(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00011766

fig|585154.3.peg.1124   Staphylococcus aureus subsp. aureus EMRSA16     MENLYLIKDLGALAGRDYRAKEIQNLQRIEQFALGLTTEFKLHQKAKTIQHFAEQIYY−−−−NGRSQAAVNKSLQSQINALVVAPRNNSANEIVQARVNVNGETFDTLKEHLDDWETKTQINKEETIRELNKTKQEILDIEYRFEPDKQEFLFVTELAPLTNAVMQSFWFDNRTGIVYMTQARNNGYMLSRLRPNGQFIDSSLIVGGGHGTHNGYRYIDDELWIYSFILNGNNENTLVRFKYTPNVEISYGKYGMQDVFTGHPEKPYITPVINEKENKILYRIERPRSQWELENSMNYIEIRSLDDVDKNIDKVLHKISIPMRLTNETQPMQGVTFDEKYLYWYTGDSNPNNRNYLTAFDLETGEEAYQVNADYGGTLDSFPGEFAEAEGLQIYYDKDSGKKALMLGVTVGGDGNRTHRIFMIGQRGILEILHSRGVPFIMSDTGGRVKPLPMRPDKLKNLGMLTEPGLYYLYTDHTVQIDDFPLPREWRDAGWFLEVKPPQTGGDVIQILTRNSYARNMMTFERVLSGRTGDISDWNYVPKNSGKWERVPSFITKMSDINIVGMSFYLTTDDTKRFTDFPTEHKGVAGWNLYVEASNTGGFVHRLVRNSVTASAEILLKNYDSKTSSGPWTLHEGRIIS
fig|548473.3.peg.1839   Staphylococcus aureus subsp. aureus TCH60     MENLYLIKDLGALAGRDYRAKEIQNLQRIEQFALGLTTEFKLHQTAKTIQHFAEQIYY−−−−NGRSQAAVNKSLQSQINALVVAPRNNSANEIVQARVNVNGETFDTLKEHLDDWETKTQINKEETIRELNKTKQEILDIEYRFEPDKQEFLFVTELAPLTNAVMQSFWFDNRTGIVYMTQARNNGYMLSRLRPNGQFIDSSLIVGGGHGTHNGYRYIDDELWIYSFILNGNNENTLVRFKYTPNVEISYGKYGMQDVFTGHPEKPYITPVINEKENKILYRIERPRSQWELENSMNYIEIRSLDDVDKNIDKVLHKISIPMRLTNETQPMQGVTFDEKYLYWYTGDSNPNNRNYLTAFDLETGEEAYQVNADYGGTLDSFPGEFAEAEGLQIYYDKDSGKKALMLGVTVGGDGNRTHRIFMIGQRGILEILHSRGVPFIMSDTGGRVKPLPMRPDKLKNLGMLTEPGLYYLYTDHTVQIDDFPLPREWRDAGWFLEVKPPQTGGDVIQILTRNSYARNMMTFERVLSGRTGDISDWNYVPKNSGKWERVPSFITKMSDINIVGMSFYLTTDDTKRFTDFPTERKGVAGWNLYVEASNTGGFVHRLVRNSVTASAEILLKNYDSKTSSGPWTLHEGRIIS
fig|505321.3.peg.949   Staphylococcus aureus subsp. aureus str. CF-Marseille     MENLYLIKDLGALAGRDYRAKEIQNLQRIEQFALGLTTEFKLHQKAKTIQHFAEQIYY−−−−NGRSQAAVNKSLQSQINALVVAPRNNSANEIVQARVNVNGETFDTLKEHLDDWETKTQINKEETIRELNKTKQEILDIEYRFEPDKQEFLFVTELAPLTNAVMQSFWFDNRTGIVYMTQARNNGYMLSRLRPNGQFIDSSLIVGGGHGTHNGYRYIDDELWIYSFILNGNNENTLVRFKYTPNVEISYGKYGMQDVFTGHPEKPYITPVINEKENKILYRIERPRSQWELENSMNYIEIRSLDDVDKNIDKVLHKISIPMRLTNETQPMQGVTFDEKYLYWYTGDSNPNNRNYLTAFDLETGEEAYQVNADYGGTLDSFPGEFAEAEGLQIYYDKDSGKKALMLGVTVGGDGNRTHRIFMIGQRGILEILHSRGVPFIMSDTGGRVKPLPMRPDKLKNLGMLTEPGLYYLYTDHTVQIDDFPLPREWRDAGWFLEVKPPQTGGDVIQILTRNSYARNMMTFERVLSGRTGDISDWNYVPKNSGKWERVPSFITKMSDINIVGMSFYLTTDDTKRFTDFPTERKGVAGWNLYVEASNTGGFVHRLVRNSVTASAEILLKNYDSKTSSGPWTLHEGRIIS
fig|553581.3.peg.63   Staphylococcus aureus A9299     MENLYLIKDLGALAGRDYRAKEIQNLQRIEQFALGLTTEFKLHQKAKTIQHFAEQIYY−−−−NGRSQAAVNKSLQSQINALVVAPRNNSANEIVQARVNVNGETFDTLKEHLDDWETKTQINKEETIRELNKTKQEILDIEYRFEPDKQEFLFVTELAPLTNAVMQSFWFDNRTGIVYMTQARNNGYMLSRLRPNGQFIDSSLIVGGGHGTHNGYRYIDDELWIYSFILNGNNENTLVRFKYTPNVEISYGKYGMQDVFTGHPEKPYITPVINEKENKILYRIERPRSQWELENSMNYIEIRSLDDVDKNIDKVLHKISIPMRLTNETQPMQGVTFDEKYLYWYTGDSNPNNRNYLTAFDLETGEEAYQVNADYGGTLDSFPGEFAEAEGLQIYYDKDSGKKALMLGVTVGGDGNRTHRIFMIGQRGILEILHSRGVPFIMSDTGGRVKPLPMRPDKLKNLGMLTEPGLYYLYTDHTVQIDDFPLPREWRDAGWFLEVKPPQTGGDVIQILTRNSYARNMMTFERVLSGRTGDISDWNYVPKNSGKWERVPSFITKMSDINIVGMSFYLTTDDTKRFTDFPTERKGVAGWNLYVEASNTGGFVHRLVRNSVTASAEILLKNYDSKTSSGPWTLHEGRIIS
fig|585151.3.peg.1425   Staphylococcus aureus subsp. aureus C427     MENLYLIKDLGALAGRDYRAKEIQNLQRIEQFALGLTTEFKLHQKAKTIQHFAEQIYY−−−−NGRSQAAVNKSLQSQINALVVAPRNNSANEIVQARVNVNGETFDTLKEHLDDWETKTQINKEETIRELNKTKQEILDIEYRFEPDKQEFLFVTELAPLTNAVMQSFWFDNRTGIVYMTQARNNGYMLSRLRPNGQFIDSSLIVGGGHGTHNGYRYIDDELWIYSFILNGNNENTLVRFKYTPNVEISYGKYGMQDVFTGHPEKPYITPVINEKENKILYRIERPRSQWELENSMNYIEIRSLDDVDKNIDKVLHKISIPMRLTNETQPMQGVTFDEKYLYWYTGDSNPNNRNYLTAFDLETGEEAYQVNADYGGTLDSFPGEFAEAEGLQIYYDKDSGKKALMLGVTVGGDGNRTHRIFMIGQRGILEILHSRGVPFIMSDTGGRVKPLPMRPDKLKNLGMLTEPGLYYLYTDHTVQIDDFPLPREWRDAGWFLEVKPPQTGGDVIQILTRNSYARNMMTFERVLSGRTGDISDWNYVPKNSGKWERVPSFITKMSDINIVGMSFYLTTDDTKRFTDFPTERKGVAGWNLYVEASNTGGFVHRLVRNSVTASAEILLKNYDSKTSSGPWTLHEGRIIS
