPEEQLTRA−−−−−−−−−KLLYQSRGL−−−EPWLCGYAASGP                        
fig|479435.6.peg.6510   Kribbella flavida DSM 17836                                 STRGGNGGSVSM−−−−−−−−−SAAWRK−−VAQCESGGNPRA−−−−−−−VNPTGKY−−−HGLFQFDRQTWRSVGG−−−SGLPSNASAAEQLMRA−−−−−−−−−KKLYSQRGA−−−SPWP−−−−SCGR                        
fig|469383.5.peg.4593   Conexibacter woesei DSM 14684                          LATAQAQSRGGGGGGSVRT−−−−−−−−−PAILDS−−IAQCESGGDPTA−−−−−−−ISPDGTY−−−RGKYQFDRQTWAAYGP−−−AGDPARASEAEQDRRA−−−−−−−−−LKLYKARGT−−−SPWP−−−−NCA                         
fig|458233.11.peg.1892   Macrococcus caseolyticus JCSC5402                                 VAQAAPAGNSSM−−−−−−−−−DAHLRV−−IAQRESGGNPNAV−−−−−−−−NPSGY−−−YGLFQFSPSTWASVGGTG−−−−NPANASVEEQWKRA−−−−−−−−−RILYQTAGA−−−SQW                                 
fig|656024.3.peg.1283   Frankia symbiont of Datisca glomerata                MIAVPAVVAAIGGSVAVSQPANAAPAAD−−−−−−−−−−−RVLSA−−IAQCESGGDPRV−−−−−−−VNEIGA−−−GGLFQFLPPTWRGVGG−−−SGLPQQASPEEQWKRA−−−−−−−−−RILYSQQGT−−−GPW                                 
fig|102897.3.peg.1749   Frankia sp. EUN1f                     VLAATIGGGIAMSQPASAAARPDA−−−−−−−−−HRFLSA−−VVPCESGGNPRA−−−−−−−VNSIGA−−−GGLFQFMPGTWHAVGG−−−KGLPQNASAAEQWKRA−−−−−−−−−HILYAQQGT−−−SPWY−−−−ASKSCWGG                    
fig|102897.3.peg.6948   Frankia sp. EUN1f                     VLAATIGGGIAMSQPASAAARPDA−−−−−−−−−HRFLSA−−VVPCESGGNPRV−−−−−−−VNSIGA−−−GGLFQFMPGTWHAVGG−−−KGLPQNASVAEQWKRA−−−−−−−−−HILYAQQGT−−−SPWV−−−−SSKPC                       
fig|298653.4.peg.6453   Frankia sp. EAN1pec                          IGGGIAMSQPASAAGRPDA−−−−−−−−−HRFLSA−−VVPCESGGNPRV−−−−−−−VNSIGA−−−GGLFQFLPGTWHGVGG−−−QGLPQNASVAEQWKRA−−−−−−−−−HILYAQQGT−−−SPWY−−−−ASKSC                       
fig|298654.3.peg.4272   Frankia sp. EuI1c                       AAVVGTGLVATQPASASARPSA−−−−−−−−−AHFLSA−−VVPCESGGNPRA−−−−−−−VNSIGA−−−GGLFQFLPSTWHGLGG−−−KGLPQNASVSEQWAKA−−−−−−−−−YKLYAQQGT−−−SPW                                 
fig|298654.3.peg.5991   Frankia sp. EuI1c                       AAVVGTGLVATQPASAAARPSA−−−−−−−−−AHFLSA−−VVPCESGGNPRA−−−−−−−VNSIGA−−−GGLFQFLPSTWHGLGG−−−RGLPQNASVSEQWAKA−−−−−−−−−YKLYAQQGT−−−SPW                                 
fig|106370.16.peg.4608   Frankia sp. CcI3                          IGGGLALSQPASASTNAD−−−−−−−−−−−HFLSK−−VIPCESGGNPRA−−−−−−−VNSIGA−−−GGLFQFLPSTWHGVGG−−−KGLPQHASVAEQWQRA−−−−−−−−−RILYAQQGT−−−SPW                                 
fig|326424.13.peg.5947   Frankia alni ACN14a                       AASVGGGLALSQPASAGTNAD−−−−−−−−−−−HFLRA−−VIPCESGGNPHA−−−−−−−VNSIGA−−−GGLFQFLPSTWHGLGG−−−RGLPQNASVGEQWQRA−−−−−−−−−RQLYAQAGT−−−SPW                                 
fig|525245.3.peg.455   Actinomyces coleocanis DSM 15436                             SANPNQPAPAPV−−AT−−−−−−−−−GDVWAA−−LAQCESGGNPAT−−−−−−−NTGNGY−−−YGMYQFSLPTWRAVGG−−−SGLPSENSAAEQTLRA−−−−−−−−−QILQQRAGW−−−GQWP−−−−HCARQ                       
fig|525246.3.peg.1256   Actinomyces urogenitalis DSM 15434                                       GA−−AS−−−−−−−−−GDVWAA−−LAQCESGGNPAT−−−−−−−NTGNGY−−−YGMYQFSLSTWQALGG−−−TGLPSEASAEAQTAMA−−−−−−−−−QKLQARSGW−−−GQWP−−−−GCNS                        
fig|446469.6.peg.2986   Sanguibacter keddieii DSM 10542                 PAAPSAPVDGGSGEPAPEAAPAPA−−VG−−−−−−−−−GDVWAA−−LAQCESSGNPSV−−−−−−−VSSNGLY−−−HGLYQFSVGTWQSLGG−−−VGLPSQASAEEQTRLA−−−−−−−−−QALQARSGW−−−GQWP−−−−HCSS                        
fig|446469.6.peg.5803   Sanguibacter keddieii DSM 10542                 PAAPSAPVDGGSGEPAPEAAPAPA−−VG−−−−−−−−−GDVWAA−−LAQCESSGNPSV−−−−−−−VSSNGLY−−−HGLYQFSVGTWQSLGG−−−VGLPSQASAEEQTRLA−−−−−−−−−QALQARSGW−−−GQWP−−−−HCSS                        
fig|446471.4.peg.3292   Xylanimonas cellulosilytica DSM 15894                                            S−−−−−−−−−GDVWAA−−LAQCESGGRADA−−−−−−−VSSNGRY−−−YGLYQFSLATWQSVGG−−−SGLPSEASPEEQTMRA−−−−−−−−−QALQERSGW−−−GQWP−−−−ACSR                        
fig|446471.4.peg.3293   Xylanimonas cellulosilytica DSM 15894                                           VS−−−−−−−−−DDVWVR−−LAQCESGGRPDI−−−−−−−VSASGRF−−−HGLYQFSVATWRSVGG−−−QGLPSQASPAEQRMRA−−−−−−−−−EMLQARSGW−−−GQWP−−−−ACSR                        
fig|585199.3.peg.1395   Mobiluncus mulieris ATCC 35243                KILAQPVSQKVTVGTKERPAAAAIP−−VG−−−−−−−−−DDVWSK−−LAFCESGGRPGT−−−−−−−NTGNGF−−−YGMYQFTLSTWLSVGG−−−SGLPSDASAEEQTHRA−−−−−−−−−KILQARSGW−−−GQWP−−−−ACTR                        
fig|548479.6.peg.450   Mobiluncus curtisii ATCC 43063                 VVTQPVNEKVTVGTKKRPASQPIA−−AT−−−−−−−−−GDVWSK−−LAFCEAGGRPDT−−−−−−−NTGNGF−−−YGMYQFTLPTWRAVGG−−−SGLPSEASAEEQTHRA−−−−−−−−−QILQARSGW−−−GQWP−−−−ACSR                        
fig|1303784.3.peg.237   Staphylococcus aureus M1193                                    ASEGSSVNV−−−−−−−−−NAHLKQ−−IAQRESGGNIHAV−−−−−−−NPTSGA−−−AGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAA−−−−−−−−−VKLYNTGGA−−−GHW                                 
fig|889933.4.peg.1886   Staphylococcus aureus subsp. aureus ECT-R 2                                    ASEGSSVNV−−−−−−−−−NAHLKQ−−IAQRESGGNIHAV−−−−−−−NPTSGA−−−AGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAA−−−−−−−−−VKLYNTGGA−−−GHW                                 
