(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00010996

fig|572264.4.peg.1767   Bacillus cereus 03BB102                                                                      SDEMLATLFNR−−−−−−−−−PIATVRLALQTFQQFGMIEI−−−−−−−−−−−−−−−−−−TEDQ−−−YICISNW−−EKHQNV−−−−−−−−−−−−−−−−−−DGLEKIREQNRLRKQKQREKLKLEM−−−−−−−−−−−−−−−−−−−−−SRDGH−−−−−−−ETITRSHATDIEED−−−−−−−KELDIDKEKD−−−KK−−−KKQKPSRHKFETCDTNGAKYLFEKIKGNNPKQKEP−−−NFDSWAND−−−−−−−−−−−−−−−−−−FRLMRE−−KDNRE−−−SKEIKDVIDWCQADPFWQGNILSPKKLREKFDQLTIQMNSKKGAKN                                                          
fig|526985.3.peg.90   Bacillus cereus Rock3-42                                                                      SDEMLATLFNR−−−−−−−−−PIATVRLALQTFQQFGMIEI−−−−−−−−−−−−−−−−−−TEDQ−−−YICISNW−−EKHQNV−−−−−−−−−−−−−−−−−−DGLEKIREQNRLRKQKQREKLKLEM−−−−−−−−−−−−−−−−−−−−−SRDGH−−−−−−−ETITRSHATDIEED−−−−−−−KELDIDKEKD−−−KK−−−KKEKPSRHKFETCDTNGAKYLFEKIKGNNPKQKEP−−−NFDSWAND−−−−−−−−−−−−−−−−−−FRLMRE−−KDNRE−−−LKEIKDVIDWCQADPFWQGNILSPKKLREKFDQLTIQMNSKKGVKN                                                          
fig|526974.3.peg.1013   Bacillus cereus BDRD-ST24                                                                     FTEEMLSTLFNR−−−−−−−−−PIATVRLALQTFKQFGMIDI−−−−−−−−−−−−−−−−−−TDDQ−−−YICISNW−−EKHQNV−−−−−−−−−−−−−−−−−−DGLEKIREQNRLRKQKQREKLRLDM−−−−−−−−−−−−−−−−−−−−−SRDSH−−−−−−−GTVTQSHATDIEED−−−−−−−KEID−−−−−−−−−KE−−−KNKKPSCQKFSTSDLENAKLLFELMLQNNPSAKEP−−−NLEKWAND−−−−−−−−−−−−−−−−−−FRLMRE−−RDNRT−−−GEAIKYLINWTQKDDFWSANILSPAKLRKQFDALVVKIKKEKAKTQPKVVKGKKEVREEDFD                                          
fig|1169245.3.peg.2065   Enterococcus faecalis A-2-1        WIKLSTSLPDNKKIKRIRKLPDGDRVILFWVFLLARAGESNQKGG−−−−−−−−LFLTDTLPYSDEDLAADFDF−−−−−−−−−TVEFVKFAILTLEKYSMVTTYE−−−−−−−−−−−−−−−−−−D−−−VIFIKNW−−EEYQAI−−−−−−−−−−−−−−−−−−DGMEKVKEQNRIRQAKYREKQKQLS−−−−−−−−−−−−−−−LSNVTSNVTRN−−−−−−−ADVTLSNGTDKDID−−−−−−−KEIDKEIDKDNKEES−−−KKPPCKYSDEH−−−LRLAQKLQNNLINDFPSEMKKV−−−KIEKWADV−−−−−−−−−−−−−−−−−−FRLIEE−−RDQQT−−−IAAIDYVLDWLPTNSFWFGNIRSASKLRTQFEKLKFEIKNEKERGQQRTTYQRQNVRTENLPEWAKEPNKQQEEK−−−−−LSPEEQLELDRQ           
fig|431943.8.peg.3398   Clostridium kluyveri DSM 555        WIKITTTMFDDEKIKLIDAMPERDTIFYIWMRLLVQAGKTNAGGY−−−−−−−−IFLTEDIPYTDEMLSAIFNR−−−−−−−−−PLNTVRLALDTLKKFGMIQR−−−−−−−−−−−−−−−−−−SENN−−−DLKITNW−−DKHQNV−−−−−−−−−−−−−−−−−−ESMDKIREGNRLRKRRQREKEKQQE−−−−−−−−−−−LLEEPKNSEENVTEG−−−−−−−EEIVMSQDSHEMSRDSHAIREREREEDLDLDNKRER−−−REKKDLSLDNNA−−LELCKYWEVLKPGENITAHLA−−−ALKIFINT−−−−−−−−−YGYDWCKEAMQIMVKNKNKFI−−−LSYMEKILKNWLVEG−−−−−−−−−−−−−−−−KSEECGTSKKEKNAPKPPSYK                                                      
fig|431943.8.peg.1972   Clostridium kluyveri DSM 555        WIKISTAMFDDEKIKIIDAMPEHDTIFYIWMRLLVQAGKTNAGGY−−−−−−−−IFLAEDIPYTDEMLSAIFNR−−−−−−−−−PLNTVRLALDTLKKFGMIQR−−−−−−−−−−−−−−−−−−SENN−−−DLKITNW−−DKHQNV−−−−−−−−−−−−−−−−−−ESMDKIREGNRLRKRRQREKEKQQE−−−−−−−−−−−LLEEPKNSEENVTEG−−−−−−−EEIVMSQDSHEMSRDSHAIREREREEDLDLDNKRER−−−REKKDLSLDNNA−−LELCKYWEVLKPGENITAHLA−−−ALKIFINT−−−−−−−−−YGYDWCKEAMQIMVKNKNKFI−−−LSYMEKILKNWLVEG−−−−−−−−−−−−−−−−KSEECGTSKKEKNAPKPPSYK                                                      
fig|431943.8.peg.2078   Clostridium kluyveri DSM 555        WIKISTAMFDDEKIKIIDAMPEHDTIFYIWMRLLVQAGKTNAGGY−−−−−−−−IFLAEDIPYTDEMLSAIFNR−−−−−−−−−PLNTVRLALDTLKKFGMIQR−−−−−−−−−−−−−−−−−−SENN−−−DLKITNW−−DKHQNV−−−−−−−−−−−−−−−−−−ESMDKIREGNRLRKRRQREKEKQQE−−−−−−−−−−−LLEEPKNSEENVTEG−−−−−−−EEIVMSQDSHEMSRDSHAIREREREEDLDLDNKRER−−−REKKDLSLDNNA−−LELCKYWEVLKPGENITAHLA−−−ALKIFINT−−−−−−−−−YGYDWCKEAMQIMVKNKNKFI−−−LSYMEKILKNWLVEG−−−−−−−−−−−−−−−−KSEECGTSKKEKNAPKPPSYK                                                      
fig|487214.5.peg.31   Streptococcus pneumoniae Hungary19A-6        WIKIKTDIFDDEKMCLIDASPDRDAIIVIWIKLITLAGKLNTKGV−−−−−−−−LTISKNIVYTDEMLAQTFHR−−−−−−−−−PLNTVRMALEVFEKFGMVEKID−−−−−−−−−−−−−−−−−−G−−−VIMLPNW−−EKHQNI−−−−−−−−−−−−−−−−−−DGMEKIKEQNRNRAARHRQKQKLLA−−−−−−−−−−−−QNNESNVTDNVMDN−−−−−−−VTVTHGNALDKELD−−−−−−−KELDKDIEINN−−NKVMISSSLSENLKNSGIHLT−−−−−−−−−−−−−−DKSHQ−−−QLLDYVGL−−−−−−−DGMSFDMLNRAVEKTSG−−SHKPS−−−FNYLIAILESWKKKGFTSIEQVDEDDRKYKEGKKSRQQNDK−−−−−−−−−−−−−−TSEQEVRDEW                                        
fig|1159102.3.peg.1760   Streptococcus pneumoniae PNI0446        WIKIKTDIFDDEKMCLIDASPDRDAIIVIWIKLITLAGKLNTKGV−−−−−−−−LTISKNIVYTDEMLAQTFHR−−−−−−−−−PLNTVRMALEVFEKFGMVEKID−−−−−−−−−−−−−−−−−−G−−−VIMLPNW−−EKHQNI−−−−−−−−−−−−−−−−−−DGMEKIKEQNRNRAARHRQKQKLLA−−−−−−−−−−−−QNNESNVTDNVMDN−−−−−−−VTVTHGNA−−−−LD−−−−−−−KELDKDIEINN−−NKVMISSSLSENLKNSGIHLT−−−−−−−−−−−−−−DKSHQ−−−QLLDYVGL−−−−−−−DGMSFDMLNRAVEKTSG−−SHKPS−−−FNYLIAILESWKKKGFTSIEQVDEDDRKYKEGKKSRQQNDK−−−−−−−−−−−−−−TSEQEVRDEW                                        
fig|760818.3.peg.325   Streptococcus pneumoniae GA43265        WIKIKTDIFDDEKMCLIDASPDRDAIIVIWIKLITLAGKLNTKGV−−−−−−−−LTISKNIVYTDEMLAQTFHR−−−−−−−−−PLNTVRMALEVFEKFGMVEKID−−−−−−−−−−−−−−−−−−G−−−VIMLPNW−−EKHQNI−−−−−−−−−−−−−−−−−−DGMEKIKEQNRNRAARHRQKQKLLA−−−−−−−−−−−−QNNESNVTDNVMDN−−−−−−−VTVTHGNA−−−−LD−−−−−−−KELDKDIEINN−−NKVMISSSLSENLKNSGIHLT−−−−−−−−−−−−−−DKSHQ−−−QLLDYVGL−−−−−−−DGMSFDMLNRAVEKTSG−−SHKPS−−−FNYLIAILESWKKKGFTSIEQVDEDDRKYKEGKKSRQQNDK−−−−−−−−−−−−−−TSEQEVRDEW                                        