fig|585153.3.peg.303   Staphylococcus aureus subsp. aureus E1410     MENLYLIKDLGALAGRDYRAKEIQNLQRIEQFALGLTTEFKLHQKAKTIQHFAEQIYY−−−−NGRSQAAVNKSLQSQINALVVAPRNNSANEIVQARVNVNGETFDTLKEHLDDWETKTQINKEETIRELNKTKQEILDIEYRFEPDKQEFLFVTELAPLTNAVMQSFWFDNRTGIVYMTQARNNGYMLSRLRPNGQFIDSSLIVGGGHGTHNGYRYIDDELWIYSFILNGNNENTLVRFKYTPNVEISYGKYGMQDVFTGHPEKPYITPVINEKENKILYRIERPRSQWELENSMNYIEIRSLDDVDKNIDKVLHKISIPMRLTNETQPMQGVTFDEKYLYWYTGDSNPNNRNYLTAFDLETGEEAYQVNADYGGTLDSFPGEFAEAEGLQIYYDKDSGKKALMLGVTVGGDGNRTHRIFMIGQRGILEILHSRGVPFIMSDTGGRVKPLPMRPDKLKNLGMLTEPGLYYLYTDHTVQIDDFPLPREWRDAGWFLEVKPPQTGGDVIQILTRNSYARNMMTFERVLSGRTGDISDWNYVPKNSGKWERVPSFITKMSDINIVGMSFYLTTDDTKRFTDFPTERKGVAGWNLYVEASNTGGFVHRLVRNSVTASAEILLKNYDSKTSSGPWTLHEGRIIS
fig|93061.5.peg.1384   Staphylococcus aureus subsp. aureus NCTC 8325     MENLYLIKDLGALAGRDYRAKEIQNLQRIEQFALGLTTEFKLHQKAKTIQHFAEQIYY−−−−NGRSQAAVNKSLQSQINALVVAPRNNSANEIVQARVNVNGETFDTLKEHLDDWETKTQINKEETIRELNKTKQEILDIEYRFEPDKQEFLFVTELAPLTNAVMQSFWFDNRTGIVYMTQARNNGYMLSRLRPNGQFIDSSLIVGGGHGTHNGYRYIDDELWIYSFILNGNNENTLVRFKYTPNVEISYGKYGMQDVFTGHPEKPYITPVINEKENKILYRIERPRSQWELENSMNYIEIRSLDDVDKNIDKVLHKISIPMRLTNETQPMQGVTFDEKYLYWYTGDSNPNNRNYLTAFDLETGEEAYQVNADYGGTLDSFPGEFAEAEGLQIYYDKDSGKKALMLGVTVGGDGNRTHRIFMIGQRGILEILHSRGVPFIMSDTGGRVKPLPMRPDKLKNLGMLTEPGLYYLYTDHTVQIDDFPLPREWRDAGWFLEVKPPQTGGDVIQILTRNSYARNMMTFERVLSGRTGDISDWNYVPKNSGKWERVPSFITKMSDINIVGMSFYLTTDDTKRFTDFPTERKGVAGWNLYVEASNTGGFVHRLVRNSVTASAEILLKNYDSKTSSGPWTLHEGRIIS
fig|931434.3.peg.1957   Staphylococcus aureus subsp. aureus CIG1165     MENLYLIKDLGALAGRDYRAKEIQNLQRIEQFALGLTTEFKLHQKAKTIQHFAEQIYY−−−−NGRSQAAVNKSLQSQINALVVAPRNNSANEIVQARVNVNGETFDTLKEHLDDWETKTQINKEETIRELNKTKQEILDIEYRFEPDKQEFLFVTELAPLTNAVMQSFWFDNRTGIVYMTQARNNGYMLSRLRPNGQFIDSSLIVGGGHGTHNGYRYIDDELWIYSFILNGNNENTLVRFKYTPNVEISYGKYGMQDVFTGHPEKPYITPVINEKENKILYRIERPRSQWELENSMNYIEIRSLDDVDKNIDKVLHKISIPMRLTNETQPMQGVTFDEKYLYWYTGDSNPNNRNYLTAFDLETGEEAYQVNADYGGTLDSFPGEFAEAEGLQIYYDKDSGKKALMLGVTVGGDGNRTHRIFMIGQRGILEILHSRGVPFIMSDTGGRVKPLPMRPDKLKNLGMLTEPGLYYLYTDHTVQIDDFPLPREWRDAGWFLEVKPPQTGGDVIQILTRNSYARNMMTFERVLSGRTGDISDWNYVPKNSGKWERVPSFITKMSDINIVGMSFYLTTDDTKRFTDFPTERKGVAGWNLYVEASNTGGFVHRLVRNSVTASAEILLKNYDSKTSSGPWTLHEGRIIS
fig|931447.3.peg.2056   Staphylococcus aureus subsp. aureus CIG1233     MENLYLIKDLGALAGRDYRAKEIQNLQRIEQFALGLTTEFKLHQKAKTIQHFAEQIYY−−−−NGRSQAAVNKSLQSQINALVVAPRNNSANEIVQARVNVNGETFDTLKEHLDDWETKTQINKEETIRELNKTKQEILDIEYRFEPDKQEFLFVTELAPLTNAVMQSFWFDNRTGIVYMTQARNNGYMLSRLRPNGQFIDSSLIVGGGHGTHNGYRYIDDELWIYSFILNGNNENTLVRFKYTPNVEISYGKYGMQDVFTGHPEKPYITPVINEKENKILYRIERPRSQWELENSMNYIEIRSLDDVDKNIDKVLHKISIPMRLTNETQPMQGVTFDEKYLYWYTGDSNPNNRNYLTAFDLETGEEAYQVNADYGGTLDSFPGEFAEAEGLQIYYDKDSGKKALMLGVTVGGDGNRTHRIFMIGQRGILEILHSRGVPFIMSDTGGRVKPLPMRPDKLKNLGMLTEPGLYYLYTDHTVQIDDFPLPREWRDAGWFLEVKPPQTGGDVIQILTRNSYARNMMTFERVLSGRTGDISDWNYVPKNSGKWERVPSFITKMSDINIVGMSFYLTTDDTKRFTDFPTERKGVAGWNLYVEASNTGGFVHRLVRNSVTASAEILLKNYDSKTSSGPWTLHEGRIIS
fig|1137131.3.peg.1440   Staphylococcus aureus subsp. aureus 122051     MENLYLIKDLGALAGRDYRAKEIQNLQRIEQFALGLTTEFKLHQKAKTIQHFAEQIYY−−−−NGRSQAAVNKSLQSQINALVVAPRNNSANEIVQARVNVNGETFDTLKEHLDDWETKTQINKEETIRELNKTKQEILDIEYRFEPDKQEFLFVTELAPLTNAVMQSFWFDNRTGIVYMTQARNNGYMLSRLRPNGQFIDSSWIVGGGHGTHNGYRYIDDELWIYSFILNGNNENTLVRFKYTPNVEISYGKYGMQDVFTGHPEKPYITPVINEKENKILYRIERPRSQWELENSMNYIEIRSLDDVDKNIDKVLHKISIPMRLTNETQPMQGVTFDEKYLYWYTGDSNPNNRNYLTAFDLETGEEAYQVNADYGGTLDSFPGEFAEAEGLQIYYDKDSGKKALMLGVTVGGDGNRTHRIFMIGQRGILEILHSRGVPFIMSDTGGRVKPLPMRPDKLKNLGMLTEPGLYYLYTDHTVQIDDFPLPREWRDAGWFLEVKPPQTGGDVIQILTRNSYARNMMTFERVLSGRTGDISDWNYVPKNSGKWERVPSFITKMSDINIVGMSFYLTTDDTKRFTDFPTERKGVAGWNLYVEASNTGGFVHRLVRNSVTASAEILLKNYDSKTSSGPWTLHEGRIIS