fig|904731.3.peg.1438   Staphylococcus aureus subsp. aureus 21201                                    ASEGSSVNV−−−−−−−−−NAHLKQ−−IAQRESGGNIHAV−−−−−−−NPTSGA−−−AGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAA−−−−−−−−−VKLYNTGGA−−−GHW                                 
fig|1123523.3.peg.2049   Staphylococcus aureus subsp. aureus 11819-97                                    ASEGSSVNV−−−−−−−−−NAHLKQ−−IAQRESGGNIHAV−−−−−−−NPTSGA−−−AGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAA−−−−−−−−−VKLYNTGGA−−−GHW                                 
fig|904726.3.peg.2253   Staphylococcus aureus subsp. aureus 21193                                    ASEGSSVNV−−−−−−−−−NAHLKQ−−IAQRESGGNIHAV−−−−−−−NPTSGA−−−AGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAA−−−−−−−−−VKLYNTGGA−−−GHW                                 
fig|931460.3.peg.2053   Staphylococcus aureus subsp. aureus CIGC93                                    ASEGSSVNV−−−−−−−−−NAHLKQ−−IAQRESGGNIHAV−−−−−−−NPTSGA−−−AGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAA−−−−−−−−−VKLYNTGGA−−−GHW                                 
fig|553601.3.peg.2389   Staphylococcus aureus A10102                                    ASEGSSVNV−−−−−−−−−NAHLKQ−−IAQRESGGNIHAV−−−−−−−NPTSGA−−−AGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAA−−−−−−−−−VKLYNTGGT−−−GHW                                 
fig|1028799.3.peg.1856   Staphylococcus aureus subsp. aureus VC40                                     SEGSSVNV−−−−−−−−−NAHLKQ−−IAQRESGGNIHAV−−−−−−−NPTSGA−−−AGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAA−−−−−−−−−VKLYNTGGA−−−GHW                                 
fig|904779.3.peg.85   Staphylococcus aureus subsp. aureus IS-91                                     SEGSSVNV−−−−−−−−−NAHLKQ−−IAQRESGGNIHAV−−−−−−−NPTSGA−−−AGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAA−−−−−−−−−VKLYNTGGA−−−GHW                                 
fig|93061.5.peg.2114   Staphylococcus aureus subsp. aureus NCTC 8325                                     SEGSSVNV−−−−−−−−−NAHLKQ−−IAQRESGGNIHAV−−−−−−−NPTSGA−−−AGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAA−−−−−−−−−VKLYNTGGA−−−GHW                                 
fig|93062.19.peg.2033   Staphylococcus aureus subsp. aureus COL                                     SEGSSVNV−−−−−−−−−NAHLKQ−−IAQRESGGNIHAV−−−−−−−NPTSGA−−−AGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAA−−−−−−−−−VKLYNTGGA−−−GHW                                 
fig|553583.3.peg.421   Staphylococcus aureus A9635                                    ASEGSSVNV−−−−−−−−−NDHLKQ−−IAQRESGGNIHAV−−−−−−−NPTSGA−−−AGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAA−−−−−−−−−VKLYNTGGA−−−GHW                                 
fig|548473.6.peg.1068   Staphylococcus aureus subsp. aureus TCH60                                    ASEGSSVNV−−−−−−−−−NDHLKQ−−IAQRESGGNIHAV−−−−−−−NPTSGA−−−AGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAA−−−−−−−−−VKLYNTGGA−−−GHW                                 
fig|904728.3.peg.830   Staphylococcus aureus subsp. aureus 21195                                    ASEGSSVNV−−−−−−−−−NDHLKQ−−IAQRESGGNIHAV−−−−−−−NPTSGA−−−AGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAA−−−−−−−−−VKLYNTGGA−−−GHW                                 
fig|931452.3.peg.2810   Staphylococcus aureus subsp. aureus CIG1267                                    ASEGSSVNV−−−−−−−−−NDHLKQ−−IAQRESGGNIHAV−−−−−−−NPTSGA−−−AGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAA−−−−−−−−−VKLYNTGGA−−−GHW                                 
fig|904766.3.peg.1923   Staphylococcus aureus subsp. aureus 21331                                    ASEGSSVNV−−−−−−−−−NDHLKQ−−IAQRESGGNIHAV−−−−−−−NPTSGA−−−AGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAA−−−−−−−−−VKLYNTGGA−−−GHW                                 
fig|985006.4.peg.1915   Staphylococcus aureus subsp. aureus LGA251                                    ASEGSSVNV−−−−−−−−−NDHLKQ−−IAQRESGGNIHAV−−−−−−−NPTSGA−−−AGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAA−−−−−−−−−VKLYNTGGA−−−GHW                                 
fig|629742.3.peg.763   Staphylococcus hominis SK119                                     TSGSSVNV−−−−−−−−−NSHLQQ−−IAQRESGGDIHAI−−−−−−−NPSSGA−−−AGKYQFLQSTWDSVAPAQYKGVSPAQAPESVQDAAA−−−−−−−−−VKLYNTAGP−−−SQW                                 
fig|396513.4.peg.1596   Staphylococcus carnosus subsp. carnosus TM300                                    ADSGSNVQV−−−−−−−−−NDHLKA−−IAQRESGGDIHAI−−−−−−−NSSSGA−−−AGKYQFLQTTWDSVAPAEYQGKPASEAPEAVQDAAA−−−−−−−−−QKLYDTAGP−−−SQW                                 
fig|525254.4.peg.1158   Anaerococcus lactolyticus ATCC 51172                                      TNQSYKG−−−−−−−−−STNWAKEWIAQRESGGSYTAY−−−−−−−NPRGGY−−−YGRYQLNPSL−−−−−−−−−−−−VRYGASPAEQEAAA−−−−−−−−−DNYVAQRYGS−−−−−W                                 
fig|106370.16.peg.4749   Frankia sp. CcI3                              AL−−−−SQPADAAT−−−−−−−−−T−−WTG−−LRQCESGGDYTT−−−−−−−NTGNAY−−−YGAYQFSASTWHSLG−−−YGGLPHQASPAVQDEAA−−−−−−−−−LKLARRSGF−−−GQWP−−−−ACGR                        