fig|453363.3.peg.2044   Streptococcus pneumoniae SP195                                                                    HYTDEMLATIFRR−−−−−−−−−PLNTVRMAIGVFEQFGMIEIID−−−−−−−−−−−−−−−−−−G−−−IISLPNW−−EKHQNV−−−−−−−−−−−−−−−−−−DGMEKIKEQTRNRVAKYRKKQKNLA−−−−−−−−−−−−−−−−−−−LGNVTGN−−−−−−−VTVTDGNALEEDKD−−KNRLDKDKNKKRITTTSSGS−−−EENILELFQSEFRRLLS−−−−−−−−−−−−−GFEIE−−−EINHLLNE−−−−−−−−−NDVDLVKEALKTAIN−−SGKPN−−−IKYIGGILRNWQMNNVTTVEQVRQS                                                                                 
fig|1239787.3.peg.2151   Streptococcus pneumoniae 3051                                                                    HYTDEMLATIFRR−−−−−−−−−PLNTVRMAIGVFEQFGMIEIID−−−−−−−−−−−−−−−−−−G−−−IISLPNW−−EKHQNV−−−−−−−−−−−−−−−−−−DGMEKIKEQTRNRVAKYRKKQKNLA−−−−−−−−−−−−−−−−−−−LGNVTGN−−−−−−−VTVTDGNALEEDKD−−KNRLDKDKNKKRITTTSSGS−−−EENILELFQSEFRRLLS−−−−−−−−−−−−−GFEIE−−−EINHLLNE−−−−−−−−−NDVDLVKEALKTAIN−−SGKPN−−−IKYIGGILRNWQMNNVTTVEQVRQS                                                                                 
fig|453363.4.peg.2101   Streptococcus pneumoniae SP195                                                                    HYTDEMLATIFRR−−−−−−−−−PLNTVRMAIGVFEQFGMIEIID−−−−−−−−−−−−−−−−−−G−−−IISLPNW−−EKHQNV−−−−−−−−−−−−−−−−−−DGMEKIKEQTRNRVAKYRKKQKNLA−−−−−−−−−−−−−−−−−−−LGNVTGN−−−−−−−VTVTDGNALEEDKD−−KNRLDKDKNKKRITTTSSGS−−−EENILELFQSEFRRLLS−−−−−−−−−−−−−GFEIE−−−EINHLLNE−−−−−−−−−NDVDLVKEALKTAIN−−SGKPN−−−IKYIGGILRNWQMNNVTTVEQVRQS                                                                                 
fig|406559.5.peg.2191   Streptococcus pneumoniae SP11-BS70                                                                    HYTDEMLATIFRR−−−−−−−−−PLNTVRMAIGVFEQFGMIEIID−−−−−−−−−−−−−−−−−−G−−−IISLPNW−−EKHQNV−−−−−−−−−−−−−−−−−−DGMEKIKEQTRNRVAKYRKKQKNLA−−−−−−−−−−−−−−−−−−−LGNVTGN−−−−−−−VTVTDGNALEEDKDKNKNRLDKDKNKKRITTTSSGS−−−EENILELFQSEFRRLLS−−−−−−−−−−−−−GFEIE−−−EINHLLNE−−−−−−−−−NDVDLVKEALKTAIN−−SGKPN−−−IKYIGGILRNWQMNNVTTVEQVRQS                                                                                 
fig|914144.3.peg.2152   Streptococcus pneumoniae 2080076                                                                    HYTDEMLATIFRR−−−−−−−−−PLNTVRMAIGVFEQFGMIEIID−−−−−−−−−−−−−−−−−−G−−−IISLPNW−−EKHQNV−−−−−−−−−−−−−−−−−−DGMEKIKEQTRNRVAKYRKKQKNLA−−−−−−−−−−−−−−−−−−−LGNVTGN−−−−−−−VTVTDGNALEEDKDKNKNRLDKDKNKKRITTTSSGS−−−EENILELFQSEFRRLLS−−−−−−−−−−−−−GFEIE−−−EINHLLNE−−−−−−−−−NDVDLVKEALKTAIN−−SGKPN−−−IKYIGGILRNWQMNNVTTVEQVRQS                                                                                 
fig|1313.5.peg.175   Streptococcus pneumoniae OXC141                                                                    HYTDEMLATIFRR−−−−−−−−−PLNTVRMAIGVFEQFGMIEIID−−−−−−−−−−−−−−−−−−G−−−IISLPNW−−EKHQNV−−−−−−−−−−−−−−−−−−DGMEKIKEQTRNRVAKYRKKQKNLA−−−−−−−−−−−−−−−−−−−LGNVTGN−−−−−−−VTVTDGNALEEDKDKNKNRLDKDKNKKRITTTSSGS−−−EENILELFQSEFRRLLS−−−−−−−−−−−−−GFEIE−−−EINHLLNE−−−−−−−−−NDVDLVKEALKTAIN−−SGKPN−−−IKYIGGILRNWQMNNVTTVEQVRQS                                                                                 
fig|1154921.3.peg.31   Streptococcus agalactiae GB00561                                                                                             TVEKAIQIFRDLQLIEILD−−−−−−−−−−−−−−NGAIY−−−MTNIQNF−−VGKSST−−−−−−−−−−−−−−−−−−EADRIRKLRAKN−−−−NSGVQMLYK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CTPEIEIEKDKKI−−D−−−−−−−INIDKELELEQ−−DK−−−EDRFVDVVEANLGRGLV−−−−−−−−−−−−−KFEFD−−−MINDYLIG−−−−−−−QNVSKDLFLEAVKVAVA−−NNVRK−−−FNYIARILDNWINDGIKTPEQAYQAQRDFKAKKANKTMQSQ−−−−−−−−−−−−−−−−−−SNVPSWSNPDYKGPDLK−−−−−E                       
fig|471872.6.peg.1271   Streptococcus infantarius subsp. infantarius ATCC BAA-102                                                                                             TVEKAIQIFQQLKLIEILD−−−−−−−−−−−−−−NGAIY−−−MSNIQNF−−VGKSSS−−−−−−−−−−−−−−−−−−EGDRKRAKRAQNRAIRQTSGQMSDK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RPPEIEIDTETEIKKD−−−−−−−IELKKELELEP−−EK−−−EERFVDIVEANLGRGLV−−−−−−−−−−−−−KFEYD−−−TMNDYLIN−−−−−−−KHVSKELFLEAVKVAVA−−NNVRK−−−FNYISRVLDNWIENGIQTVEQAYQAQRDFKAKKANRYQANQ−−−−−−−−−−−−−−−PAKSNVPDWVDEDYKHEATV−−−−−DEQAQLEALKKSMLE        
fig|1159082.3.peg.2093   Streptococcus pneumoniae PCS8203                                                                 GYFNNLKEELALKLDV−−−−−−−−−SEDDIDMTMAYFTKCGLIQIDE−−−−−−−DKNAELPQAKAM−−−VMSETNW−−ASYKRE−−−−−−−−−−−−−−−−−−QRKKGKLEEVQPSLTFS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NSCPTEIEKELEIE−−−−−−−VDKEQSPTPSTINQD−−−FVNLYKSFEAETGKALS−−−−−−−−−−−−−PLQIQ−−−ELQYMLED−−−−−−−−−FSPELIHEALKEAVS−−QGKAN−−−FAYIKAILNRWKQDNLLTVELVRNSRAAREAKKQQTNQLEP−−−−−−−−−−−−−−−−−−TSYEDWIPTQEK                                  
fig|526979.3.peg.364   Bacillus cereus 95/8201                                                                 GVYQITKKQMAFDLGY−−−−−−−−−SMESVNALLDRFEKHHKLVKY−−−−−−−−−−−−−−−NPETR−−−ELAIINW−−GKYNLN−−−−−−−−−−−−−−−−−−RGGKPVEDCIRK−−−−ELDGVSDGSLVELVSAKVKSDKIRAIFEEFINANDTSDDTFTTGGQEKEEEKEEE−−−−−−−KEEQQQERAGAEDVV−−−EINPIIFYERNFGLIT−−−−−−−−−−−−−PFIAD−−−GINAWIDD−−−−−−−−−LNAELVVKAMQIALE−−KNTRN−−−MNYVNTILRDWHLKGLKTVADVEAADKEFRAQRFAKAQQSSQVPYQQKGLSESTKNVIQQQESWEQNIPTDEEL                               