fig|452948.4.peg.2137   Staphylococcus aureus 930918-3     MENLYLIKDLGALAGRDYRAKEIQNLQRIEQFALGLTTEFKLHQKAKTMQHFAEQIYY−−−−NGRSQAAVNKSLQSQINALVVAPRNNSANEIVQARVNVNGETFDTLKEHLDDWETKTQINKEETIRELNKTKQEILDIEYRFEPDKQEFLFVTELAPLTNAVMQSFWFDNRTGIVYMTQARNNGYMLSRLRPNGQFIDSSLIVGGGHGTHNGYRYIDDELWIYSFILNGNNENTLVRFKYTPNVEISYGKYGMQDVFTGHPEKPYITPVINEKENKILYRIERPRSQWELENSMNYIEIRSLDDVDKNIDKVLHKISIPMRLTNETQPMQGVTFDEKYLYWYTGDSNPNNRNYLTAFDLETGEEAYQVNADYGGTLDSFPGEFAEAEGLQIYYDKDSGKKALMLGVTVGGDGNRTHRIFMIGQRGILEILHSRGVPFIMSDTGGRVKPLPMRPDKLKNLGMLTEPGLYYLYTDHTVQIDDFPLPREWRDAGWFLEVKPPQTGGDVIQILTRNSYARNMMTFERVLSGRTGDISDWNYVPKNSGKWERVPSFITKMSDINIVGMSFYLTTDDTKRFTDFPTERKGVAGWNLYVEASNTGGFVHRLVRNSVTASAEILLKNYDSKTSSGPWTLHEGRIIS
fig|553577.3.peg.2606   Staphylococcus aureus A8796     MENLYLIKDLGALAGRDYRAKEIQNLQRIEQFALGLTTEFKLHQKAKTMQHFAEQIYY−−−−NGRSQAAVNKSLQSQINALVVAPRNNSANEIVQARVNVNGETFDTLKEHLDDWETKTQINKEETIRELNKTKQEILDIEYRFEPDKQEFLFVTELAPLTNAVMQSFWFDNRTGIVYMTQARNNGYMLSRLRPNGQFIDSSLIVGGGHGTHNGYRYIDDELWIYSFILNGNNENTLVRFKYTPNVEISYGKYGMQDVFTGHPEKPYITPVINEKENKILYRIERPRSQWELENSMNYIEIRSLDDVDKNIDKVLHKISIPMRLTNETQPMQGVTFDEKYLYWYTGDSNPNNRNYLTAFDLETGEEAYQVNADYGGTLDSFPGEFAEAEGLQIYYDKDSGKKALMLGVTVGGDGNRTHRIFMIGQRGILEILHSRGVPFIMSDTGGRVKPLPMRPDKLKNLGMLTEPGLYYLYTDHTVQIDDFPLPREWRDAGWFLEVKPPQTGGDVIQILTRNSYARNMMTFERVLSGRTGDISDWNYVPKNSGKWERVPSFITKMSDINIVGMSFYLTTDDTKRFTDFPTERKGVAGWNLYVEASNTGGFVHRLVRNSVTASAEILLKNYDSKTSSGPWTLHEGRIIS
fig|644279.4.peg.1589   Staphylococcus aureus subsp. aureus 132     MENLYLIKDLGALAGRDYRAKEIQNLQRIEQFALGLTTEFKLHQKAKTMQHFAEQIYY−−−−NGRSQAAVNKSLQSQINALVVAPRNNSANEIVQARVNVNGETFDTLKEHLDDWETKTQINKEETIRELNKTKQEILDIEYRFEPDKQEFLFVTELAPLTNAVMQSFWFDNRTGIVYMTQARNNGYMLSRLRPNGQFIDSSLIVGGGHGTHNGYRYIDDELWIYSFILNGNNENTLVRFKYTPNVEISYGKYGMQDVFTGHPEKPYITPVINEKENKILYRIERPRSQWELENSMNYIEIRSLDDVDKNIDKVLHKISIPMRLTNETQPMQGVTFDEKYLYWYTGDSNPNNRNYLTAFDLETGEEAYQVNADYGGTLDSFPGEFAEAEGLQIYYDKDSGKKALMLGVTVGGDGNRTHRIFMIGQRGILEILHSRGVPFIMSDTGGRVKPLPMRPDKLKNLGMLTEPGLYYLYTDHTVQIDDFPLPREWRDAGWFLEVKPPQTGGDVIQILTRNSYARNMMTFERVLSGRTGDISDWNYVPKNSGKWERVPSFITKMSDINIVGMSFYLTTDDTKRFTDFPTERKGVAGWNLYVEASNTGGFVHRLVRNSVTASAEILLKNYDSKTSSGPWTLHEGRIIS
fig|931450.3.peg.2668   Staphylococcus aureus subsp. aureus CIG2018     MENLYLIKDLGALAGRDYRAKEIQNLQRIEQFALGLTTEFKLHQKAKTMQHFAEQIYY−−−−NGRSQAAVNKSLQSQINALVVAPRNNSANEIVQARVNVNGETFDTLKEHLDDWETKTQINKEETIRELNKTKQEILDIEYRFEPDKQEFLFVTELAPLTNAVMQSFWFDNRTGIVYMTQARNNGYMLSRLRPNGQFIDSSLIVGGGHGTHNGYRYIDDELWIYSFILNGNNENTLVRFKYTPNVEISYGKYGMQDVFTGHPEKPYITPVINEKENKILYRIERPRSQWELENSMNYIEIRSLDDVDKNIDKVLHKISIPMRLTNETQPMQGVTFDEKYLYWYTGDSNPNNRNYLTAFDLETGEEAYQVNADYGGTLDSFPGEFAEAEGLQIYYDKDSGKKALMLGVTVGGDGNRTHRIFMIGQRGILEILHSRGVPFIMSDTGGRVKPLPMRPDKLKNLGMLTEPGLYYLYTDHTVQIDDFPLPREWRDAGWFLEVKPPQTGGDVIQILTRNSYARNMMTFERVLSGRTGDISDWNYVPKNSGKWERVPSFITKMSDINIVGMSFYLTTDDTKRFTDFPTERKGVAGWNLYVEASNTGGFVHRLVRNSVTASAEILLKNYDSKTSSGPWTLHEGRIIS
fig|585145.3.peg.1694   Staphylococcus aureus subsp. aureus 65-1322     MENLYLIKDLGALAGRDYRAKEIQNLQRIEQFALGLTTEFKLHQKAKTMQHFAEQIYY−−−−NGRSQAAVNKSLQSQINALVVAPRNNSANEIVQARVNVNGETFDTLKEHLDDWETKTQNNKEETIRELNKTKQEILDIEYRFEPDKQEFLFVTELAPLTNAVMQSFWFDNRTGIVYMTQARNNGYMLSRLRPNGQFIDSSLIVGGGHGTHNGYRYIDDELWIYSFILNGNNENTLVRFKYTPNVEISYGKYDMQDVFTGHPEKPYITPVINEKENKILYRIERPRSQWELENSMNYIEIRSLDDVDKNIDKVLHKISIPMRLTNENQPMQGVTFDEKYLYWYTGDSNPNNRNYLTAFDLETGEEAYQVNADYGGTLDSFPGEFAEAEGLQIYYDKDSGKKALMLGVTVGGDGNRTHRIFMIGQRGILEILHSRGVPFIMSDTGGRVKPLPMRPDKLKNLGMLTEPGLYYLYTDHTVQIDDFPLPREWRDAGWFLEVKPPQTGGDVIQILTRNSYARNMMTFERVLSGRTGDISDWNYVPKNSGKWERVPSFITKMSDINIVGMSFYLTTDDTKRFTDFPTERKGVAGWNLYVEASNTGGFVHRLVRNSVTASAEILLKNYDSKTSSGPWTLHEGRIIS