fig|326424.13.peg.6079   Frankia alni ACN14a                MVAPVLAAAVGGTLAV−−−−SQPAEAAS−−−−−−−−−T−−WAG−−LRQCESGGDYTT−−−−−−−NTGNGY−−−YGAFQFSASTWHSLG−−−YSGLPHEAAPAVQDEAA−−−−−−−−−LRLAQRSGF−−−GQWP−−−−VCGR                        
fig|298653.4.peg.213   Frankia sp. EAN1pec               LVSVPVIAAAVGGTLAL−−−−SQPANAAT−−−−−−−−−T−−WEG−−LRQCESGGNYTT−−−−−−−NTGNGY−−−YGAYQFSPGTWRSLG−−−YSGLPHTAPPAVQDTAA−−−−−−−−−LQLALRSGF−−−GQWP−−−−VCGS                        
fig|298653.7.peg.224   Frankia sp. EAN1pec               LVSVPVIAAAVGGTLAL−−−−SQPANAAT−−−−−−−−−T−−WEG−−LRQCESGGNYTT−−−−−−−NTGNGY−−−YGAYQFSPGTWRSLG−−−YSGLPHTAPPAVQDTAA−−−−−−−−−LQLALRSGF−−−GQWP−−−−VCGS                        
fig|656024.3.peg.3408   Frankia symbiont of Datisca glomerata                MVAPALAAAVSGSIVM−−−−SQPASAAT−−−−−−−−−T−−WAQ−−LRQCESGGNYST−−−−−−−STGNGY−−−YGAYQFSLSTWQSLG−−−YTGLPSSASPATQDEAA−−−−−−−−−LRLANRSGF−−−GQWP−−−−VCG                         
fig|525909.11.peg.190   Acidimicrobium ferrooxidans DSM 10331                                       ATAAQ−−−−−−−−−L−−LA−−−LRDCESGGNYQA−−−−−−−DTGNGY−−−YGAYQFAASTWAALG−−−YGGLPNQAPPAVQDQAA−−−−−−−−−EQLLARAGW−−−GQWP−−−−VCS                         
fig|351607.5.peg.1149   Acidothermus cellulolyticus 11B             RTVAATGFAVAMLTGELAS−−−−AASASAVG−−−−−−−−−SDVWAA−−LRMCESSGNYHI−−−−−−−NTGNGY−−−YGAYQFDLRTWRGLG−−−YSGLPSDAPPAVQDEAA−−−−−−−−−QRLYAQRGW−−−QPWP−−−−ACSR                        
fig|351607.8.peg.1220   Acidothermus cellulolyticus 11B                       AMLTGELAS−−−−AASASAVG−−−−−−−−−SDVWAA−−LRMCESSGNYHI−−−−−−−NTGNGY−−−YGAYQFDLRTWRGLG−−−YSGLPSDAPPAVQDEAA−−−−−−−−−QRLYAQRGW−−−QPWP−−−−ACSR                        
fig|479431.5.peg.2918   Nakamurella multipartita DSM 44233                                      PASADPS−−−−−−−−−ADDWYQ−−LRMCESTNRYTI−−−−−−−NTGNGY−−−YGAYQFDLSTWRSVG−−−GSGYPNEASASEQDYRA−−−−−−−−−LLLYRQRGW−−−EPW                                 
fig|479431.6.peg.5196   Nakamurella multipartita DSM 44233                                      PASADPS−−−−−−−−−ADDWYQ−−LRMCESTNRYTI−−−−−−−NTGNGY−−−YGAYQFDLSTWRSVG−−−GSGYPNEASASEQDYRA−−−−−−−−−LLLYRQRGW−−−EPW                                 
fig|656024.3.peg.3410   Frankia symbiont of Datisca glomerata             KVLRTTGAVTALVSSGLAVT−−−AAPASAAT−−−−−−−−−SDDFAK−−LRQCESGGNYRI−−−−−−−NTGNGY−−−YGAYQFDAKTWHSLG−−−YSGLPSDAPPALQDEAA−−−−−−−−−YKLYNARGC−−−SPWP−−−−SCSAQ                       
fig|326424.13.peg.6080   Frankia alni ACN14a                      TAIVGSGLAVSTVAAAPAGAAT−−−−−−−−−ADDFAK−−LRQCESGGNYAT−−−−−−−NTGNGF−−−SGGYQFDDQTWHGLG−−−YSGRPYQASPATQDEAA−−−−−−−−−AKLYNARGW−−−QPWP−−−−SCSRKMGLTNNGPAAV−−GSGDVIEQA 
fig|106370.16.peg.4750   Frankia sp. CcI3             RILRTTGAVTAIVGSGLAVT−−−AAPAGAAT−−−−−−−−−SDDFAK−−LRQCESGGNYAV−−−−−−−NTGNGF−−−SGAYQFDDQTWHGLG−−−YSGRPYQASPATQDEAA−−−−−−−−−AKLYNQRGW−−−QPWP−−−−SCSVKMGLTNNGPASVPGGSGDVIQQA 
fig|298654.3.peg.396   Frankia sp. EuI1c              MLRTTGAVTALVGSGLAVT−−−AMPAGAAT−−−−−−−−−PDDFAR−−LRQCESGGNYSI−−−−−−−NTGNGF−−−YGAYQFDVRTWQGLG−−−YSGRPDQAAPAVQDEAA−−−−−−−−−YRLYNSRGW−−−SPWP−−−−ACSR                        
fig|102897.3.peg.4369   Frankia sp. EUN1f             RVLRTTGAVTALVGTGLAVT−−−AAPAGAAT−−−−−−−−−ADDFAR−−LRQCESGGNYAI−−−−−−−NTGNGF−−−YGAYQFDQRTWTGLG−−−YPGRPDQAPPAMQDDAA−−−−−−−−−YKLYDSRGW−−−SPWP−−−−ACSNKLGLTRNGPAPASSGT        
fig|298653.7.peg.223   Frankia sp. EAN1pec                      TALVGTGLAVT−−−AAPAGAAT−−−−−−−−−ADDFAK−−LRKCESGGNYAI−−−−−−−NTGNGF−−−YGAYQFDQRTWTGLG−−−YPGRPDQAPPAMQDEAA−−−−−−−−−YKLYDSRGW−−−SPWP−−−−GCTSKLGLTRNGPAPASSGAGGDVIAQA
fig|298653.4.peg.211   Frankia sp. EAN1pec             RVLRTTGAVTALVGTGLAVT−−−AAPAGAAT−−−−−−−−−ADDFAK−−LRKCESGGNYAI−−−−−−−NTGNGF−−−YGAYQFDQRTWTGLG−−−YPGRPDQAPPAMQDEAA−−−−−−−−−YKLYDSRGW−−−SPWP−−−−GCTSKLGLTRNGPAPASSGAGGDVIAQA
fig|526226.8.peg.1209   Gordonia bronchialis DSM 43247                                       GTWTST−−−−−−−−−DPAWAA−−LIKRESGGNPSIVQGVQDANSGGNEA−−−SGLFQIAKGTWASNGGDEFAPTAGQATPQQQAIVA−−−−−−−−−ARIFDKSGG−−−APW                                 
fig|1306952.3.peg.824   Pediococcus acidilactici D3                                      ASRTGVS−−−−−−−−−AAKWQQ−−IIMRESGGNANVS−−−−−−−NASSGA−−−YGLFQL−−−−−−−LGHGEHAG−−−−−MSVAEQINMA−−−−−−−−−TNVYNAQGL−−−SAW                                 
fig|525262.3.peg.1039   Corynebacterium jeikeium ATCC 43734                     ARLSVAGVAVAATSALLAPTASAA−−−−−−P−−DSDWDR−−LAQCESGGNWSI−−−−−−−NTGNGF−−−HGGLQFSPSTWAGYGGKQYAPYAYQATREQQIAVA−−−−−−−−−ERVLAGQGW−−−GAWP−−−−ACSA                        
fig|306537.3.peg.1734   Corynebacterium jeikeium K411                     ARLSVAGVAVAATSALLAPTASAA−−−−−−P−−DSDWDR−−LAQCESGGNWSI−−−−−−−NTGNGF−−−HGGLQFSPSTWAGYGGKQYAPYAYQATREQQIAIA−−−−−−−−−ERVLAGQGW−−−GAWP−−−−ACSA                        
fig|1267754.3.peg.1541   Corynebacterium urealyticum DSM 7111                                                      DSDWDR−−LAQCEAGGNWQI−−−−−−−NTGNGY−−−HGGLQFSPSTWNAYGGQKYAPYAYQASREQQIAVA−−−−−−−−−EKVLAGQGW−−−GAWP−−−−SCSAQ                       