fig|565662.4.peg.74   Enterococcus faecium Com12                                                                                                                                   T−−−VKTTVDN−−TVENPT−−−−−−−−−−−−−−−−−−TGNIPVDSKVNPKVNREVNPSVDST−−−−−−−−−−−−−−−−−−−−−−−−−−−VNPSAYINNTKQNKTNKEDD−−−−−−−−−−−−−−−−−−−−−−−−−DIGVYEFIQKNWGKSPT−−−−−−−−−−−−−GLLQG−−−ALGPMIKT−−−−−−−−−WGADMILFAFKLAFE−−NNVEMPGLKKYVEAILNSWSNQGIKTMESVEKAQEAFKNKKKQNYLPKR−−−−−−−−−−−−QNNVRREKLPDWVNKPQEEKALD−−−−−PDKKAELEARFAAYQAK      
fig|565665.3.peg.2597   Enterococcus faecium D344SRF                                                                                                                               TGKFT−−−VKTTVDN−−TVENSA−−−−−−−−−−−−−−−−−−TGNIPVDSKVNPKVNREVNPSVDST−−−−−−−−−−−−−−−−−−−−−−−−−−−VNPSAYINNTKQNKTNKED−−−−−−−−−−−−−−−−−−−−−−−−−DIGVYEFIQKNWGKSPT−−−−−−−−−−−−−GLLQG−−−ALGPMIKA−−−−−−−−−WGADMILFAFKLAFE−−NNVEMPGLKKYVEAILNSWSNQGIKTMESAEKAQEAFKNKKKQNYLPKR−−−−−−−−−−−−QNNVRREKLPDWVNKPQEEKTLD−−−−−PDKKAELEARFAAYQAK      
fig|535205.4.peg.1568   Enterococcus faecium E1071                                                                                                                                   T−−−VKTTVDN−−TVENSA−−−−−−−−−−−−−−−−−−TGNIPVDSKVNPKVNREVNPSVDST−−−−−−−−−−−−−−−−−−−−−−−−−−−VIPSAYINNTKQNKTNKED−−−−−−−−−−−−−−−−−−−−−−−−−DIGVYEFIQKNWGKAPT−−−−−−−−−−−−−GLLQG−−−ALGPMIKT−−−−−−−−−WGADMILFAFKLAFE−−NNVEMPGLKKYVEAILNSWSNQGIKTMESAEKAQEAFKNKKKQNYLPKR−−−−−−−−−−−−QNNVRREKLPDWVNKPQEEKALD−−−−−PDKKAELEARFAAYQAK      
fig|565659.3.peg.518   Enterococcus faecium 1,141,733                                                                                                                                   T−−−VKTTVDN−−TVENSA−−−−−−−−−−−−−−−−−−TGNIPVDSKVNPKVNREVNPSVDST−−−−−−−−−−−−−−−−−−−−−−−−−−−VNPSAYINNTKQNKTNKED−−−−−−−−−−−−−−−−−−−−−−−−−DIGVYEFIQKNWGKAPT−−−−−−−−−−−−−GLLQG−−−ALGPMIKT−−−−−−−−−WGADMILFAFKLAFE−−NNVEMPGLKKYVEAILNSWSNQGIKTMESAEKAQEDFKNKKKQNYLPKR−−−−−−−−−−−−QNNVRREKLPDWVNKPQEEKTLD−−−−−PDKKAELEARFAAYQAK      
fig|645663.4.peg.1519   Enterococcus faecium E1039                                                                                                                                   T−−−VKTTVDN−−TVENSA−−−−−−−−−−−−−−−−−−TGNIPVDSKVNPKVNREVNPSVDST−−−−−−−−−−−−−−−−−−−−−−−−−−−VNPSAYINNTKQNKTNKEDD−−−−−−−−−−−−−−−−−−−−−−−−−DIGVYEFIQKNWGKAPT−−−−−−−−−−−−−GLLQG−−−ALGPMIKT−−−−−−−−−WGADMILFAFKLAFE−−NNVEMPGLKKYVEAILNSWSNQGIKTMESAEKAQEDFKNKKKQNYLPKR−−−−−−−−−−−−QNNVRREKLPDWVNKPQEEKTLD−−−−−PDKKAELEARFAAYQAK      
fig|526974.3.peg.4275   Bacillus cereus BDRD-ST24                                                                     FHISELARHAKD−−−−−−−−−GEDSLRTGFKELKELGYVKRYP−−−−−−−−−−−−−−VRDGN−−−TKKIARWDTEIYETP−−−−−−−−−−−−−−−−−−QRDMPQMENPDVVKPYEENQKLLNT−−−−−−−−−−−−−−−−−−−−NRLNTNKR−−−−−NNNDYDDMDKLESRVFIN−−−−−−−−−−−−−−−−ER−−−VKVSCNFIKGMGIPLS−−−−−−−−−−−−−EIAIA−−−ELGSFCNL−−−−−−−−−FSGELIQHAINKAVD−−ENAPR−−−WNYIKAILRNWKEQEVKTLVDVAILDRRFEMSKKKKYNGTG−−−−−−−−−−−RKYSNRKEIVPDWLYKDDESTNLEEERKTVQSTDEERERLQEVLN       
fig|526978.3.peg.3592   Bacillus cereus BDRD-Cer4                                                                     FHISELARHAKD−−−−−−−−−GEDSLRTGFKELKELGYVKRYP−−−−−−−−−−−−−−VRDGN−−−TKKIARWDTEIYETP−−−−−−−−−−−−−−−−−−QRDMPQMENQDVVKPYEENQKLLNT−−−−−−−−−−−−−−−−−−−−NRLNTNKR−−−−−NNNDYDDMDKLESRVFIN−−−−−−−−−−−−−−−−ER−−−VKVSCNFIKGMGIPLS−−−−−−−−−−−−−EIAIA−−−ELGSFCNL−−−−−−−−−FSGELIQHAINKAVD−−ENAPR−−−WNYIKAILRNWKEQEVKTLVDVAILDRRFEMSKKKKYNGTG−−−−−−−−−−−RKYSNRKEIVPDWLYKDDESTNLEEERKTVQSTDEERERLQEVLN       
fig|226900.1.peg.3541   Bacillus cereus ATCC 14579                                                                     FHISELARHAKD−−−−−−−−−GEDSLRTGFKELKELGYVKRYP−−−−−−−−−−−−−−VRDGN−−−TKKIARWDTEIYETP−−−−−−−−−−−−−−−−−−QRDMPQMENQDVVKPYEENQKLLNT−−−−−−−−−−−−−−−−−−−−NRLNTNKR−−−−−NNNDYDDMDQLESRVFIN−−−−−−−−−−−−−−−−ER−−−VKVSCNFIKGMGIPLS−−−−−−−−−−−−−EIAIA−−−ELGSFCNL−−−−−−−−−FSGELIQHAINKAVD−−ENAPR−−−WNYIKAILRNWKEQEVKTLVDVAILDRRFEMSKKKKYNGTG−−−−−−−−−−−RKYSNRKEIVPDWLYKDDESTNLEEERKTVQSTDEERERLQEVLN       
fig|1053225.3.peg.1329   Bacillus cereus VD045                                                                     FHISELARHAKD−−−−−−−−−GEDSLRTGFKELKELGYVKRYP−−−−−−−−−−−−−−VRDGN−−−TKKITRWDTEIYETP−−−−−−−−−−−−−−−−−−QRDMPQMENQDVVKPYEENQKLLNT−−−−−−−−−−−−−−−−−−−−NRLNTNKR−−−−−NNNDYDDMDKLESRVFIN−−−−−−−−−−−−−−−−ER−−−VKVSCNFIKGMGIPLS−−−−−−−−−−−−−EIAIA−−−ELGSFCNL−−−−−−−−−FSGELIQHAINKAVD−−ENAPR−−−WNYIKAILRNWKEQEVKTLVDVAILDRRFEMSKKKKYNGTG−−−−−−−−−−−RKYSNRKEIVPDWLYKDDESTNLEEERKTVQSTDEERERLQEVLN       
fig|1053243.3.peg.2819   Bacillus cereus VD196                                                                     FHISELARHAKD−−−−−−−−−GEDSLRTGFKELKELGYVKRYP−−−−−−−−−−−−−−VRDGN−−−TKKITRWDTEIYETP−−−−−−−−−−−−−−−−−−QRDMPQMENQDVVKPYEENQKLLNT−−−−−−−−−−−−−−−−−−−−NRLNTNKR−−−−−NNNDYDDMDKLESRVFIN−−−−−−−−−−−−−−−−ER−−−VKVSCNFIKGMGIPLS−−−−−−−−−−−−−EIAIA−−−ELGSFCNL−−−−−−−−−FSGELIQHAINKAVD−−ENAPR−−−WNYIKAILRNWKEKEVKTLVDVAILDRRFEMSKKKKYNGTG−−−−−−−−−−−RKYSNRKEIVPDWLYKDDESTNLEEERKTVQSTDEERERLQEVLN       