fig|93062.4.peg.842   Staphylococcus aureus subsp. aureus COL     MENLYLIKDLGALAGRDYRAKEIQNLQRIEQFALGLTTEFKLHQKAKTMQHFAEQIYY−−−−NGRSQAAVNKSLQSQINALVVAPRNNSANEIVQARVNVNGETFDTLKEHLDDWETKTQINKEETIRELNKTKQEILDIEYRFEPDKQEFLFVTELAPLTNAVMQSFWFDNRTGIVYMTQARNNGYMLSRLRPNGQFIDSSLIVGGGHGTHNGYRYIDDELWIYSFILNGNNENTLVRFKYTPNVEISYGKYGMQDVFTGHPEKPYITPVINEKENKILYRIERPRSQWELENSMNYIEIRSLDDVDKNIDKVLHKISIPMRLTNETQPMQGVTFDEKYLYWYTGDSNPNNRNYLTAFDLETGEEAYQVNADYGGTLDSFPGEFAEAEGLQIYYDKDSGKKALMLGVTVGGDGNRTHRIFMIGQRGILEILHSRGVPFIMSDTGGRVKPLPMRPDKLKNLGMLTEPGLYYLYTDHTVQIDDFPLPREWRDAGWFLEVKPPQTGGDVIQILTRNSYARNMMTFERVLSGRTGDISDWNYVPKNSGKWERVPSFITKMSDINIVGMSFYLTTDDTKRFTDFPTERKGVAGWNLYVEASNTGGFVHRLVRNSVTASAEILLKNYDSKISSGPWTLHEGRIIS
fig|1323661.3.peg.1400   Staphylococcus aureus CA-347     MENLYLIKDLGALAGRDYRAKEIQNLQRIEQFALGLTTEFKLHQKAKTIQHFAEQIYY−−−−NGRSQAAVNKSLQSQINALVVAPRNNSANEIVQARVNVNGETFDTLKEHLDDWETKTQINKEETIRELNKTKQEILDIEYRFEPDKQEFLFVTELAPLTNAVMQSFWFDNRTGIVYMTQARNNGYMLSRLRPNGQFIDSSLIVGGGHGTHNGYRYIDDELWIYSFILNGNNENTLVRFKYTPNVEISYGKYGMQDVFTGHPEKPYITPVINEKENKILYRIERPRSQWELENSMNYIEIRSLDDVDKNIDKVLHKISIPMRLTNETQPMQGVTFDEKYLYWYTGDSNPNNRNYLTAFDLETGEEAYQVNADYGGTLDSFPGEFAEAEGLQIYYDKDSGKKALMLGVTVGGDGNRTHRIFMIGQRGILEILHSRGVPFIMSDTGGRVKPLPMRPDKLKNLGMLTEPGLYYLYTDHTVQIDDFPLPREWRDAGWFLEVKPPQTGGDVIQILTRNSYARNMMTFERVLSGRTGDISDWNYVPKNSGKWERVPSFITKMSDINIVGMSFYLTTDDTKRFTDFPTERKGVAGWNLYVEASNTGGFVHRLVRNSVTASCEILLKNYDSKTSSGPWTLHEGRIIS
fig|359786.13.peg.1146   Staphylococcus aureus subsp. aureus JH9     MENLYLIKDLGALAGRDYRAKEIQNLQRIEQFALGLTTEFKLHQKAKTIQHFAEQIYY−−−−NGRSQAAVNKSLQSQINALVVAPRNNSANEIVQARVNVNGETFDTLKEHLDDWETKTQINKEETIRELNKTKQEILDIEYRFEPDKQEFLFVTELAPLTNAVMQSFWFDNRTGIVYMTQARNNGYMLSRLRPNGQFIDSSLIVGGGHGTHNGYRYIDDELWIYSFILNGNNENTLVRFKYTPNVEISYGKYGMQDVFTGHPEKPYITPVINEKENKILYRIERPRSQWELENSMNYIEIRSLDDVDKNIDKVLHKISIPMRLTNETQPMQGVTFDEKYLYWYTGDSNPNNRNYLTAFDLETGEEAYQVNADYGGTLDSFPGEFAEAEGLQIYYDKDSGKKALMLGVTVGGDGNRTHRIFMIGQRGILEILHSRGVPFIMSDTGGRVKPLPMRPDKLKNLGMLTEPGLYYLYTDHTVQIDDFPLPREWRDAGWFLEVKPPQTGGDVIQILTRNSYARNMMTFERVLSGRTGDISDWNYVPKNSGKWERVPSFITKMSDINIVGMSFYLTTDDTKRFTDFPTERKGVAGWNLYVEASNTGGFVHRLVRNSVTASCEILLKNYDSKTSSGPWTLHEGRIIS
fig|681288.4.peg.1986   Staphylococcus aureus subsp. aureus ED98     MENLYLIKDLGALAGRDYRAKEIQNLQRIEQFALGLTTEFKLHQKAKTIQHFAEQIYY−−−−NGRSQAAVNKSIQSQINALVVAPRNNSANEIVQARVNVNGETFDTLKEHLDDWETKTQNNKEETIRELNKAKQQILDIEYRFEPDKQEFLFVTELAPLTNAVMQSFWFDNRTGIVYMTQARNNGYTLSRLRPNGQFIDSSLIVGGGHGTHNGYRYIDDELWIYSFILNGNNENTLVRFKYTPNVEISYGKYGMQDVFTGHPEKPYITPVINEKENKILYRIERPRSQWELENSMNYIEIRSLDDVDKNIDKVLHKISIPMRLTNETQPMQGVTFDEKYLYWYTGDSNPNNRNYLTAFDLETGEEAYQVNADYGGTLDSFPGEFAEAEGLQIYYDKDSGKKALMLGVTVGGDGNRTHRIFMIGQRGILEILHSRGVPFIMSDTGGRVKPLPMRPDKLTNLGMLTEPGLYYLYTDHTVQIDDFPLPREWRDAGWFLEVKPPQTGGDVIQILTRNSYARNMMTFERVLSGRTGDISDWNYVPKNSGKWERVPSFITKMSDINIVGMSFYLTTDDTKRFTDFPTERKGVAGWNLYVEASNTGGFVHRLVRNSVTASCEILLKNYDSKTSSGPWTLHEGRIIS
fig|1323661.3.peg.1838   Staphylococcus aureus CA-347     MAYGLITSLHSMTGRKIVAQHEYNYRLLDEGMSKLEKMFIYHQKEEIYAHSAKQIKY−−−−LNDSVEDYLTYLNGRFSNMILGHNGDGINEVKDARIDNTGYGHKTLQDRLYHDYSTLDAFTKKVEKAVDEHYKEYRATEYRFEPKEQEPEFITDLSPYTNAVMQSFWVDPRTKIIYMTQARPGNHYMLSRLKPNGQFIDRLLVKNGGHGTHNAYRYIDGELWIYSAVLDSNKNNKFVRFQYRTGEITYGNEMQDVMPNIFNDRYTSAIYNPIENLMIFRREYKASERQAKNSLNFIEVRSADDIDKGIDKVLYQMDIPMEYTSDTQPMQGITYDAGILYWYTGDSNTANPNYLQGFDIKTKELLFKRRIDIGGVNNNFKGDFQEAEGLDMYYDLETGRKALLIGVTIGPGNNRHHSIYSIGQRGVNQFLKNIAPQVSMTDSGGRVKPLPIQ−−NPAYLSDITEVGHYYIYTQDTQNALDFPLPKAFRDAGWFFDVLPGHYNGALRQVLTRNSTGRNMLKFERVIDIFNKKNNGAWNFCPQNAGYWEHIPKSITKLSDLKIVGLDFYITTEESKRFTDFPKDFKGIAGWILEVKSNTPGNTTQVLRRNNFASAHQFFVRNFGTGGNSGWSIIEGKEVE