fig|504474.3.peg.1549   Corynebacterium urealyticum DSM 7109                                                      DSDWDR−−LAQCEAGGNWQI−−−−−−−NTGNGY−−−HGGLQFSPSTWNAYGGQKYAPYAYQASREQQIAVA−−−−−−−−−EKVLAGQGW−−−GAWP−−−−SCSAQ                       
fig|548477.4.peg.2070   Corynebacterium glucuronolyticum ATCC 51867                                                      DSDWDR−−LAQCEAGGNWSI−−−−−−−NTGNGY−−−HGGLQFSPSTWSAHGGREFAPYAYQATREQQIAVA−−−−−−−−−ERILASQGW−−−GAWP−−−−ACSA                        
fig|525263.3.peg.1929   Corynebacterium lipophiloflavum DSM 44291                                     MAPAAHAA−−−−−−P−−DSDWDR−−LAQCEAGGNWSI−−−−−−−NTGNGY−−−YGGLQFSASTWRAYGGDQFAPYAHQATREQQIIVA−−−−−−−−−ERTLASQGW−−−GAWP−−−−ACSA                        
fig|553207.3.peg.1154   Corynebacterium matruchotii ATCC 14266                   KFAKFAASTVAVGTASAIFSPAAHAA−−−−−−P−−DSDWDR−−LAQCESGGNWAI−−−−−−−NTGNGF−−−HGGLQFTASTWNAHGGQQYAPYAYQASREQQIAVA−−−−−−−−−ERVLASQGW−−−GAWP−−−−ACSA                        
fig|566549.5.peg.2630   Corynebacterium matruchotii ATCC 33806                   KFAKFAASTVAVGTASAIFSPAAHAA−−−−−−P−−DSDWDR−−LAQCESGGNWAI−−−−−−−NTGNGF−−−HGGLQFTASTWNAHGGQQYAPYAYQASREQQIAVA−−−−−−−−−ERVLASQGW−−−GAWP−−−−ACSA                        
fig|340322.5.peg.966   Corynebacterium glutamicum R                        AASTIAFGAAATIMAPSASAA−−−−−−P−−DSDWDR−−LAQCESGGNWAI−−−−−−−NTGNGY−−−HGGLQFSASTWAAYGGQEFATYAYQATREQQIAVA−−−−−−−−−ERTLAGQGW−−−GAWP−−−−ACSAS                       
fig|548476.3.peg.783   Corynebacterium aurimucosum ATCC 700975                                                      DSDWDR−−LAQCESGGNWAI−−−−−−−NTGNGY−−−HGGLQFNAQTWQAYGGGEFAPTANLATREQQIAVA−−−−−−−−−ERTLAQQGW−−−GAWP−−−−ACSAS                       
fig|548476.7.peg.570   Corynebacterium aurimucosum ATCC 700975 (Prj:31451)                                                      DSDWDR−−LAQCESGGNWAI−−−−−−−NTGNGY−−−HGGLQFNAQTWQAYGGGEFAPTANLATREQQIAVA−−−−−−−−−ERTLAQQGW−−−GAWP−−−−ACSAS                       
fig|649754.3.peg.785   Corynebacterium ammoniagenes DSM 20306              AKTNSVGTKFAATTIAFGAAAALMAPTAAAA−−−−−−P−−DSDWDR−−LAQCESGGDWNI−−−−−−−NTGNGY−−−HGGLQFSAGTWQAHGGGEFAPTADQASREQQIVVA−−−−−−−−−ERTLASQGW−−−GAWP−−−−ACSSQ                       
fig|525260.4.peg.1780   Corynebacterium accolens ATCC 49725                                                      DSDWDR−−LAQCESGGDWHI−−−−−−−NTGNGY−−−HGGLQFNAQTWQAYGGGEFAPTANQATREQQIVIA−−−−−−−−−ERTLANQGW−−−GAWP−−−−ACSAS                       
fig|525268.3.peg.1391   Corynebacterium striatum ATCC 6940                                          SAA−−−−−−P−−DSDWDR−−LAGCESGGNWAI−−−−−−−NTGNGY−−−YGGLQFSGQTWSAFGGGQYAPTANQATREQQIAIA−−−−−−−−−EKVLASQGW−−−GAWP−−−−ACSAS                       
fig|698973.3.peg.779   Corynebacterium diphtheriae BH8                        AASTVAFGTAATLLAPTASAA−−−−−−P−−DSDWDR−−LAGCEAGGNWAI−−−−−−−NTGNGF−−−FGGLQFTASTWNAYGGGQYAPTANGATREQQIAVA−−−−−−−−−EKVLAGQGW−−−GAWP−−−−ACSA                        
fig|553204.6.peg.2034   Corynebacterium amycolatum SK46                     AKVALTGAILGAGAAIFAPTASAA−−−−−−P−−DSDWDR−−LAQCESGGNWHI−−−−−−−NTGNGY−−−YGGLQFSAGTWNAFGGNEFASTADQASREEQIYVA−−−−−−−−−EKVLAQQGW−−−GAWP−−−−ACSAS                       
fig|266940.11.peg.2620   Kineococcus radiotolerans SRS30216                                       SSASAA−−−−−−P−−LEQWDR−−LAQCESGGNWHI−−−−−−−NTGNGY−−−YGGIQFSPRTWTGFGGGQFAPRADLASREQQIVVA−−−−−−−−−ERVLARQGW−−−RAWP−−−−SCSR                        
fig|266940.5.peg.4320   Kineococcus radiotolerans SRS30216                                       SSASAA−−−−−−P−−LEQWDR−−LAQCESGGNWHI−−−−−−−NTGNGY−−−YGGIQFSPRTWTGFGGGQFAPRADLASREQQIVVA−−−−−−−−−ERVLARQGW−−−RAWP−−−−SCSR                        
fig|247156.1.peg.691   Nocardia farcinica IFM 10152                  RTVAKVAVTGAIFGTASAALAGNASAA−−−−−−P−−DSDWDR−−LAQCEAGGNWAI−−−−−−−NTGNGY−−−HGGLQFSPSTWTAHGGQQYAPTANQATREEQIAVA−−−−−−−−−EKVLASQGW−−−GAWP−−−−SCSAA                       
fig|247156.8.peg.657   Nocardia farcinica IFM 10152                  RTVAKVAVTGAIFGTASAALAGNASAA−−−−−−P−−DSDWDR−−LAQCEAGGNWAI−−−−−−−NTGNGY−−−HGGLQFSPSTWTAHGGQQYAPTANQATREEQIAVA−−−−−−−−−EKVLASQGW−−−GAWP−−−−SCSAA                       
fig|234621.6.peg.5191   Rhodococcus erythropolis PR4                  RTVAKVAVTGAIMGVAGIAATGTASAA−−−−−−P−−DSDWDR−−LAQCEAGGNWAI−−−−−−−NTGNGY−−−QGGLQFSPSTWNAHGGGQYAATANQATREQQIVVA−−−−−−−−−ERVLANQGW−−−GAWP                                
fig|1278077.4.peg.4481   Rhodococcus qingshengii BKS 20-40                  RTVAKVAVTGAIMGVAGIAATGTANAA−−−−−−P−−DSDWDR−−LAQCEAGGNWAI−−−−−−−NTGNGY−−−QGGLQFSPSTWNAHGGGQYAATANQATREQQIVVA−−−−−−−−−ERVLANQGW−−−GAWP                                
fig|596309.3.peg.153   Rhodococcus erythropolis SK121                  RTVAKVAVTGAIMGVAGIAATGTANAA−−−−−−P−−DSDWDR−−LAQCEAGGNWAI−−−−−−−NTGNGY−−−QGGLQFSPSTWNAHGGGQYAATANQATREQQIVVA−−−−−−−−−ERVLANQGW−−−GAWP                                
fig|525264.4.peg.1846   Corynebacterium pseudogenitalium ATCC 33035                                          SAA−−−−−−P−−DSDWDR−−LAQCEAGGNWHI−−−−−−−NTGNGY−−−QGGLQFNPQTWQANGGGQFAATADQATREQQIVVA−−−−−−−−−ERVLASQGW−−−GAWP−−−−ACSAS                       