fig|1053238.3.peg.1654   Bacillus cereus VD154                                                                     FHISELARHAKD−−−−−−−−−GEDSLRTGFKELKELGYVKRYP−−−−−−−−−−−−−−VRDGN−−−TKKITRWDTEIYETP−−−−−−−−−−−−−−−−−−QRNMPQMENQDVVKPYEENQKLLNT−−−−−−−−−−−−−−−−−−−−NRLNTNKR−−−−−NNNDYDDMDKLESRVFIN−−−−−−−−−−−−−−−−ER−−−VKVSCNFIKGMGIPLS−−−−−−−−−−−−−EIAIA−−−ELGSFCNL−−−−−−−−−FSGELIQHAINKAVD−−ENAPR−−−WNYIKAILRNWKEQEVKTLVDVAILDKRFEMSKKKKYNGTG−−−−−−−−−−−RRYSNRKEIVPDWLYKDDESTNLEEERKTVQSTDEERERLQEVLN       
fig|527019.3.peg.4894   Bacillus thuringiensis IBL 200                                                                     FHISELARHAKD−−−−−−−−−GEDSLRTGFKELKELGYVKRYP−−−−−−−−−−−−−−VRDGN−−−TKKITRWDTEIYETP−−−−−−−−−−−−−−−−−−QRNMPQVENQDVVKPYEENQKLLNT−−−−−−−−−−−−−−−−−−−−NRLTTNKR−−−−−NTNDYDDMDKLESRVFIN−−−−−−−−−−−−−−−−ER−−−VKVSCNFIKGRGIPLS−−−−−−−−−−−−−EIAIA−−−ELGSFCNL−−−−−−−−−FSDELIQHAINKAVD−−ENAPR−−−WNYIKAILRNWKEQEVKTLVDVAILDRRFEMSKKKKYNGTG−−−−−−−−−−−RKYSNRKEIVPDWLYKDDESTNLEEERKTVQSIDEERERLQEVLN       
fig|1053223.3.peg.3468   Bacillus cereus VD014                                                                     FHISELARHAKD−−−−−−−−−GEDSLRTGFKELKELGYVKRYP−−−−−−−−−−−−−−VRDGN−−−TKKITKWDTEIYETP−−−−−−−−−−−−−−−−−−QRNMPQVENQDVVKPYVENQKLLNT−−−−−−−−−−−−−−−−−−−−NRLTTNKRNTNIQNTNHYDDMDKLESRVFIN−−−−−−−−−−−−−−−−ER−−−VKVSCNFIKGMGIPLS−−−−−−−−−−−−−EIAIA−−−ELGDFCNL−−−−−−−−−FSDELIQHAINKAVD−−ENAPR−−−WNYIKAILRNWKEQEVKTLVDVAILDRCFEMSKKKKYKGTG−−−−−−−−−−−RKYSNRKEIVPNWLYKDDESTNLEEERKTVQSIDEERERLQEVLN       
fig|526980.3.peg.4657   Bacillus cereus ATCC 10876                                                                     FHISELARHAKD−−−−−−−−−GEDSLRTGFKELKELGYVKRYP−−−−−−−−−−−−−−VRDGN−−−TQKITRWDTEIYETP−−−−−−−−−−−−−−−−−−QRNMPQVENQDVVKLYVENQTLLNT−−−−−−−−−−−−−−−−−−−−NRLITNKRNTNIQNTNHYDDMDKLDSRVFIN−−−−−−−−−−−−−−−−ER−−−VKVSCNFIKGMGIPLS−−−−−−−−−−−−−EIAIA−−−ELGDFCNL−−−−−−−−−FSDELIQHAINKAVD−−ENAPR−−−WNYIKAILRNWKEQEVKTLVDVATLDRRFEMSKKKKYNETG−−−−−−−−−−−RKYSNRKEIVPDWLYKDDESTNLEGERKTVQSTDEERERLQEVLN       
fig|526969.3.peg.3470   Bacillus cereus m1550                                                                     FHISELARHAKD−−−−−−−−−GEDSLRTGFKELKELGYVKRYP−−−−−−−−−−−−−−VRDGN−−−TKKITRWDTEIYETP−−−−−−−−−−−−−−−−−−QRNMPQVENQDVVKPYEENQKLLNT−−−−−−−−−−−−−−−−−−−−NRLTTNKRNTNIQNTNHYDDMDKLESRVFIN−−−−−−−−−−−−−−−−ER−−−VKVSCNFIKGMGIPLS−−−−−−−−−−−−−EIAIA−−−ELGDFCNL−−−−−−−−−FSDGLIQHAINKAVD−−ENAPR−−−WNYIKAILRNWKEQEVKTLVDVATLDRRFEMSKKKKYNGTG−−−−−−−−−−−RKYSNRKEIVPDWLYKDDESTNPEGERKTVQSIDEERERLQEVLN       
fig|1053220.3.peg.1315   Bacillus cereus MSX-A1                                                                     FHISELARHAKD−−−−−−−−−GEDSLRTGFKELKELGYVKRYP−−−−−−−−−−−−−−VRDGN−−−TKKITRWDTEIYETP−−−−−−−−−−−−−−−−−−QRNMPQVENQDVVKPYEENQALLNT−−−−−−−−−−−−−−−−−−−−NRITTNKRNTNIQNTNHYDDIDKLDSCVSSN−−−−−−−−−−−−−−−−EK−−−VKVSCNFIKGTGIPLS−−−−−−−−−−−−−EIAIA−−−ELGDFCNL−−−−−−−−−FSDELIQHAINKAVD−−ENAPR−−−WNYIKAILRNWKEQEVKTLVDVAILDRRFEMSKKKKYNGIG−−−−−−−−−−−RKYSNRKEIVPDWLYKDDESTNQEEERKIVQSTDEERERLQEVLN       
fig|526984.3.peg.3980   Bacillus cereus Rock3-29                                                                     FHISELAQHAKD−−−−−−−−−GEDSLRTGFKELKELGYVKRYP−−−−−−−−−−−−−−VRDEH−−−TKKIKRWDTEIYETP−−−−−−−−−−−−−−−−−−QKRIPQVEKQDVGKPYEENPTLLNI−−−−−−−−−−−−−−−−−−−−NKL−−−−−NTKIQNTNHDDKDKLESHILFG−−−−−−−−−−−−−−−−RE−−−FKKNYNFLKERGIPLS−−−−−−−−−−−−−EIAFT−−−ELGDFCDL−−−−−−−−−FSSELIQYATNKAID−−ENAPR−−−WNYVKAILSNWKEQKVKTFADVTALDRRFKMSKNKKFNESG−−−−−−−−−−−RNYSTRKELVPDWLYKDDEHTNQEVERKPAQYTEEERERLKEVLN       
fig|526983.3.peg.2747   Bacillus cereus Rock3-28                                                                     FHISELAQHAKD−−−−−−−−−GEDSLRTGFKELKELGYVKRYP−−−−−−−−−−−−−−VRDEN−−−TKKIKRWDTEIYETP−−−−−−−−−−−−−−−−−−QKRIPQVEKQDVGKPYEENPTLLNI−−−−−−−−−−−−−−−−−−−−NKL−−−−−NTKIQNTNHDDKDKLESHILFG−−−−−−−−−−−−−−−−GE−−−FKKNYSFLKERGIPLS−−−−−−−−−−−−−ENAFT−−−ELGDFCDL−−−−−−−−−FSSELIQYATNKAID−−ENAPR−−−WNYVKAILSNWKEQKVKTFADVTALDRRFKMSKNKKFNESG−−−−−−−−−−−RNYSTRKEIVPDWLYKDDEQTNKEVERKPAQSTEEERERLQEVLN       
fig|280355.4.peg.672   Bacillus anthracis str. A1055                                                                PDDWVFYREELSRHAKD−−−−−−−−−GLDSLRAGMKELKEYGYLKRFPV−−−−−−−−−−−−−−RDDNNKIIKWETIIY−−EVPQND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PVAEKPPVEIPPEEKPPVEKPPVENPELLSTKELN−−−−−−−TKELSTDI−−−−−−−−−−−−−−−−−−−−−−−−−−QS−−−SSSIFSFYENNFGILN−−−−−−−−−−−−−SFIAE−−−NISQWVND−−−−−−−−−TSEELVQAAMERALK−−QQKK−−−−WNYAEGILKQWVNNNVKTLKDVDALETEYQRNKGVKK                                                                    
fig|526970.3.peg.1364   Bacillus cereus BGSC 6E1                                                                      SLTTLTEKVGC−−−−−−−−−GRKKIIECIKSLEEKGYIQKVNR−−−−−−−−−−−−−−KDDQG−−−NNLSNIY−−YVLPTP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SVSQKLVVSEGNQGSVPEKLGVVSEGNTNNTNLN−−−−−−−NTNLTK−−−−−−−−−−−−−−−−−−−−−−−−−−−−SS−−−SKNPFSFYENNIGMLN−−−−−−−−−−−−−PFMAD−−−SIEQWIKD−−−−−−−−−TSEELVIAAMERALK−−QQKK−−−−WKYAEGILKHWANNNVKTLQDVEASEAEYKNRNKGAKQNDPV                                                                