fig|359786.13.peg.403   Staphylococcus aureus subsp. aureus JH9     MAYGLITSLHSMTGRKIVAQHEYNYRLLDEGMSKLEKMFIYHQKEEIYAHSAKQIKY−−−−LNDSVEDYLTYLNGRFSNMILGHNGDGINEVKDARIDNTGYGHKTLQDRLYHDYSTLDAFTKKVEKAVDEHYKEYRATEYRFEPKEQEPEFITDLSPYTNAVMQSFWVDPRTKIIYMTQARPGNHYMLSRLKPNGQFIDRLLVKNGGHGTHNAYRYIDGELWIYSAVLDSNKNNKFVRFQYRTGEITYGNEMQDVMPNIFNDRYTSAIYNPIENLMIFRREYKASERQAKNSLNFIEVRSADDIDKGIDKVLYQMDIPMEYTSDTQPMQGITYDAGILYWYTGDSNTANPNYLQGFDIKTKELLFKRRIDIGGVNNNFKGDFQEAEGLDMYYDLETGRKALLIGVTIGPGNNRHHSIYSIGQRGVNQFLKNIAPQVSMTDSGGRVKPLPIQ−−NPAYLSDITEVGHYYIYTQDTQNALDFPLPKAFRDAGWFFDVLPGHYNGALRQVLTRNSTGRNMLKFERVIDIFNKKNNGSWNFNPQSAGYWEHIPKSITKLSDLKIVGLDFYITTEESKRFSDFPKDYKGIAGWVLEVKSNTPGNTTQVLRRNNFASAHQFFVRNFGTGGNSGWSIIEGKEVE
fig|553583.3.peg.1939   Staphylococcus aureus A9635     MAYGLITSLHSTTGAKVVAQHEYNYRLLDNGMSKLEKMFIYHQKEEIYAHSAKQIKY−−−−LNDSVEDYLTYLNGRFSNMVLGHNGDGINEVKDARVDNTGYGHKTLQDRLYHDYSTLDAFTKKVEKAVDENYKEYRATEYRFEPKEQEPEFITDLSPYTNAVMQSFWVDPRTKIIYMTQARPGNHYMLSRLKPNGQFIDRLLVKNGGHGTHNAYRYIDGELWIYSAVLDSNKNNKFVRFQYRTGEITYGNEMQDVMPNIFNNRYTSAIYNPIENLMIFRREYKASERQLKNSLNFVEVRSADDIDKGIDKVLYQMDIPMEYTSDTQPMQGITYDAGILYWYTGDSKPANPNYLQGFDIKTKELLFKRRIDIGGVNNNFKGDFQEAEGLDMYYDLETGRKALLIGVTIGPGNNRHHSIYSIGQRGVNQFLKNIAPQVSMTDSGGRVKPLPIQ−−NPAYLSDITEVGHYYIYTQDTQNALDFPLPKAFRDAGWFFDVLPGHYNGALRQVLTRNSTGRNMLKFERVIDIFNKKNNGAWNFCPQNAGYWEHIPKNITKLSDLKIVGLDFYITTEESKRFSDFPKDYKGIAGWVLEVKSNTPGNTTQVLRRNNFASAHQFFVRNFGTGGNSGWSIIEGKEVE
fig|585155.3.peg.2414   Staphylococcus aureus subsp. aureus H19     MAYGLITSLHSTTGAKVVAQHEYNYRLLDNGMSKLEKMFIYHQKEEIYAHSAKQIKY−−−−LNDSVEDYLTYLNGRFSNMVLGHNGDGINEVKDARVDNTGYGHKTLQDRLYHDYSTLDAFTKKVEKAVDENYKEYRATEYRFEPKEQEPEFITDLSPYTNAVMQSFWVDPRTKIIYMTQARPGNHYMLSRLKPNGQFIDRLLVKNGGHGTHNAYRYIDGELWIYSAVLDSNKNNKFVRFQYRTGEITYGNEMQDVMPNIFNNRYTSAIYNPIENLMIFRREYKASERQAKNSLNFIEVRSADDIDKGIDKVLYQMDIPMEYSSLTQPMQGITYDAGILYWYTGDSNTANPNYLQGFDIKTKELLFKRRIDIGGVNNNFKGDFQEAEGLDMYYDLETGRKALLIGVTIGPGNNRHHSIYSIGQRGVNQFLKNIAPQVSMTDSGGRVKPLPIQ−−NPAYLSDITEVGHYYIYTQDTQNALDFPLPKAFRDAGWFFDVLPGHYNGALRQVLTRNSTGRNMLKFERVIDIFNKKNNGSWNFNPQSAGYWEHIPKSITKLSDLKIVGLDFYITTEESKRFSDFPKDYKGIAGWVLEVKSNTPGNTTQVLRRNNFASAHQFFVRNFGTGGNSGWSIIEGKEVE
fig|505321.3.peg.7   Staphylococcus aureus subsp. aureus str. CF-Marseille     MAYGLITSLHSTTGAKVVAQHEYNYRLLDNGMSKLEKMFIYHQKEEIYAHSAKQIKY−−−−LNDSVEDYLTYLNGRFSNMIIGHNGDGINEVKDARVDNTGYDHKTLQDRLYHDYSTLDAFTKKVEKAVDEHYKEYQATEYRFEPKEQEPEFITDLSPYTNAVMQSFWVDPRTKIIYMTQARPGNHYMLSRLKPNGQFIDRLLVKNGGHGTHNAYRYIDGELWIYSAVLDSNKNNKFVRFKYRSGEMTYGNEMQDVMPNVFNDRYTSAIYNPIENLMIFRREYKASERQAKNSLNFVEVRSADDIDKGIDKVLYQMDIPMEYTSDTQPMQGIAYDAGILYWYTGDSNPANPNYLQGFDIKTKELLFKRRIDIGGVNNNFKGDFQEAEGLDMYYDLETGRKALLIGVTIGPGNNRHHSIYSIGQRGVNQFLKNIAPQVSMTDSGGRVKPLPIQ−−NPAYLSDITEVGHYYIYTQDTQNALDFPLPKAFRDAGWFFDVLPGHYNGALRQVLTRNSTGRNMLKFERVIDIFNKKNNGSWNFNPQSAGYWEHIPKSITKLSDLKIVGLDFYITTEESKRFSDFPKDYKGIAGWVLEVKSNTPGNTTQVLRRNNFASAHQFFVRNFGTGGNSGWSIIEGKEVE
fig|931447.3.peg.2530   Staphylococcus aureus subsp. aureus CIG1233     MAYGLITSLHSTTGAKVVAQHEYNYRLLDNGMSKLEKMFIYHQKEEIYAHSAKQIKY−−−−LNDSVEDYLTYLNGRFSNMVLGHNGDGINEVKDARVDNTGYDHKTLQDRLYHDYSTLDAFTKKVEKAADEHYKEYQATEYRFEPKEQEPEFITDLSPYTNAVMQSFWVDPRTKIIYMTQARPGNHYMLSRLKPNGQFIDRLLVKNGGHGTHNAYRYIDGELWIYSAVLDSNKNNKFVRFQYRTGEITYGNEMQDVMPNIFNDRYTSAIYNPVENLMIFRREYKPTERQLKNSLNFVEVRSADDIDKGIDKVLYQMDIPMEYTSDTQPMQGIAYDAGILYWYTGDSNPANPNYLQGFDIKTKELLFKRRIDIGGVNNNFKGDFQEAEGLDMYYDLETGRKALLIGVTIGPGNNRHHSIYSIGQRGVNQFLKNIAPQVSMTDSGGRVKPLPIQ−−NPVYLSDITEVGHYYIYTQDTQNALDFPLPKAFRDAGWFFDVLPGHYNGALRQVLTRNSTGRNMLKFERVIDIFNKKNNGAWNFCPQNAGYWEHIPKSITKLSDLKIVGLDFYITTEESKRFTDFPKDFKGIAGWILEVKSNTPGNTTQVLRRNNFASAHQFFVRNFGTGGNSGWSIIEGKVVE