fig|553206.4.peg.1270   Corynebacterium tuberculostearicum SK141                                          SAA−−−−−−P−−DSDWDR−−LAQCEAGGNWHI−−−−−−−NTGNGY−−−QGGLQFNPQTWQANGGGQFAATADQATREQQIVVA−−−−−−−−−ERVLASQGW−−−GAWP−−−−ACSAS                       
fig|645127.4.peg.449   Corynebacterium kroppenstedtii DSM 44385                     AKVALSGLAITASGIAVAPSASAA−−−−−−P−−DSDWDR−−LAQCESGGNWGI−−−−−−−NTGNGF−−−QGGLQFAPSTWSAYGGTEYAATANQATREQQITVG−−−−−−−−−ERVLAEQGW−−−NAWP−−−−ACSAQ                       
fig|632772.3.peg.5085   Rhodococcus opacus B4                  RTVAKVAVTGAIMGVAGAAFSGTANAA−−−−−−P−−DSDWDR−−LAQCESGGNWGI−−−−−−−NTGNGF−−−QGGLQFSPSTWNAHGGTQYAATANQASREEQIVVA−−−−−−−−−EKVLDSQGW−−−GAWP                                
fig|101510.15.peg.5006   Rhodococcus jostii RHA1                  RTVAKVAVTGAIMGVAGAAFSGTANAA−−−−−−P−−DSDWDR−−LAQCESGGNWGI−−−−−−−NTGNGF−−−QGGLQFSPSTWNAHGGTQYAATANQASREEQIVVA−−−−−−−−−EKVLDSQGW−−−GAWP                                
fig|101510.16.peg.5012   Rhodococcus jostii RHA1                  RTVAKVAVTGAIMGVAGAAFSGTANAA−−−−−−P−−DSDWDR−−LAQCESGGNWGI−−−−−−−NTGNGF−−−QGGLQFSPSTWNAHGGTQYAATANQASREEQIVVA−−−−−−−−−EKVLDSQGW−−−GAWP                                
fig|101510.15.peg.7068   Rhodococcus jostii RHA1                  RTVAKVAVTGAIMGVAGAAFSGTANAA−−−−−−P−−DSDWDR−−LAQCESGGNWGI−−−−−−−NTGNGF−−−QGGLQFSPSTWNAHGGTQYAATANQASREEQIVVA−−−−−−−−−EKVLDSQGW−−−GAWP                                
fig|101510.16.peg.7073   Rhodococcus jostii RHA1                  RTVAKVAVTGAIMGVAGAAFSGTANAA−−−−−−P−−DSDWDR−−LAQCESGGNWGI−−−−−−−NTGNGF−−−QGGLQFSPSTWNAHGGTQYAATANQASREEQIVVA−−−−−−−−−EKVLDSQGW−−−GAWP                                
fig|350058.8.peg.1495   Mycobacterium vanbaalenii PYR-1                                    VVNGGSIAAPLTSAIGQWSADWNA−−IAQAESGGNWSI−−−−−−−NTGNGY−−−SGGLQFSPSSWAAAGGTQYAPSAYQASPYQQALTA−−−−−−−−−ERLLAMQGP−−−GAWP−−−−NTFVPGSTGPSPDAVG           
fig|350058.5.peg.1439   Mycobacterium vanbaaleni vanbaalenii PYR-1                                    VVNGGSIAAPLTSAIGQWSADWNA−−IAQAESGGNWSI−−−−−−−NTGNGY−−−SGGLQFSPSSWAAAGGTQYAPSAYQASPYQQALTA−−−−−−−−−ERLLAMQGP−−−GAWP−−−−NTFVPGSTGPSPDAVG           
fig|526226.8.peg.5070   Gordonia bronchialis DSM 43247                                   SVVT−−−−−−−−−−−−−−−AADWDK−−VAQLESGGNWAI−−−−−−−DTGNGY−−−QGGLQFAPSTWTGAGGAQYAPTANKATREQQMEVA−−−−−−−−−NRVLGTQGW−−−GAWP−−−−STSKAAGVTGKKPAPPGTF         
fig|553206.4.peg.1723   Corynebacterium tuberculostearicum SK141                                      AAAPAVA−−−−−−D−−GSVWDS−−IAQCEATGNWSI−−−−−−−NTGNGF−−−SGGLQFTPSTWAAFGGTEYAPEAWQASREQQIAVA−−−−−−−−−EKVQAAQGW−−−GAWP−−−−ACTS                        
fig|525264.4.peg.1918   Corynebacterium pseudogenitalium ATCC 33035                                      AAAPAVA−−−−−−D−−GSVWDS−−IAQCEATGNWAI−−−−−−−NTGNGF−−−SGGLQFTPSTWAAFGGTEYAPEAWQASREQQIAVA−−−−−−−−−EKVQAAQGW−−−GAWP−−−−ACTS                        
fig|548476.3.peg.879   Corynebacterium aurimucosum ATCC 700975                 VRNEAVAAVIARGTK−−−−PKSTAPAVA−−−−−−E−−GSVWDA−−LAQCEATGNWSI−−−−−−−NTGNGF−−−SGGLQFTPSTWAAFGGTEYAPQAWQASREQQIAVA−−−−−−−−−QKVQAAQGW−−−GAWP−−−−ACTS                        
fig|548476.7.peg.479   Corynebacterium aurimucosum ATCC 700975 (Prj:31451)                 VRNEAVAAVIARGTK−−−−PKSTAPAVA−−−−−−E−−GSVWDA−−LAQCEATGNWSI−−−−−−−NTGNGF−−−SGGLQFTPSTWAAFGGTEYAPQAWQASREQQIAVA−−−−−−−−−QKVQAAQGW−−−GAWP−−−−ACTS                        
fig|525268.3.peg.1300   Corynebacterium striatum ATCC 6940            IVKEKVINEPVAATIARGTK−−−−KPAAAPAVA−−−−−−D−−GSVWDS−−LAQCESTGNWAI−−−−−−−NTGNGF−−−SGGLQFTPSTWAGFGGTAYAPEAWQATREQQIAVA−−−−−−−−−EKVQAAQGW−−−GAWP−−−−ACTS                        
fig|525260.4.peg.1867   Corynebacterium accolens ATCC 49725                                      AAAPAVA−−−−−−D−−GSVWDA−−IAQCESNGNWSI−−−−−−−NTGNGF−−−SGGLQFAPSTWAGLGGTEYAPEAWQATREQQIAVA−−−−−−−−−QKVQAAQGW−−−GAWP−−−−ACTA                        
fig|1267754.3.peg.562   Corynebacterium urealyticum DSM 7111                    APVEAVVKVGTKPKKPAGPDAPAVA−−−−−−N−−GSVWDE−−LAQCESTGNWSI−−−−−−−NTGNGF−−−SGGLQFTPSTWAGFGGTEYAPAAHMATREQQIAVA−−−−−−−−−ERVQAAQGW−−−GAWP−−−−ACTA                        
fig|504474.3.peg.559   Corynebacterium urealyticum DSM 7109                    APVEAVVKVGTKPKKPAGPDAPAVA−−−−−−N−−GSVWDE−−LAQCESTGNWSI−−−−−−−NTGNGF−−−SGGLQFTPSTWAGFGGTEYAPAAHMATREQQIAVA−−−−−−−−−ERVQAAQGW−−−GAWP−−−−ACTA                        
fig|525262.3.peg.501   Corynebacterium jeikeium ATCC 43734                                    TGAAAPAVA−−−−−−N−−GSVWDQ−−LAQCEAGGDWSI−−−−−−−NTGNGF−−−SGGLQFTPSTWAAFGGTEYAPAAHMATREQQIAVA−−−−−−−−−ERVQAGQGW−−−GAWP−−−−ACTS                        
fig|306537.3.peg.765   Corynebacterium jeikeium K411                                    TGAAAPAVA−−−−−−N−−GSVWDQ−−LAQCEAGGDWSI−−−−−−−NTGNGF−−−SGGLQFTPSTWAAFGGTEYAPAAHMATREQQIAVA−−−−−−−−−ERVRAGQGW−−−GAWP−−−−ACTS                        