fig|1053214.3.peg.5925   Bacillus cereus IS845/00                                                                      SLTTLTEKVGC−−−−−−−−−GRKKIIECIKSLEEKGYIQKVNR−−−−−−−−−−−−−−KDDQG−−−NNLSNIY−−YVLPTP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SVSQKLVVSEGNHGSVSQKLGVVSEGNTNNTNLN−−−−−−−NTNLTKS−−−−−−−−−−−−−−−−−−−−−−−−−−−NS−−−NKNPFSFYESNIGILN−−−−−−−−−−−−−PFMAD−−−SIEQWIKD−−−−−−−−−TSEELVIAAMERALK−−KQAK−−−−WNYAEGILKQWSNKNIKNLNDVEALESEYQRNK                                                                        
fig|526999.3.peg.2200   Bacillus mycoides Rock3-17                                                                      SLTTLTEKVGC−−−−−−−−−GRKKIVQCIKSLEEKGYIQKVNR−−−−−−−−−−−−−−KDEQG−−−NNLSNIY−−YVLPTP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SVSQKLVVSEGNQGSVPEKPGVVSEGNTNNTNLN−−−−−−−NTNLTIS−−−−−−−−−−−−−−−−−−−−−−−−−−−SS−−−SKNPFSFYENNIGQLN−−−−−−−−−−−−−SFMAD−−−NIDQWIQD−−−−−−−−−TSEELVIAAMERALK−−QQKK−−−−WNYAEGILKQWANNNMKTLSDVEALEAEYQRKK                                                                        
fig|526971.3.peg.1028   Bacillus cereus MM3                                                                      SLTTLTEKVGC−−−−−−−−−GRKKIVQCIKSLEEKGYIQKVNR−−−−−−−−−−−−−−KDNQG−−−NNLSNIY−−YVLPTP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SVSQKLVVSEGNQGSVPEKQGVVSEGNCNNTNLN−−−−−−−NTNLTIS−−−−−−−−−−−−−−−−−−−−−−−−−−−SS−−−SKNPFSFYESNIGVLN−−−−−−−−−−−−−PFMAD−−−GIDQWIKD−−−−−−−−−TSEELVVAAMERALK−−QQKK−−−−WNYAEGILKQWANKNIKTLSDVEALEVEYQRNKGAKN                                                                    
fig|526992.3.peg.3646   Bacillus cereus AH1271                                                                     TYDEWLKQFPFW−−−−−−−−−SSATLRRIVNKLEKQGLLIK−−−−−GNYNKL−−−−−−KIDQT−−−KWYRIDY−−DLLDRM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SRPSAQN−−−−−EQMECSKRA−−−DEQLNMSRPLPETTTENTTKK−−−−−−−−−−−−−−−−−−−−−−−−−−−VS−−−SSNIFAFYENNFGILN−−−−−−−−−−−−−SFIAD−−−SISQWVDE−−−−−−−−−TSEELVQAAMERALK−−QQKK−−−−WNYAEGILKQWANNNIKTLKDVEASEGEFKRNK                                                                        
fig|526987.3.peg.2813   Bacillus cereus Rock4-2                                                                                W−−−−−−−−−SSATLRRIINKLEKQGLLIK−−−−−GNYNKL−−−−−−KIDQT−−−KWYRIDY−−DLLERM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SRPSAQN−−−−−EQMGCSKRA−−−DGLLKMSRPLPETTTENTTKK−−−−−−−−−−−−−−−−−−−−−−−−−−−VS−−−SSNIFAFYENNFGILN−−−−−−−−−−−−−PFVAD−−−SITQWAND−−−−−−−−−TSEELVIAAMERALK−−QQKK−−−−WNYAEGILKQWANQNIKTLSDVEVLEAEYQRNKGAKN                                                                    
fig|1286404.3.peg.630   Bacillus thuringiensis serovar thuringiensis str. IS5056                                                                     TYEEWKSQFPFW−−−−−−−−−SESTIKRTLKKLQERKIIIV−−−−−GNYNKM−−−−−−KVDHT−−−KWYRIDY−−EVLDNI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EQEAASQIDLTSGQFAPTKRSNCPDEQVKVTRPIPETTTEITTENV−−−−−−−−−−−−−−−−−−−−−−−−−−SS−−−NSSAFAFYENNFGVLN−−−−−−−−−−−−−SFMAD−−−SIGHWIRD−−−−−−−−−TSEELVIAAMERALK−−RQAK−−−−WNYAEGILKQWTNSNIRTLSDVKASEEAFKRQKQSKKRAGK                                                                
fig|491915.4.peg.2085   Anoxybacillus flavithermus WK1                                                                                         WSESTIRRTIVRLEKKGIVVS−−−−−−−RYRS−−−−−−KLDKT−−−KWYRIDY−−HVLANV−−−−−−−−−−−−−−−−−−MNGEEER−−−−−−−−−−−QNDETNAQHEQTTMQHDVSHASTCQDARRNMNR−−−−−QTNITTD−−−−−−−−−−−−−−−−−−−−−−−−−−−−HT−−−LQNIIYFYEQNGFGTIS−−−−−−−−−−−−−SYVGE−−−QMALWVNE−−−−−−−−−TSAEWVLEALTIALK−−NGVKT−−−WKYAEGILRNWKKHG−−−−−−−−−−−−−−−−RIKKEKR−−−−−−−−−−−−−−−−−−AVRTEWIPEWLHIDYTQYERR−−−−−−−TYNEAELEQKRRELEERLKKK
fig|235909.3.peg.2112   Geobacillus kaustophilus HTA426                                                                                         WSESTIRRIITKLEKIGIIVS−−−−−ANFNRS−−−−−−RIDKT−−−KWYRIDY−−DKLAEF−−−−−−−−−−−−−−−−−−TSSNQDEQTTDQNDVSTVQNEQTTDEIDSPSGQNEQSICSNWTDEALNLNRPIPENTTEITTEKKEEVEED−−−−−−−−−−−−−−−−−ARAHS−−−FREIIQFVEQNGFGTVG−−−−−−−−−−−−−SYIGE−−−KIVSWVDD−−−−−−−−−TSEELVLEALKIAVE−−NGAKT−−−WKYVETILRDWFEKGYRTVDQVRAAQLAFREQQLKKRQAST−−−−SSDSGRKIRTPVRTEIVPDWLKMDYSQPEDD−−−−−−−−−−DFDVEQARRELEERL   
fig|272558.8.peg.3679   Bacillus halodurans C-125           VYRKIFHHEIFR−−−−−−−DQLGFRLFMLILGNAVFSQDGVE−−−−IDGVVVKRGQWFRSYRKLQEDLAYREGRTIKKPGLATLKRAVKRLEDLDMIKTTIIYENGGTRCGTGSGTVRGT−−−LFEVVNY−−AKYQAL−−−−−−−−−−−−−−−−−−PGPENLLRNAMRNASRNKNNNVLNN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NELNNKATTTT−−−GEEPVTFYESNFGMLS−−−−−−−−−−−−−PFQME−−−QIVMMREE−−−−−−−−−NSDELVLAAMKLALK−−KNKKH−−−LSYVEGILKIWRENNVKTVADARAYELEY                                                                             