fig|450394.6.peg.95   Staphylococcus aureus subsp. aureus USA300_TCH959     MAYGLITSLHSMTGRKIVAQHEYNYRLLDEGMSKLEKMFIYHQKEEIYAHSAKQIKY−−−−LNDSVEDYLTYLNGRFSNMILGHNGDGINEVKDARIDNTGYGHKTLQDRLYHDYSTLDAFTKKVEKAVDEHYKEYQATEYRFEPKEQEPEFITDLSPYTNAVMQSFWVDPRTKIIYMTQARPGNHYMLSRLKPNGQFIDRLLVKNGGHGTHNAYRYIDGELWIYSAVLDSNKNNKFVRFQYRTGEITYGNEMQDVMPNIFNDRYTSAIYNPVENLMIFRREYKPTERQLKNSLNFVEVRSADDIDKGIDKVLYQMDIPMEYTSDTQPMQGITYDAGILYWYTGDSKPANPNYLQSFDIKTKELLFKRRIDIGGVNNNFKGDFQEAEGLDMYYDLETGRKALLIGVTIGPGNNRHHSIYSIGQRGVNQSLKNIAPQVSMTDSGGRVKPLPIQ−−NPAYLSDITEVGYYYIYTQDTQNALDFPLPKAFRDAGWFFDVLPGHYNGALRQVLTRNSTGRNMLKFERVIDIFNKKNNGAWNFCPQNAGYWEHIPKSITKLSDLKIVGLDFYITTEESKRFTDFPKDFKGIAGWILEVKSNTPGNTTQVLRRNNFPSAHQFLVRNFGTGGVGKWSLFEGKVVE
fig|585153.3.peg.2195   Staphylococcus aureus subsp. aureus E1410     MAYGLITSLHSMTGRKIVAQHEYNYRLLDEGMSKLEKMFIYHQKEEIYAHSAKQIKY−−−−LNDSVEDYLTYLNGRFSNMILGHNGDGINEVKDARIDNTGYGHKTLQDRLYHDYSTLDAFTKKVEKAVDEHYKEYRATEYRFEPKEQEPEFITDLSPYTNAVMQSFWVDPRTKIIYMTQARPGNHYMLSRLKPNGQFIDRLLVKNGGHGTHNAYRYIDGELWIYSAVLDSNKNNKFVRFQYRTGEITYGNEMQDVMPNIFNDRYTSAIYNPVENLMIFRREYKPTERQLKNSLNFVEVRSADDIDKGIDKVLYQMDIPMEYTSDTQPMQGITYDAGILYWYTGDSNTANPNYLQGFDIKTKELLFKRRIDIGGVNNNFKGDFQEAEGLDMYYDLETGRKALLIGVTIGPGNNRHHSIYSIGQRGVNQFLKNIAPQVSMTDSGGRVKPLPIQ−−NPAYLSDITEVGHYYIYTQDTQNALDFPLPKAFRDAGWFFDVLPGHYNGALRQVLTRNSTGRNMLKFERVIDIFNKKNNGAWNFCPQNAGYWEHIPKSITKLSDLKIVGLDFYITTEESKRFTDFPKDFKGIAGWILEVKSNTPGNTTQVLRRNNFPSAHQFLVRNFGTGGVGKWSLFEGKVVE
fig|644279.4.peg.1304   Staphylococcus aureus subsp. aureus 132     MAYGLITSLHSMTGRKIVAQHEYNYRLLDEGMSKLEKMFIYHQKEEIYAHSAKQIKY−−−−LNDSVEDYLTYLNGRFSNMILGHNGDGINEVKDARIDNTGYGHKTLQDRLYHDYSTLDAFTKKVEKAVDEHYKEYQATEYRFEPKEQEPEFITDLSPYTNAVMQSFWVDPRTKIIYMTQARPGNHYMLSRLKPNGQFIDRLLVKNGGHGTHNAYRYIDGELWIYSAVLDSNKNNKFVRFKYRSGEMTYGNEMQDVMPNVFNDRYTSAIYNPIENLMIFRREYKASERQAKNSLNFVEVRSADDIDKGIDKVLYQMDIPMEYTSDTQPMQGITYDAGILYWYTGDSNTANPNYLQGFDIKTKELLFKRRIDIGGVNNNFKGDFQEAEGLDMYYDLETGRKALLIGVTIGPGNNRHHSIYSIGQRGVNQFLKNIAPQVSMTDSGGRVKPLPIQ−−NPAYLSDITEVGHYYIYTQDTQNALDFPLPKAFRDAGWFFDVLPGHYNGALRQVLTRNSTGRNMLKFERVIDIFNKKNNGAWNFCPQNAGYWEHIPKNITKLSDLKIVGLDFYITTEESKRFTDFPKDFKGIAGWILEVKSNTPGNTTQVLRRNNFPSAHQFLVRNFGTGGVGKWSLFEGKVVE
fig|546342.3.peg.717   Staphylococcus aureus subsp. aureus str. JKD6008     MAYGLITSLHSMTGRKIVAQHEYNYRLLDEGMSKLEKMFIYHQKEEIYAHSAKQIKY−−−−LNDSVEDYLTYLNGRFSNMILGHNGDGINEVKDARIDNTGYGHKTLQDRLYHDYSTLDAFTKKVEKAVDEHYKEYRATEYRFEPKEQEPEFITDLSPYTNAVMQSFWVDPRTKIIYMTQARPGNHYMLSRLKPNGQFIDRLLVKNGGHGTHNAYRYIDGELWIYSAVLDSNKNNKFVRFQYRTGEITYGNEMQDVMPNIFNDRYTSAIYNPVENLMIFRREYKPTERQLKNSLNFVEVRSADDIDKGIDKVLYQMDIPMEYTSDTQPMQGITYDAGILYWYTGDSNTANPNYLQGFDIKTKELLFKRRIDIGGVNNNFKGDFQEAEGLDMYYDLETGRKALLIGVTIGPGNNRHHSIYSIGQRGVNQFLKNIAPQVSMTDSGGRVKPLPIQ−−NPAYLSDITEVGHYYIYTQDTQNALDFPLPKAFRDAGWFFDVLPGRYNGALRQVLTRNSTGRNMLKFERVIDIFNKKNNGAWNFCPQNAGYWEHIPKNITKLSDLKIVGLDFYITTEESKRFTDFPKDFKGIAGWILEVKSNTPGNTTQVLRRNNFPSAHQFLVRNFGTGGVGKWSLFEGKVVE
fig|426430.6.peg.307   Staphylococcus aureus subsp. aureus str. Newman     MAYGLITSLHSMTGRKIVAQHEYNYRLLDEGMSKLEKMFIYHQKEEIYAHSAKQIKY−−−−LNDSVEDYLTYLNGRFSNMILGHNGDGINEVKDARIDNTGYGHKTLQDRLYHDYSTLDAFTKKVEKAVDEHYKEYRATEYRFEPKEQEPEFITDLSPYTNAVMQSFWVDPRTKIIYMTQARPGNHYMLSRLKPNGQFIDRLLVKNGGHGTHNAYRYIDGELWIYSAVLDSNKNNKFVRFQYRTGEITYGNEMQDVMPNIFNDRYTSAIYNPVENLMIFRREYKPTERQLKNSLNFVEVRSADDIDKGIDKVLYQMDIPMEYTSDTQPMQGITYDAGILYWYTGDSNTANPNYLQGFDIKTKELLFKRRIDIGGVNNNFKGDFQEAEGLDMYYDLETGRKALLIGVTIGPGNNRHHSIYSIGQRGVNQFLKNIAPQVSMTDSGGRVKPLPIQ−−NPAYLSDITEVGHYYIYTQDTQNALDFPLPKAFRDAGWFFDVLPGHYNGALRQVLTRNSTGRNMLKFERVIDIFNKKNNGAWNFCPQNAGYWEHIPKNITKLSDLKIVGLDFYITTEESKRFTDFPKDFKGIAGWILEVKSNTPGNTTQVLRRNNFPSAHQFLVRNFGTGGVGKWSLFEGKVVE