fig|553207.3.peg.1071   Corynebacterium matruchotii ATCC 14266                     AKKATISRGT−−−−−KVSRVPTVP−−−−−−D−−GSVWDR−−LAQCESTGNWAI−−−−−−−NTGNGF−−−HGGLQFTPQTWLAYGGGEYAPYAYQATREEQIAVA−−−−−−−−−QKVQASQGW−−−GAWP−−−−ACTA                        
fig|566549.5.peg.2544   Corynebacterium matruchotii ATCC 33806                     AKKATISRGT−−−−−KVSRVPTVP−−−−−−D−−GSVWDR−−LAQCESTGNWAI−−−−−−−NTGNGF−−−HGGLQFTPQTWLAYGGGEYAPYAYQATREEQIAVA−−−−−−−−−QKVQASQGW−−−GAWP−−−−ACTA                        
fig|1232383.3.peg.1105   Corynebacterium glutamicum SCgG2                                  ATISRGTKTVA−−−−−−A−−NSVWDQ−−LAQCESGGNWAI−−−−−−−NTGNGF−−−SGGLQFHPQTWLAYGGGAFSGDASGASREQQISIA−−−−−−−−−EKVQAAQGW−−−GAWP−−−−ACTAS                       
fig|340322.5.peg.1045   Corynebacterium glutamicum R                                  ATISRGTKTVA−−−−−−A−−NSVWDQ−−LAQCESGGNWAI−−−−−−−NTGNGF−−−SGGLQFHPQTWLAYGGGAFSGDASGASREQQISIA−−−−−−−−−EKVQAAQGW−−−GAWP−−−−ACTAS                       
fig|196164.6.peg.979   Corynebacterium efficiens YS-314                   TKAAPATVSSST−−−−−SGSAAPSVA−−−−−−G−−GSVWDA−−LAQCESNGNWSI−−−−−−−NTGNGF−−−SGGLQFHPQTWQAYGGGQYAPTAAGASREQQIAIA−−−−−−−−−QKVQAAQGW−−−GAWP−−−−ACTA                        
fig|591158.3.peg.6895   Streptomyces sp. AA4                     KVLVEAKSKIIKVGTKKPPAPAIG−−−−−−D−−TGAWDR−−IAQCESGGNWSI−−−−−−−NTGNGY−−−YGGLQFDRQTWNAYGGQQYAPTADKATREQQIAIA−−−−−−−−−EKVRDARGGY−−−SAW−−−−−GCG                         
fig|479435.6.peg.5731   Kribbella flavida DSM 17836                                      AADPPVG−−−−−−N−−TSAWDR−−IAECESGGNWHI−−−−−−−NTGNGY−−−YGGLQFSHQTWVAYGGDKYANNAHQASKAQQIAIA−−−−−−−−−EKVRAARGGY−−−GDWP−−−−VCG                         
fig|471857.5.peg.3307   Saccharomonospora viridis DSM 43017                               VRVGTKQPAVPPVT−−−−−−D−−GSVWDA−−LAQCESGGNWSI−−−−−−−NTGNGY−−−YGGLQFNKQTWDAYGGTQYAAYPHQATREQQIAIA−−−−−−−−−TKLRDSRGGY−−−GAWP−−−−ACSS                        
fig|471857.4.peg.251   Saccharomonospora viridis DSM 43017                               VRVGTKQPAVPPVT−−−−−−D−−GSVWDA−−LAQCESGGNWSI−−−−−−−NTGNGY−−−YGGLQFNKQTWDAYGGTQYAAYPHQATREQQIAIA−−−−−−−−−TKLRDSRGGY−−−GAWP−−−−ACSS                        
fig|196162.12.peg.4148   Nocardioides sp. JS614                           VDEIVKVGTKAPAVNFAS−−−−−−G−−NSVWDR−−LAQCESGGNWAI−−−−−−−NTGNGY−−−YGGLQFSLGTWQAYGGT−−−GLPSNHSRETQIAIA−−−−−−−−−TKLRNASGGY−−−GAWP−−−−GCAAA                       
fig|196162.6.peg.3974   Nocardioides sp. JS614                           VDEIVKVGTKAPAVNFAS−−−−−−G−−NSVWDR−−LAQCESGGNWAI−−−−−−−NTGNGY−−−YGGLQFSLGTWQAYGGT−−−GLPSNHSRETQIAIA−−−−−−−−−TKLRNASGGY−−−GAWP−−−−GCAAA                       
fig|446462.5.peg.677   Actinosynnema mirum DSM 43827                                                   D−−GAVWDS−−LAKCEAGGNWAI−−−−−−−NTGNGY−−−YGGLQFNKSTWDAYGGSSYAAYPHQASREQQIAIA−−−−−−−−−TKLRDARGGY−−−SAWP−−−−GCSS                        
fig|446462.6.peg.658   Actinosynnema mirum DSM 43827                                                   D−−GAVWDS−−LAKCEAGGNWAI−−−−−−−NTGNGY−−−YGGLQFNKSTWDAYGGSSYAAYPHQASREQQIAIA−−−−−−−−−TKLRDARGGY−−−SAWP−−−−GCSS                        
fig|405948.6.peg.741   Saccharopolyspora erythraea NRRL 2338                                                   D−−SAVWDK−−LVQCEATGNWAM−−−−−−−NSGNGY−−−YGGLQFDKKTWDANGGSQYAAYPHQASREQQIAVA−−−−−−−−−TKVRDSRGGY−−−GAWP−−−−SCSS                        
fig|405948.11.peg.812   Saccharopolyspora erythraea NRRL 2338                                                   D−−SAVWDK−−LVQCEATGNWAM−−−−−−−NSGNGY−−−YGGLQFDKKTWDANGGSQYAAYPHQASREQQIAVA−−−−−−−−−TKVRDSRGGY−−−GAWP−−−−SCSS                        
fig|446465.5.peg.2366   Brachybacterium faecium DSM 4810                                          SAP−−−−−−S−−GSVWDR−−IAQCESGGNWSI−−−−−−−NTGNGY−−−HGGLQFSGQTWRAFGGGKYAPTADQASRAQQIDIA−−−−−−−−−KKVQAQQGW−−−GAWP−−−−ACTS                        
fig|548477.4.peg.2143   Corynebacterium glucuronolyticum ATCC 51867     VFVNGQEVSNEVLQETVTAPSTGAVIARGTKKAPAAASVA−−−−−−A−−GSVWDS−−IAQCESGGNWAI−−−−−−−STGNGY−−−YGGLQFNVGTWSAYGGGEYAPTANLATRDQQIAIA−−−−−−−−−QKVQAAQGW−−−GAWP−−−−ACTAS                       
fig|585529.3.peg.1435   Corynebacterium genitalium ATCC 33030                          TGA−−−−−−−−−−SAPAVA−−−−−−G−−GSVWDS−−IAQCESGGNWSI−−−−−−−NTGNGY−−−YGGLQFAASTWSAYGGGQYAPTADQATREQQIAVA−−−−−−−−−EKVQAAQGW−−−GAWP−−−−ACTAS                       
fig|680198.5.peg.7097   Streptomyces scabiei 87.22                                         ASAA−−−−−−D−−SGVWDR−−IARCESGGDWHI−−−−−−−NTGNGY−−−YGGLQFAASTWRAYGGTAYAPTADRASRSQQIEIA−−−−−−−−−TKVQRAQGW−−−GAWP−−−−TCSR                        
fig|443255.8.peg.4362   Streptomyces clavuligerus ATCC 27064                                VVLGAGTGTARAA−−−−−−D−−AGVWDR−−IARCESGGNWHI−−−−−−−NTGNGY−−−YGGLQFAPSTWRAHGGTAYAPTADRASRSQQIAVA−−−−−−−−−VRVQRAQGW−−−GAWP−−−−TCSA                        
fig|645465.3.peg.4766   Streptomyces sp. e14                                        GAHAA−−−−−−D−−SGVWDR−−IARCESGGNWHI−−−−−−−NTGNGY−−−YGGLQFAASTWRAYGGTAYAARADQASRGQQIAVA−−−−−−−−−TRVQQAQGW−−−GAWP−−−−VC                          