fig|568703.9.peg.1034   Lactobacillus rhamnosus GG                                                                PSEFNMPNRTLETLTGL−−−−−−−−−SRQGIVKSRNALKQSGLIDFQTN−−−−−−−−−−−−−GVKAT−−−TYSVIDI−−SRKLST−−−−−−−−−−−−−−−−−−SDSRQPSSQDDDSMSNSRQHGRQPS−−−−−−−−−−−−−−RQHSLQGSLQPSRQHSSTYTKQDETKLDKTKRQQTTAPVKAAERPAGEPSSSSSS−−−ILDICNFWEGNGFGQLS−−−−−−−−−−−−−PFTRE−−−SLVDWVADMRKAGSP−−EPEKLVLNALRTAVE−−SNVRN−−−YKYVNGILKNWESKRLLTVAAVDANDSERKTNQPQRRYGKP−−−−−−−−−−−−−−−VRNEKLPDWAKPGYKPEHKK−−−−−ASAEDRAELAEQL          
fig|568704.3.peg.773   Lactobacillus rhamnosus Lc 705                                                                PSEFNMPNRTLETLTGL−−−−−−−−−SRQGIVKSRNALKQSGLIDFQTN−−−−−−−−−−−−−GVKAT−−−TYSVIDI−−SRKLST−−−−−−−−−−−−−−−−−−SDSRQPSGQDDDSVSNSRQHSRQPS−−−−−−−−−−−−−−RQHSLQGSLQPSRQHSSTYTKQDETKLDKTKRQQTTAPVKAAERPAEEPSSSSSS−−−ILDICNFWEGNGFGQLS−−−−−−−−−−−−−PFTRE−−−SLVDWVADMRKAGSP−−EPEKLVLNALRTAVE−−SNVRN−−−YKYVNGILKNWESKRLLTVAAVDANDNERKTNQPQRRYGKP−−−−−−−−−−−−−−−VRNEKLPDWAKPGYKPEHKK−−−−−ASAEDRAELAEQL          
fig|525337.3.peg.2242   Lactobacillus paracasei subsp. paracasei ATCC 25302                                                                PSEFNMPNRTLETLTGL−−−−−−−−−SRQGIIKARNALKQSGLIDFQTN−−−−−−−−−−−−−GVKAT−−−TYSVIDI−−SRKLST−−−−−−−−−−−−−−−−−−SDSRQPSSQADDSVSDSRQHSRQPS−−−−−−−−−−−−−−RQHSLQGSLQPSRQHSSTYTKQDETKLDKTKRQQTTAPVKAAERPTEEPSSSSSS−−−ILDICNFWEGNGFGQLS−−−−−−−−−−−−−PFTRE−−−SLVEWVDDMRKAGSP−−EPEKLVLNALRTAVE−−SNVKN−−−YKYVNGILKNWESKRLLTVAAVEANDSERKTNQPQRRYGKP−−−−−−−−−−−−−−−VRTEELPVWAQDGYKPKHKK−−−−−VSEEDRAKLAEQMEQLKA     
fig|1256224.3.peg.146   Lactobacillus paracasei subsp. paracasei Lpp223                                                                PSEFNMPNRTLETLTGL−−−−−−−−−SRQGIVKARNALKQSGLIDFQTN−−−−−−−−−−−−−GVKAT−−−TYSVIDI−−SRKLST−−−−−−−−−−−−−−−−−−SDSRQPSSQADGSVSNSRQHSRQPS−−−−−−−−−−−−−−RQHSLQGSLQPSRQHSSTYTKQDETKLDKTKRQQTTAPVKAAERPAEEPSSSSSS−−−ILDICNFWEGNGFGQLS−−−−−−−−−−−−−PFTRE−−−SLVDWVDDMRKAGSP−−EPEKLVLNALRTAVE−−SNVRN−−−YKYVNGILKNWESKRLLTVAAVDANDSERKTNQPQRRYGKP−−−−−−−−−−−−−−−VRTEELPVWAQDGYKPKHKK−−−−−VSEEDRAKLAEQMEQLKA     
fig|428127.7.peg.1153   Eubacterium dolichum DSM 3991       GFIKIHRKLREWKYYDVPN−−−−−−−MVAVWLELLLRASYEGTTYR−−−−−−GVELKKGQVVFGRKELAETLGL−−−−−−−−−SEQNIRTCINKLISANQITIET−−−−−−−−−−−−−−TNRFT−−−VATIVKW−−EEYQFC−−−−−−−−−−−−−−−−−−NDNDNQQNN−−−QISNQQVTSNQPT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TNQQLTTIKKEKKD−−−−−−−KKDKNNTFIGACAQDDVWSIPLLSLFEEEFARTIS−−−−−−−−−−−−−SNEAM−−−LISQMEND−−−−−−−−−YDDLLIRYALREAMT−−RGKKS−−−VQYIDRILGDWKQRDFTTKD                                                                                      
fig|279010.5.peg.894   Bacillus licheniformis ATCC 14580                                                                 GQTIIKITHLAERFNW−−−−−−−−−SAVQIKYSLDRMARQGYLKIDRLP−−−−−−−−−−−−QKRGF−−−IVTIVNY−−AEYTRF−−−−−−−−−−−−−−−−−−ENYKKKKAPVSDPTEGKEEDKNM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KTNPFQFFEDEGFGLLS−−−−−−−−−−−−−SFLAD−−−MLKGLIDD−−−−−−−−−YGEEKVLDAMKEAVK−−RNARN−−−MAYVQRLLQSNELKSKEWGNDYQAKKARKQ−−SDQYKHGISKGDAKPSGKISP                                                     
fig|196620.1.peg.1920   Staphylococcus aureus subsp. aureus MW2     MTGWISIDRSIQNHWLFK−−E−−KRTFSKFEAWIYLLMEANHSKAKVP−−IGNQIVTVERGQRLTSILTLSDLFNW−−−−−−−−−SRFKVKTFLDLLESDGMLEVKT−−−−−−−−−−−−−−TSKYT−−−LITIVNY−−DFYQSE−−−−−−−−−−−−−−−−−−QGRNQHQNDIKPTSKQHQSNINPTS−−−−−−−−−−−−−−−−−−KQHQTNTN−−−−−−−NND−−−−−−−−NKD−−−−−−−NNEKNVNNE−−−KK−−−KAAAFDFFQDNGFGFIT−−−−−−−−−−−−−PYNLD−−−DLNYYLDSF−−−−−−ENDSDEIVTASLKIAKD−−RNKVT−−−WGYAKSILNTWLNANLKSIEQVRAFEKQQIESKKQTYKPHV−−−−−−−−−−−−−−KQSKEKTPKWLTDGTRETKT−−−−−−AEVDENLEKDREAFIKRLNSKWE
fig|282459.5.peg.1981   Staphylococcus aureus subsp. aureus MSSA476                                                                                                          MLEVKT−−−−−−−−−−−−−−TSKYT−−−LITIVNY−−DFYQSE−−−−−−−−−−−−−−−−−−QGRNQHQNDIKPTSKQHQSNINPTS−−−−−−−−−−−−−−−−−−KQHQTNTN−−−−−−−NND−−−−−−−−NKD−−−−−−−NNEKNVNNE−−−KK−−−KAAAFDFFQDNGFGFIT−−−−−−−−−−−−−PYNLD−−−DLNYYLDSF−−−−−−ENDSDEIVTASLKIAKD−−RNKVT−−−WGYAKSILNTWLNANLKSIEQVRAFEKQQIESKKQTYKPHV−−−−−−−−−−−−−−KQSKEKTPKWLTDGTRETKT−−−−−−AEVDENLEKDREAFIKRLNSKWE
fig|1123523.3.peg.1956   Staphylococcus aureus subsp. aureus 11819-97     MTGWISIDRSIQNHWLFK−−E−−KRTFSKFEAWIYLLMEANHSKAKVP−−IGNQIVTVERGQRLTSILTLSDLFNW−−−−−−−−−SRFKVKTFLDLLESDGMLEVKT−−−−−−−−−−−−−−TSKYT−−−LITIVNY−−DFYQSE−−−−−−−−−−−−−−−−−−QGRNQHQNDIKPTSKQHQSNINPTS−−−−−−−−−−−−−−−−−−KQHQTNTN−−−−−−−NND−−−−−−−−NKD−−−−−−−NNEKNVNNE−−−KK−−−KAAAFDFFQDNGFGFIT−−−−−−−−−−−−−PYNLD−−−DLNYYLDSF−−−−−−ENDSDQIVTASLKIAKD−−RNKVT−−−WGYAKSILNTWLNANLKSIEQVRAFEKQQLESKKQTNKPYV−−−−−−−−−−−−−−KPSKEKTPKWLTDSTRETKT−−−−−−PEVDENLEKDREAFIKRLNSKWE
fig|1158520.3.peg.1239   Staphylococcus aureus M0280     MTGWISIDRSIQNHWLFK−−E−−KRTFSKFEAWIYLLMEANHSKAKVP−−IGNQIVTVERGQRLTSILTLSDLFNW−−−−−−−−−SRFKVKTFLDLLESDGMLEVKT−−−−−−−−−−−−−−TSKYT−−−LITIVNY−−DFYQSE−−−−−−−−−−−−−−−−−−QGRNQHQNDIKPTSKQHQSNINPTS−−−−−−−−−−−−−−−−−−KQHQTNTN−−−−−−−NND−−−−−−−−NKD−−−−−−−NNEKNVNNE−−−KK−−−KTTAFDFFQDNGFGFIT−−−−−−−−−−−−−SYNLD−−−DLNYYLDSF−−−−−−ENDSDEIVTASLKIAKD−−RNKVT−−−WGYAKSILNTWLNANLKSIEQVRAFEKQQLESKKQNYKPFV−−−−−−−−−−−−−−KQSKEKTPKWLTDSTRETKT−−−−−−PEVDENLEKDREAFIKRLNSKWE