fig|452948.4.peg.2172   Staphylococcus aureus 930918-3     MAYGLITSLHSMTGRKIVAQHEYNYRLLDEGMSKLEKMFIYHQKEEIYAHSAKQIKY−−−−LNDSVEDYLTYLNGRFSNMILGHNGDGINEVKDARIDNTGYGHKTLQDRLYHDYSTLDAFTKKVEKAVDEHYKEYRATEYRFEPKEQEPEFITDLSPYTNAVMQSFWVDPRTKIIYMTQARPGNHYMLSRLKPNGQFIDRLLVKNGGHGTHNAYRYIDGELWIYSAVLDSNKNNKFVRFQYRTGEITYGNEMQDVMPNIFNDRYTSAIYNPVENLMIFRREYKPTERQLKNSLNFVEVRSADDIDKGIDKVLYQMDIPMEYTSDTQPMQGITYDAGILYWYTGDSNTANPNYLQGFDIKTKELLFKRRIDIGGVNNNFKGDFQEAEGLDMYYDLETGRKALLIGVTIGPGNNRHHSIYSIGQRGVNQFLKNIAPQVSMTDSGGRVKPLPIQ−−NPAYLSDITEVGHYYIYTQDTQNALDFPLPKAFRDAGWFFDVLPGHYNGALRQVLTRNSTGRNMLKFERVIDIFNKKNNGAWNFCPQNAGYWEHIPKNITKLSDLKIVGLDFYITTEESKRFTDFPKDFKGIAGWILEVKSNTPGNTTQVLRRNNFPSAHQFLVRNFGTGGVGKWSLFEGKVVE
fig|426430.6.peg.1004   Staphylococcus aureus subsp. aureus str. Newman     MSNKLITDLSRVFDYRYVDENEYNFKLISDMLSDFNFSLEYHRNKEGFAHDGEQIKYEHLNVTSSVSDFLTYLNGRFSNMVLGHNGDGINEVKDARVDNTGYGHKTLQDRLYHDYSTLDAFTKKVEKAVDEHYKEYRATEYRFEPKEQEPEFITDLSPYTNAVMQSFWVDPRTKIIYMTQARPGNHYMLSRLKPNGQFIDRLLVKNGGHGTHNAYRYIDGELWIYSAVLDSNKNNKFVRFQYRTGEITYGNEMQDVMPNIFNDRYTSAIYNPVENLMIFRREYKPTERQLKNSLNFVEVRSADDIDKGIDKVLYQMDIPMEYTSDTQPMQGITYDAGILYWYTGDSNTANPNYLQGFDIKTKELLFKRRIDIGGVNNNFKGDFQEAEGLDMYYDLETGRKALLIGVTIGPGNNRHHSIYSIGQRGVNQFLKNIAPQVSMTDSGGRVKPLPIQ−−NPAYLSDITEVGHYYIYTQDTQNALDFPLPKAFRDAGWFLDVLPGHYNGALRQVLTRNSTGRNMLKFERVIDIFNKKNNGAWNFCPQNAGYWEHIPKSITKLSDLKIVGLDFYITTEESKRFTDFPKDLKGIAGWILEVKSNTPGNTTQVLRRNNFPSAHQFLVRNFGTGGVGKWSLFEGKVVE
fig|93061.5.peg.1841   Staphylococcus aureus subsp. aureus NCTC 8325     MSNKLITDLSRVFDYRYVDENEYNFKLISDMLTDFNFSLEYHRNKEVFAHDGEQIKYEHLNVTSNVSDFLTYLNGRFSNMVLGHNGDGINEVKDARVDNTGYGHKTLQDRLYHDYSTLDVFTKKVEKAVDEHYKEYRATEYRFEPKEQEPEFITDLSPYTNAVMQSFWVDPRTKIIYMTQARPGNHYMLSRLKPNGQFIDRLLVKNGGHGTHNAYRYIDGELWIYSAVLDSNKNNKFVRFQYRTGEITYGNEMQDVMPNIFNDRYTSAIYNPVENLMIFRREYKPTERQLKNSLNFVEVRSADDIDKGIDKVLYQMDIPMEYTSDTQPMQGITYDAGILYWYTGDSNTANPNYLQGFDIKTKELLFKRRIDIGGVNNNFKGDFQEAEGLDMYYDLETGRKALLIGVTIGPGNNRHHSIYSIGQRGVNQFLKNIAPQVSMTDSGGRVKPLPIQ−−NPAYLSDITEVGHYYIYTQDTQNALDFPLPKAFRDAGWFLDVLPGHYNGALRQVLTRNSTGRNMLKFERVIDIFNKKNNGAWNFCPQNAGYWEHIPKSITKLSDLKIVGLDFYITTEESNRFTDFPKDFKGIAGWILEVKSNTPGNTTQVLRRNNFPSAHQFLVRNFGTGGVGKWSLFEGKVVE
fig|931450.3.peg.1448   Staphylococcus aureus subsp. aureus CIG2018     MDNKLITDLSRVFDYRYVDENEYNFKLISDMLTDFNFSLEYHRNKEVFAHNGEQIKYEHLNVTSSVSDFLTYLNGRFSNMVLGHNGDGINEVKDARVDNTGYGHKTLQDRLYHDYSTLDAFTKKVEKAVDEHYKEYRATEYRFEPKEQEPEFITDLSPYTNAVMQSFWVDPRTKIIYMTQARPGNHYMLSRLKPNGQFIDRLLVKNGGHGTHNAYRYIDGELWIYSAVLDSNKNNKFVRFQYRTGEITYGNEMQDVMPNIFNDRYTSAIYNPVENLMIFRREYKPTERQLKNSLNFVEVRSADDIDKGIDKVLYQMDIPMEYTSDTQPMQGITYDAGILYWYTGDSNTANPNYLQGFDIKTKELLFKRRIDIGGVNNNFKGDFQEAEGLDMYYDLETGRKALLIGVTIGPGNNRHHSIYSIGQRGVNQFLKNIAPQVSMTDSGGRVKPLPIQ−−NPAYLSDITEVGHYYIYTQDTQNALDFPLPKAFRDAGWFFDVLPGHYNGALRQVLTRNSTGRNMLKFERVIDIFNKKNNGAWNFCPQNAGYWEHIPKSITKLSDLKIVGLDFYITTEESNRFTDFPKDFKGIAGWILEVKSNTPGNTTQVLRRNNFPSAHQFLVRNFGTGGVGKWSLFEGKVVE
fig|904739.3.peg.2342   Staphylococcus aureus subsp. aureus 21236     MDNKLITDLSRVFDYRYVDENEYNFKLISDMLTDFNFSLEYHRNKEVFAHNGEQIKYEHLNVTSSVSDFLTYLNGRFSNMVLGHNGDGINEVKDARVDNTGYDHKTLQDRLYHDYSTLDAFTKKVEKAVDENYKEYRATEYRFEPKEQEPEFITDLSPYTNAVMQSFWVDPRTKIIYMTQARPGNHYMLSRLKPNGQFIDRLLVKNGGHGTHNAYRYIGNELWIYSAVLDSNKNNKFVRFQYRTGEITYGNEMQDVMPNIFNDRYTSAIYNPVENLMIFRREYKPTERQLKNSLNFVEVRSADDIDKGIDKVLYQMDIPMEYTSDTQPMQGITYDAGILYWYTGDSNTANPNYLQGFDIKTKELLFKRRIDIGGVNNNFKGDFQEAEGLDMYYDLETGRKALLIGVTIGPGNNRHHSIYSIGQRGVNQFLKNIAPQVSMTDSGGRVKPLPIQ−−NPAYLSDITEVGHYYIYTQDTQNALDFPLPKAFRDAGWFFDVLPGHYNGALRQVLTRNSTGRNMLKFERVIDIFNKKNNGAWNFCPQNAGYWEHIPKSITKLSDLKIVGLDFYITTEESNRFTDFPKDFKGIAGWILEVKSNTPGNTTQVLRRNNFPSAHQFLVRNFGTGGVGKWSLFEGKVVE