fig|591159.3.peg.7197   Streptomyces viridochromogenes DSM 40736                                                         WDR−−IAQCESGGNWHI−−−−−−−NTGNGY−−−YGGLQFAASTWSAYGGTAYAATADQASKSQQIAVA−−−−−−−−−TKVQRAQGW−−−GAWP−−−−VCSARAGASGGAP               
fig|463191.3.peg.5024   Streptomyces sviceus ATCC 29083                                         SVAA−−−−−−D−−GGVWDR−−IAQCESGGNWHI−−−−−−−NTGNGY−−−YGGLQFSAGTWRAYGGTAYAATADQATKSQQIAVA−−−−−−−−−TKVQGAQGW−−−GAWP−−−−TCSA                        
fig|754252.3.peg.612   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1                         VSKVVLVGTGQAASGGATDTA−−−−−N−−SGIWDR−−IAQCESGGNWSI−−−−−−−NTGNGY−−−YGGLQFAASTWAAYGGTAYAPTANLATRDQQITIA−−−−−−−−−NKVYAASGL−−−SAW                                 
fig|290340.10.peg.1361   Arthrobacter aurescens TC1                                       SGPTGAP−−−−−N−−EAMWDR−−IAQCESGGNWSI−−−−−−−NTGNGY−−−YGGLQFSSPTWLANGGGAYAPNASLATKAQQIEIA−−−−−−−−−NRLYAKNGL−−−SDW                                 
fig|288705.4.peg.3123   Renibacterium salmoninarum ATCC 33209                   KPVAEKVSVGGKDRPKQEAASGNTGATPPPTAN−−DAMWDK−−IAQCESGGNWAI−−−−−−−NTGNGY−−−YGGLQFDIGSWNANGGGQYAARADLASREQQIAVA−−−−−−−−−NTYYAKAGL−−−RPWG−−−−CAGAASR                     
fig|288705.3.peg.3123   Renibacterium salmoninarum ATCC 33209                   KPVAEKVSVGGKDRPKQEAASGNTGATPPPTAN−−DAMWDK−−IAQCESGGNWAI−−−−−−−NTGNGY−−−YGGLQFDIGSWNANGGGQYAARADLASREQQIAVA−−−−−−−−−NTYYAKAGL−−−RPWG−−−−CAGAASR                     
fig|452863.6.peg.1940   Arthrobacter chlorophenolicus A6                                          TGAAAPAMMN−−EAMWDK−−IAQCESTGNWSI−−−−−−−NSGNGY−−−YGGLQFDIQTWIGAGGGAYAPNASLATKAQQIDIA−−−−−−−−−NRVYAQRGL−−−QPW                                 
fig|313589.5.peg.3307   Janibacter sp. HTCC2649                                ASAPAPSAGNTSGAGINLSN−−AAMWDR−−IAECESSGNWSI−−−−−−−NTGNGY−−−YGGLQFDLQTWRGAGGGDFASRPDLASRAEQITVA−−−−−−−−−NRVYADRGL−−−QPW                                 
fig|313589.3.peg.56   Janibacter sp. HTCC2649                                ASAPAPSAGNTSGAGINLSN−−AAMWDR−−IAECESSGNWSI−−−−−−−NTGNGY−−−YGGLQFDLQTWRGAGGGDFASRPDLASRAEQITVA−−−−−−−−−NRVYADRGL−−−QPW                                 
fig|313589.3.peg.4319   Janibacter sp. HTCC2649                         AVTSVAAVGGATAMAQSASA−−−−−−G−−GTVWDR−−VAACESGGNWAI−−−−−−−NTGNGY−−−YGGLQFSYSTWKGFGGQRYATTANKASKGQQIEIA−−−−−−−−−QKVLKTQGP−−−GAWP−−−−VCS                         
fig|313589.5.peg.3195   Janibacter sp. HTCC2649                         AVTSVAAVGGATAMAQSASA−−−−−−G−−GTVWDR−−VAACESGGNWAI−−−−−−−NTGNGY−−−YGGLQFSYSTWKGFGGQRYATTANKASKGQQIEIA−−−−−−−−−QKVLKTQGP−−−GAWP−−−−VCS                         
fig|313589.3.peg.4320   Janibacter sp. HTCC2649                                     GLATGAGA−−−−−−A−−ENVWDR−−VAICESGGNWSI−−−−−−−NTGNGY−−−YGGLQFSYSTWKAFGGQTYATTANLASKSQQILIA−−−−−−−−−QKVLKVQGP−−−GAWP−−−−VCS                         
fig|313589.5.peg.3196   Janibacter sp. HTCC2649                                     GLATGAGA−−−−−−A−−ENVWDR−−VAICESGGNWSI−−−−−−−NTGNGY−−−YGGLQFSYSTWKAFGGQTYATTANLASKSQQILIA−−−−−−−−−QKVLKVQGP−−−GAWP−−−−VCS                         
fig|321955.4.peg.3376   Brevibacterium linens BL2                                GGPAQASTGAQSS−−−−−−−−−EGVWDK−−VAECESGGDWHI−−−−−−−NTGNGY−−−YGGLQFSEQTWKAFGG−−−EGMPHKASKAEQIDVA−−−−−−−−−QKTLKEQGP−−−GAWP−−−−VCG                         
fig|446465.5.peg.262   Brachybacterium faecium DSM 4810                      AAATGGAVIAAGLGVSGAGVAAA−−−−−−D−−TAVWDK−−VAQCESGGNWSI−−−−−−−NTGNGY−−−YGGLQFSPSTWRAFGGQEFAGNAHQATKAEQIAVA−−−−−−−−−QRTLAQQGP−−−GAWP−−−−TCG                         
fig|348776.4.peg.676   Mycobacterium tuberculosis C                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|611303.3.peg.771   Mycobacterium tuberculosis CPHL_A                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|1806.1.peg.665   Mycobacterium microti OV254                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|611304.3.peg.3748   Mycobacterium tuberculosis K85                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|515617.4.peg.1655   Mycobacterium tuberculosis T92                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|478433.3.peg.973   Mycobacterium tuberculosis KZN 4207                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|663886.3.peg.802   Mycobacterium tuberculosis KZN R506                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|1765.102.peg.3473   Mycobacterium bovis str. 04-6082                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|233413.5.peg.969   Mycobacterium bovis AF2122/97                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|520140.3.peg.1131   Mycobacterium tuberculosis EAS054                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|1206780.3.peg.964   Mycobacterium bovis BCG str. Korea 1168P                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|410289.13.peg.918   Mycobacterium bovis BCG str. Pasteur 1173P2                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|717522.6.peg.949   