fig|553577.3.peg.2949   Staphylococcus aureus A8796     MTGWISIDRSIQNHWLFK−−E−−KRTFSKFEAWIYLLMEANHSKAKVP−−IGNQIVTVERGQRLTSILTLSDLFNW−−−−−−−−−SRFKVKTFLDLLESGGMLEVKT−−−−−−−−−−−−−−TSKYT−−−LITIVNY−−DFYQSE−−−−−−−−−−−−−−−−−−QGRNQHQNDIKPTSKQHQSNINPTS−−−−−−−−−−−−−−−−−−KQHQTNTN−−−−−−−NND−−−−−−−−NKD−−−−−−−NNEKNVNNE−−−KK−−−KTTAFDFFQDNGFGFIT−−−−−−−−−−−−−SYNLD−−−DLNYYLDSF−−−−−−ENDSDEIVTASLKIAKD−−RNKVT−−−WGYAKSILNTWLNANLKSIEQVRAFEKQQLESKKQNYKPYV−−−−−−−−−−−−−−KQSKEKTPKWLTDGTRETKT−−−−−−PEVDENLEKDREAFIKRLNSKWE
fig|553583.3.peg.580   Staphylococcus aureus A9635     MTGWISIDRSIQNHWLFK−−E−−KRTFSKFEAWIYLLMEANHSEAKVP−−IGNQIVTVERGQRLTSILTLSDLFNW−−−−−−−−−SRFKVKTFLDLLESDGMLEVKT−−−−−−−−−−−−−−TSKYT−−−LITIVNY−−DFYQSE−−−−−−−−−−−−−−−−−−QGRNQHQNDIKPTSKQHQSNINPTS−−−−−−−−−−−−−−−−−−KQHQTNTN−−−−−−−NND−−−−−−−−NKD−−−−−−−NNEKNVNNE−−−KK−−−KVTAFDFFQDNGFGFIT−−−−−−−−−−−−−PYNLD−−−DLNYYLDSF−−−−−−ENDSDEIVTASLKIAKD−−RNKVT−−−WGYAKSILNTWLNANLKSIEQVRAFEKQQLESKKQNYKPFV−−−−−−−−−−−−−−KQSKEKTPKWLTDSTRETKT−−−−−−PEVDENLEKDREAFIKRLNSKWE
fig|931445.3.peg.1731   Staphylococcus aureus subsp. aureus CIG1176     MTGWISIDRSIQNHWLFK−−E−−KRTFSKFEAWIYLLMEANHSEAKVP−−IGNQIVTVERGQRLTSILTLSDLFNW−−−−−−−−−SRFKVKTFLDLLESDGMLEVKT−−−−−−−−−−−−−−TSKYT−−−LITIVNY−−DFYQSE−−−−−−−−−−−−−−−−−−QGRNQHQNDIKPTSKQHQSNINPTS−−−−−−−−−−−−−−−−−−KQHQTNTN−−−−−−−NND−−−−−−−−NKD−−−−−−−NNEKNVNNE−−−KK−−−KVTAFDFFQDNGFGFIT−−−−−−−−−−−−−PYNLD−−−DLNYYLDSF−−−−−−ENDSDEIVTASLKIAKD−−RNKVT−−−WGYAKSILNTWLNANLKSIEQVRAFEKQQLESKKQNYKPFV−−−−−−−−−−−−−−KQSKEKTPKWLTDSTRETKT−−−−−−PEVDENLEKDREAFIKRLNSKWE
fig|553567.3.peg.1855   Staphylococcus aureus A5948     MTGWIKLHRKLLDSPIFQ−−N−−EKLF−−−KVFAYCLMKASHKDHTQL−−VGRRVVELEKGQFVFGRKRASEELRL−−−−−−−−−KESTVRDYIKLLENLGTIVVKS−−−−−−−−−−−−−−DNKFS−−−VITVVNW−−AIYQSM−−−−−−−−−−−−−−−−−−EENSDSKNDNKSTTNGQQINNKSTT−−−−−−−−−−−−−−−−−−NGQQINTN−−−−−−−KNV−−−−−−−−KNG−−−−−−−DNVKNDENE−−−KK−−−KAAAFDFFQDNGFGFIT−−−−−−−−−−−−−PYNLD−−−DLNYYLDSF−−−−−−ENDSDQIVTASLKIAKD−−RNKVT−−−WGYAKSILNTWLNANLKSIEQVRAFEKQQLESKKQTNKPYV−−−−−−−−−−−−−−KPSKEKTPKWLTDSTRETKT−−−−−−PEVDENLEKDREAFIKRLNSKWE
fig|585150.3.peg.2605   Staphylococcus aureus subsp. aureus C160     MTGWIKLHRKLLDSPIFQ−−N−−EKLF−−−KVFAYCLMKASHKDHTQL−−VGRRVVELEKGQFVFGRKRASEELRL−−−−−−−−−KESTVRDYIKLLENLGTIVVKS−−−−−−−−−−−−−−DNKFS−−−VITVVNW−−AIYQSM−−−−−−−−−−−−−−−−−−EENSDSKND−−−−−−−−−−−NKSTT−−−−−−−−−−−−−−−−−−NQQQINTN−−−−−−−KNV−−−−−−−−KNG−−−−−−−DNVKNGENE−−−KK−−−KVTAFDFFQDNGFGFIT−−−−−−−−−−−−−PYNLD−−−DLNYYLDSF−−−−−−ENDSDEIVTASLKIAKD−−RNKVT−−−WGYAKSILNTWLNANLKSIEQVRAFEKQQLESKKQTNKPYV−−−−−−−−−−−−−−KPSKEKTPKWLTDSTRETKT−−−−−−PEVDENLEKDREAFIKRLNSKWE
fig|1158520.3.peg.263   Staphylococcus aureus M0280     MTGWIKLHRKLLDSPIFQ−−N−−EKLF−−−KVFAYCLMKASHKDHTQL−−VGRRVVELEKGQFVFGRKRASEELRL−−−−−−−−−KESTVRDYIKLLENLGTIVVKS−−−−−−−−−−−−−−DNKFS−−−VITVVNW−−AIYQSM−−−−−−−−−−−−−−−−−−EENSNSKNDNKSTTNQQQMDNKWTT−−−−−−−−−−−−−−−−−−NQQQINTN−−−−−−−KNV−−−−−−−−KNG−−−−−−−DNVKNGENE−−−KK−−−KVTAFDFFQDNGFGFIT−−−−−−−−−−−−−PYNLD−−−DLNYYLDSF−−−−−−ENDSDQIVTASLKIAKD−−RNKVT−−−WGYAKSILNTWLNANLKSIEQVRAFEKQQLESKKQNYKPFV−−−−−−−−−−−−−−KQSKEKTPKWLTDSTRETKT−−−−−−PEVDENLEKDREAFIKRLNSKWE
fig|1169274.3.peg.1958   Staphylococcus aureus M1309     MTGWIKLHRKLLDSPIFQ−−N−−EKLF−−−KVFAYCLMKASHKDHTQL−−VGRRVVELEKGQFVFGRKRASEELRL−−−−−−−−−KESTVRDYIKLLENLGTIVVKS−−−−−−−−−−−−−−DNKFS−−−VITVVNW−−AIYQSM−−−−−−−−−−−−−−−−−−EENSNSKNDNKSTTNQQQMDNKWTT−−−−−−−−−−−−−−−−−−NQQQINTN−−−−−−−KNV−−−−−−−−KNG−−−−−−−DNVKNGENE−−−KK−−−KVTAFDFFQDNGFGFIT−−−−−−−−−−−−−PYNLD−−−DLNYYLDSF−−−−−−ENDSDQIVTASLKIAKD−−RNKVT−−−WGYAKSILNTWLNANLKSIEQVRAFEKQQLESKKQNYKPFV−−−−−−−−−−−−−−KQSKEKTPKWLTDSTRETKT−−−−−−PEVDENLEKDREAFIKRLNSKWE
fig|553577.3.peg.2847   Staphylococcus aureus A8796     MTGWIKLHRKLLDSPIFQ−−N−−EKLF−−−KVFAYCLMKASHKDHTQL−−VGRRVVELEKGQFVFGRKRASEELRL−−−−−−−−−KESTVRDYIKLLENLGTIVVKS−−−−−−−−−−−−−−DNKFS−−−VITVVNW−−AIYQSM−−−−−−−−−−−−−−−−−−EENSNSKNDNKSTTNQQQMDNKWTT−−−−−−−−−−−−−−−−−−NQQQINTN−−−−−−−KNV−−−−−−−−KNG−−−−−−−DNVKNGENE−−−KK−−−KVTAFDFFQDNGFGFIT−−−−−−−−−−−−−PYNLD−−−DLNYYLDSF−−−−−−ENDSDQIVTASLKIAKD−−RNKVT−−−WGYAKSILNTWLNANLKSIEQVRAFEKQQLESKKQNYKPFV−−−−−−−−−−−−−−KQSKEKTPKWLTDSTRETKT−−−−−−PEVDENLEKDREAFIKRLNSKWE
fig|931445.3.peg.2892   Staphylococcus aureus subsp. aureus CIG1176     MTGWIKLHRKLLDSPIFQ−−N−−EKLF−−−KVFAYCLMKASHKDHTQL−−VGRRVVELEKGQFVFGRKRASEELRL−−−−−−−−−KESTVRDYIKLLENLGTIVVKS−−−−−−−−−−−−−−DNKFS−−−VITVVNW−−AIYQSM−−−−−−−−−−−−−−−−−−EENSDSKNDNKSTTNQQQMDNKWTT−−−−−−−−−−−−−−−−−−NQQQINTN−−−−−−−KNV−−−−−−−−KNG−−−−−−−DNVKNGENE−−−KK−−−KVTAFDFFQDNGFGFIT−−−−−−−−−−−−−PYNLD−−−DLNYYLDSF−−−−−−ENDSDQIVTASLKIAKD−−RNKVT−−−WGYAKSILNTWLNANLKSIEQVRAFEKQQLESKKQNYKPFV−−−−−−−−−−−−−−KQSKEKTPKWLTDSTRETKT−−−−−−PEVDENLEKDREAFIKRLNSKWE
fig|426430.6.peg.1859   Staphylococcus aureus subsp. aureus str. Newman     MTGWIKLHRKLLDSPIFQ−−N−−EKLF−−−KVFAYCLMKASHKDHTQL−−VGRRVVELEKGQFVFGRKRASEELRL−−−−−−−−−KESTVRDYIKLLENLGTIVVKS−−−−−−−−−−−−−−DNKFS−−−VITVVNW−−AIYQSM−−−−−−−−−−−−−−−−−−EENSDSKNDNKSTTNQQQMDNKWTT−−−−−−−−−−−−−−−−−−NQQQINTN−−−−−−−KNV−−−−−−−−KNG−−−−−−−DNVKNGENE−−−KK−−−KVTAFDFFQDNGFGFIT−−−−−−−−−−−−−PYNLD−−−DLNYYLDSF−−−−−−ENDSDQIVTASLKIAKD−−RNKVT−−−WGYAKSILNTWLNANLKSIEQVRAFEKQQLESKKQNYKPFV−−−−−−−−−−−−−−KQSKEKTPKWLTDSTRETKT−−−−−−PEVDENLEKDREAFIKRLNSKWE