fig|553581.3.peg.256   Staphylococcus aureus A9299     MDNKLITDLSRVFDYRYVDENEYNFKLISDMLTDFNFSLEYHRNKEVFAHNGEQIKYEHLNVTSSVSDFLTYLNGRFSNMVLGHNGDGINEVKDARVDNTGYDHKTLQDRLYHDYSTLDAFTKKVEKAVDEHYKEYQATEYRFEPKEQEPEFITDLSPYTNAVMQSFWVDPRTKIIYMTQARPGNHYMLSRLKPNGQFIDRLLVKNGGHGTHNAYRYIGNELWIYSAVLDSNKNNKFVRFQYRTGEITYGNEMQDVMPNIFNDRYTSAIYNPVENLMIFRREYKPTERQLKNSLNFVEVRSADDIDKGIDKVLYQMDIPMEYTSDTQPMQGITYDAGILYWYTGDSNTANPNYLQGFDIKTKELLFKRRIDIGGVNNNFKGDFQEAEGLDMYYDLETGRKALLIGVTIGPGNNRHHSIYSIGQRGVNQFLKNIAPQVSMTDSGGRVKPLPIQ−−NPAYLSDITEVGHYYIYTQDTQNALDFPLPKAFRDAGWFFDVLPGHYNGALRQVLTRNSTGRNMLKFERVIDIFNKKNNGAWNFCPQNAGYWEYIPKNITKLSDLKIVGLDFYITTEESKRFTDFPKDFKGIAGWILEVKSNTPGNTTQVLRRNNFPSAHQFLVRNFGTGGVGKWSLFEGKVVE
fig|585152.3.peg.1786   Staphylococcus aureus subsp. aureus D139     MDNKLITDLSRVFDYRYVDENEYNFKLISDMLTDFNFSLEYHRNKEVFAHNGEQIKYEHLNVTSSVSDFLTYLNGRFSNMVLGHNGDGINEVKDARVDNAGYDHKTLQDRLYHDYSTLDAFTKKVEKAVDENYKEYRATEYRFEPKEQEPEFITDLSPYTNAVMQSFWVDPRTKIIYMTQARPGNHYMLSRLKPNGQFIDRLLVKNGGHGTHNAYRYIDGELWIYSAVLDSNKNNKFVRFQYRTGEITYGNEMQDVMPNIFNDRYTSAIYNPVENLMIFRREYKPTERQLKNSLNFVEVRSADDIDKGIDKVLYQMDIPMEYTSDTQPMQGITYDAGILYWYTGDSNTANPNYLQGFDIKTKELLFKRRIDIGGVNNNFKGDFQEAEGLDMYYDLETGRKALLIGVTIGPGNNRHHSIYSIGQRGVNQFLKNIAPQVSMTDSGGRVKPLPIQ−−NPAYLSDITEVGHYYIYTQDTQNALDFPLPKAFRDAGWFFDVLPGHYNGALRQVLTRNSTGRNMLKFERVIDIFNKKNNGAWNFCPQNAGYWEHIPKNITKLSDLKIVGLDFYITTEESKRFTDFPKDLKGIAGWILEVKSNTPGNTTQVLRRNNFPSAHQFLVRNFGTGGVGKWSLFEGKVVE
fig|359786.13.peg.972   Staphylococcus aureus subsp. aureus JH9     MDNKLIIDLSRVFDYRYVDENEYNFKLISDMLTDFNFSLEYHRNKEVFAHNGEQIKYEHLNVTSSVSDFLTYLNGRFSNMVLGHNGDGINEVKDARVDNTGYDHKTLQDRLYHDYSTLDAFTKKVEKAVDEHYKEYQATEYRFEPKEQEPEFITDLSPYTNAVMQSFWVDPRTKIIYMTQARPGNHYMLSRLKPNGQFIDRLLVKNGGHGTHNAYRYIGNELWIYSAVLDANNNNKFVRFKYRSGEMTYGNEMQDVMPNVFNDRYTSAIYNPIENLMVFRREYKTSEQQAKNALNFVEVRSADDIDKGIDKVLYQMDIPMQYTSGTQPMQGIAYDAGILYWYTGDSNPANPNYLQGFDIKTKELLFKRRIDIGGVNNNFKGDFQEAEGLDMYYDLETGRKALLIGVTIGPGNNRHHSIYSIGQRGVNQFLKNIAPQVSMTDSGGRVKPLPVQ−−NPAYLSDITEVGHYYIYTQDTQNALDFPLPKAFRDAGWFFDVLPGHYNGALRQVLTRNSTGRNMLKFERVIDIFNKKNNGSWNFNPQSAGYWEHIPKSITKLSDLKIVGLDFYITTEESNRFTDFPKDFKGIAGWILEVKSNTPGNTTQVLRRNNFPSAHQFLVRNFGTGGVGKWSLFEGKVVE
fig|553577.3.peg.2897   Staphylococcus aureus A8796                                                                                     MVLGHNGDGINEVKDARVDNTGYDHKTLQDRLYHDYSTLDAFTKKVEKAVDEHYKEYQATEYRFEPKEQEPEFITDLSPYTNAVMQSFWVDPRTKIIYMTQARPGNHYMLSRLKPNGQFIDRLLVKNGGHGTHNAYRYIGNELWIYSAVLDANNNNKFVRFKYRSGEMTYGNEMQDVMPNVFNDRYTSAIYNPIENLMVFRREYKTSEQQAKNALNFVEVRSADDIDKGIDKVLYQMDIPMQYTSGTQPMQGIAYDAGILYWYTGDSNPANPNYLQGFDIKTKELLFKRRIDIGGVNNNFKGDFQEAEGLDMYYDLETGRKALLIGVTIGPGNNRHHSIYSIGQRGVNQFLKNIAPQVSMTDSGGRVKPLPVQ−−NPAYLSDITEVGHYYIYTQDTQNALDFPLPKAFRDAGWFFDVLPGHYNGALRQVLTRNSTGRNMLKFERVIDIFNKKNNGSWNFNPQSAGYWEHIPKSITKLSDLKIVGLDFYITTEESNRFTDFPKDFKGIAGWILEVKSNTPGNTTQVLRRNNFPSAHQFLVRNFGTGGVGKWSLFEGKVVE
fig|418127.4.peg.830   Staphylococcus aureus subsp. aureus Mu3     MDNKLITDLSRVFDYRYVDENEYNFKLISDMLTDFNFSLEYHRNKEVFAHNGEQIKYEHLNVTSSVSDFLTYLNGRFSNMVLGHNGDGINEVKDARVDNTGYDHKTLQDRLYHDYSTLDAFTKKVEKAVDENYKEYRATEYRFEPKEQEPEFITDLSPYTNAVMQSFWVDPRTKIIYMTQARPGNHYMLSRLKPNGQFIDRLLVKNGGHGTHNAYRYIDGELWIYSAVLDSNKNNKFVRFQYRTGEITYGNEMQDVMPNIFNDRYTSAIYNPIENLMIFRREYKASERQAKNSLNFIEVRSADDIDKGIDKVLYQMDIPMEYTSDTQPMQGITYDAGILYWYTGDSNTANPNYLQGFDIKTKELLFKRRIDIGGVNNNFKGDFQEAEGLDMYYDLETGRKALLIGVTIGPGNNRHHSIYSIGQRGVNQFLKNIAPQVSMTDSGGRVKPLPIQ−−NPAYLSDITEVGHYYIYTQDTQNALDFPLPKAFRDAGWFFDVLPGHYNGALRQVLTRNSTGRNMLKFERVIDIFNKKNNGAWNFCPQNAGYWEHIPKSITKLSDLKIVGLDFYITTEESNRFTDFPKDFKGIAGWILEVKSNTPGNTTQVLRRNNFPSAHQFLVRNFGTGGVGKWSLFEGKVVE
fig|426430.6.peg.1720   Staphylococcus aureus subsp. aureus str. Newman     MDNKLITDLSRV