Mycobacterium bovis BCG str. Mexico                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|1138877.3.peg.965   Mycobacterium tuberculosis                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|164513.4.peg.3777   Mycobacterium tuberculosis 210                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|1765.199.peg.2372   Mycobacterium bovis str. 10-8965                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|443150.4.peg.953   Mycobacterium tuberculosis CCDC5180                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|572418.5.peg.949   Mycobacterium africanum GM041182                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|707235.4.peg.949   Mycobacterium tuberculosis CTRI-2                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|83331.1.peg.908   Mycobacterium tuberculosis CDC1551                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|83332.1.peg.868   Mycobacterium tuberculosis H37Rv                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|83332.12.peg.968   Mycobacterium tuberculosis H37Rv                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|83332.29.peg.950   Mycobacterium tuberculosis strain H37Rv / BROAD                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|882100.3.peg.946   Mycobacterium tuberculosis BTB05-559                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|611302.3.peg.1323   Mycobacterium tuberculosis T46                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|515616.3.peg.415   Mycobacterium tuberculosis 02_1987                            AVLGGGGIAMAAQATAA−−−−−−T−−DGEWDQ−−VARCKSGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|478435.3.peg.499   Mycobacterium tuberculosis KZN 605                                     MAAQATAA−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQRPAGEASKNCPSVERVLATQ−−−−−−−CWPPRVAGCAAAGL                     
fig|520141.3.peg.846   Mycobacterium tuberculosis T85                                            A−−−−−−T−−DGEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVG−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGR                        
fig|272631.5.peg.4069   Mycobacterium leprae TN                              MLDGSIALAGQASPA−−−−−−T−−DSEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVA−−−−−−−−−ERVLATQGS−−−GAWP−−−−ACGHGLSGP                   
fig|272631.1.peg.1289   Mycobacterium leprae TN                    IVAKITFTGAMLDGSIALAGQASPA−−−−−−T−−DSEWDQ−−VARCESGGNWSI−−−−−−−NTGNGY−−−LGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVA−−−−−−−−−ERVLATQGS−−−GAWP−−−−ACGHGLSGP                   
fig|362242.7.peg.404   Mycobacterium ulcerans Agy99                                                   T−−DGEWDQ−−VARCESGGNWAI−−−−−−−NTGNGY−−−YGGVQFAQSTWASHGGGEYAPSAQLASREEQIAVA−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCG                         
fig|216594.1.peg.5150   Mycobacterium marinum M                                                   T−−DGEWDQ−−VARCESGGNWAI−−−−−−−NTGNGY−−−YGGVQFAQSTWASHGGGEYAPSAQLASREEQIAVA−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCG                         
fig|216594.6.peg.5013   Mycobacterium marinum M                                                   T−−DGEWDQ−−VARCESGGNWAI−−−−−−−NTGNGY−−−YGGVQFAQSTWASHGGGEYAPSAQLASREEQIAVA−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCG                         
fig|243243.7.peg.972   Mycobacterium avium 104                                         AAAA−−−−−−T−−DGEWDQ−−VARCESGGNWGI−−−−−−−NTGNGY−−−HGGVQFSASTWAAHGGGEYAPSAELATREQQIAVA−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGGPLSGPTP                 
fig|1199187.3.peg.3147   Mycobacterium avium subsp. paratuberculosis MAP4                     AKIAVTGAVLGGGAIAMAGQAAAA−−−−−−T−−DGEWDQ−−VARCESGGNWGI−−−−−−−NTGNGY−−−HGGVQFSASTWAAHGGGEYAPSAELATREQQIAVA−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGGPLSGPTP                 
fig|262316.1.peg.805   Mycobacterium avium subsp. paratuberculosis str. k10                     AKIAVTGAVLGGGAIAMAGQAAAA−−−−−−T−−DGEWDQ−−VARCESGGNWGI−−−−−−−NTGNGY−−−HGGVQFSASTWAAHGGGEYAPSAELATREQQIAVA−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGGPLSGPTP                 
fig|553481.3.peg.828   Mycobacterium avium subsp. avium ATCC 25291                                                   T−−DGEWDQ−−VARCESGGNWGI−−−−−−−NTGNGY−−−HGGVQFSASTWAAHGGGEYAPSAELATREQQIAVA−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGGPLSGPTP                 
fig|262316.17.peg.847   Mycobacterium avium subsp. paratuberculosis K-10                                                   T−−DGEWDQ−−VARCESGGNWGI−−−−−−−NTGNGY−−−HGGVQFSASTWAAHGGGEYAPSAELATREQQIAVA−−−−−−−−−ERVLATQGR−−−GAWP−−−−VCGGPLSGPTP                 
fig|525368.3.peg.3109   Mycobacterium parascrofulaceum ATCC BAA-614                      KIAVTGAVLGGGSIALAGQAAAA−−−−−−T−−DGEWDQ−−VARCESGGNWAI−−−−−−−NTGNGY−−−HGGVQF