fig|553583.3.peg.2381   Staphylococcus aureus A9635     MAGWIKIHRKIIDHWIWT−−D−−SKRL−−−KWWMDLLLLTNHSDKKVM−−LGGKLVVLKRGSFHTSELKLSERWNV−−−−−−−−−SRNTVRNYLNALEKDTMITTKK−−−−−−−−−−−−−−TKNGT−−−TIIVHNY−−GIYQDN−−−−−−−−−−−−−−−−−−DDYKKQQTEQLSEQQTEQQSEQK−−−−−−−−−−−−−−−−−−−−KDNRLNRTLNKTKELKNI−−−−−−−−KND−−−−−−−KNVKNMKKE−−−KK−−−NYKVFDFFQENGFGFIT−−−−−−−−−−−−−QYILE−−−DINYYLDAF−−−−−−CQDSDEILIAALKIAKD−−RNKVN−−−WGYAKSILNSWLQMNLSNYDQIKAYEAQYKATKKMQNKQKQ−−−−−−−−−−−−−NYKSKEKTPSWLTNQNQNTAVQ−−−−−−−VDEEFEKDRAEFLKKLNAHW 
fig|458233.11.peg.1024   Macrococcus caseolyticus JCSC5402     MAGWISLHRSIEKHWLYE−−E−−ERKFSRFEAWVDLLLMVNHADNKTM−−IDGKLVTVKRGQRITSLRKLGDRWNW−−−−−−−−−SLTKVDAFLKLLEEDKMIVLKK−−−−−−−−−−−−−−DTKKT−−−LVTIVNY−−DIYQNN−−−−−−−−−−−−−−−−−−DLEKRHRKDSEKTVKEHRKDSEKTQ−−−−−−−−−−−−−−−−−−−−−−KKTN−−−−−−−NNV−−−−−−NKDNN−−−−−−−VNNDNKVISSSNNDD−−−FRTVVSMYQEN−−−−−−−−−−−−−IELNPAPVTFQ−−−KIQQDFSD−−−−−−−−−YGKDIMIYAIKKSAL−−KNNHN−−−YSFINYLLNDWKKKQLTTVDEIKQSEHNFEFKKQATYSKQN−−−−−−−−−−−−−−−QQKEITPSWINQENTQKQ−−−−−−−DIDEEELERERQKLLEELNSSWE
fig|536229.4.peg.1070   Bacillus pumilus ATCC 7061      TGWIKLHRAIRNHWLYE−−E−−ERTFSRYEAWLDLLMMANHKDAKVK−−LGLEIIHVPEGSLITSELKLMDRW−−−−−−−−KWGKAKTRNFLKLLENDEMIIKKS−−−−−−−−−−−−−−DRKKT−−−TITICNY−−SVYQEK−−−−−−−−−−−−−−−−−−ETKVR−−−−−−−−−−−PQADHEQTD−−−−−−−−−−−−−−−−−−HRPIADTN−−−−−−−KNVKNLRNKELKEE−−−−−−−EEKSPVGNDS−−PF−−−QQIEDKYLSRRGGGLMITPNDAQAIERIIQEHIPLE−−−DILVWIDEI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FDQYRPR                                                                                            
fig|212717.1.peg.1923   Clostridium tetani E88       GWISLYRDIQEHWIWE−−D−−AEKL−−−KAWLDLLLLANHQSRKIL−−LGNELINVERGSFITSQKKLMERWGW−−−−−−−−−GSEKTRTFLKLLDSDGMIKFQP−−−−−−−−−−−−−−DKKKT−−−TIIILNY−−DRYQKQNGFNADIPTDSENM−−−−QNDNRTQTE−−−−−−−CNQNDSRTS−−−−−−−−−−−−−−−−−−−−−−AETN−−−−−−−NND−−−−−NNYNNI−−−−−−−NNDNNSS−−−−−GS−−−TPNYIEFFNSNFHMIS−−−−−−−−−−−−−SYELE−−−VLRSYEKD−−−−−−−−GLSEEVILLALKKAVE−−NNVRT−−−IKYVKSILQNWLENNIKTVEGVKAEEERFKRDIEHKKAKGNVER                                                             
fig|212717.1.peg.944   Clostridium tetani E88       GWISLYRDIQEHWIWE−−D−−AEKL−−−KAWLDLLLLANHQSRKIL−−LGNELIEIKRGSTHASELKLMDRWNW−−−−−−−−−SKKKVRNFLQLLEKDNMIICEK−−−−−−−−−−−−−−SKKGT−−−TITIINY−−EVYQGS−−−−−−−−−−−−−−−−−−RNHRETIKE−−−−−−−PQGNHKETI−−−−−−−−−−−−−−KELLGDHKGYTN−−−−−−−NND−−−−−NNYNNI−−−−−−−NNDNNSS−−−−−GS−−−TPNYIEFFNSNFHLIN−−−−−−−−−−−−−SYEIN−−−ILNSFVKD−−−−−−−−GLSEEVILLALKKAVE−−NNVRT−−−IKYVKSILQNWLENNIKTVEGVKAEEERFKRDIEHKKAKGNVER                                                             
fig|293826.4.peg.823   Alkaliphilus metalliredigens QYMF       GWISLHRQMQNHWLWD−−−−−DKPFSKGQAWMDLLMMANHQENKFL−−LGNELIKVERGSFVTSELKMIKRWGW−−−−−−−−−SKTKLRNFFKLLEEDEMIMKKT−−−−−−−−−−−−−−DKKKT−−−ILTICNY−−NEYQTS−−−−−−−−−−−−−−−−−−ENHKETMRE−−−−−−−PQENQVKTT−−−−−−−−−−−−−−−−−−KKPQENTN−−−−−−−NND−−−−−−−−NNE−−−−−−−NKDNKDRSICQENEA−−−QRESQLKFPLDSIEYRLADFLRKWIKKNNELAKVPGDSHMDKWSQH−−−−−−−−−−−−−−−−−−IDYMLR−−LDNRS−−−AEDIKEVIEFCQKDEFWMTNILSTAKLRNKFDQLYLKSRQKNQPAIHPVNTEAKIKTKFHLSKSRGDKYTADELEE                            
fig|293826.6.peg.879   Alkaliphilus metalliredigens QYMF                                          MMANHQENKFL−−LGNELIKVERGSFVTSELKMIKRWGW−−−−−−−−−SKTKLRNFFKLLEEDEMIMKKT−−−−−−−−−−−−−−DKKKT−−−ILTICNY−−NEYQTS−−−−−−−−−−−−−−−−−−ENHKETMRE−−−−−−−PQENQVKTT−−−−−−−−−−−−−−−−−−KKPQENTN−−−−−−−NND−−−−−−−−NNE−−−−−−−NKDNKDRSICQENEA−−−QRESQLKFPLDSIEYRLADFLRKWIKKNNELAKVPGDSHMDKWSQH−−−−−−−−−−−−−−−−−−IDYMLR−−LDNRS−−−AEDIKEVIEFCQKDEFWMTNILSTAKLRNKFDQLYLKSRQKNQPAIHPVNTEAKIKTKFHLSKSRGDKYTADELEE                            
fig|386415.6.peg.1294   Clostridium novyi NT       GWIKIYRNIQEHWIWQ−−D−−PQKL−−−KWWLDILLLANHKDNKFL−−LGNELITIERGEHHTSELKLAERWGV−−−−−−−−−SKTTVRKFLKLLESDNMIELKK−−−−−−−−−−−−−−SKKGT−−−TLKVTNY−−NDYQDF−−−−−−−−−−−−−−−−−−SEGEKTIKK−−−−−−−PQKNHSIDH−−−−−−KETIKEPYAIPQKNHEVYTN−−−−−−−NNE−−−−−KNDNNE−−−−−−−KNDKNE−−−−−−−−−−−−KNDNKNKYMSDSNEYRLAEYLYKHIKVNNPNAKEP−−−NFQNWAKT−−−−−−−−−−−−−−−−−−FDYILR−−IDKRD−−−LEEVKQLIVFCQKHSFWYKNILSADKFRKQYERLLLEKNDSKKVKYENKVYGNKMDE                                               
fig|445337.5.peg.622   Clostridium botulinum C str. Eklund       GWIKIYRNIQEHWIWQ−−D−−PQKL−−−KWWLDILLLANHKDNKFL−−LGNELITIERGEHHTSELKLAERWGV−−−−−−−−−SKTTVRKFLKLLESDNMIELKK−−−−−−−−−−−−−−SKKGT−−−TLKVTNY−−NDYQDF−−−−−−−−−−−−−−−−−−SEGEKTIKK−−−−−−−PQKNHSVDH−−−−−−KETIKEPYAIPQKNHEVYTN−−−−−−−NNE−−−−−−−−KNE−−−−−−−KNDKNE−−−−−−−−−−−−KNDNKNKYMSDSNEYRLAEYLYKHIKVNNPNAKEP−−−NLQNWAKT−−−−−−−−−−−−−−−−−−FNYILR−−IDKRD−−−LEEVRELIVFCQKHSFWYKNILSADKFRKQYERLLLEKNDSKKVKYENKVYGNKMDE                                               
fig|1134825.3.peg.1631   Enterococcus faecium ERV38       GWVKLHRSITENWIWD−−N−−PQYL−−−KWWLDLILMANHKEKKIL−−FNGSFKKVDVGERITSEQKLAERWGV−−−−−−−−−SRNTVRKFLSLLVEDDMISIEKS−−−−−−−−−−−−−−RKNGT−−−TYKVNNY−−AIYQGF−−−−−−−−−−−−−−−−−−SEEKKQQTE−−−−−−−QRAEHQ−−−−−−−−−−−−−−−−−−−−−KDNELNIN−−−−−−−KNE−−−−−−−−KNE−−−−−−−KNEKNNNYV−−−−−−−−−ATRKKRVYADDDPNKKLAILLLKLIRKNQNIKEP−−−DLDKWANT−−−−−−−−−−−−−−−−−−IRLTIE−−SDKRT−−−GREVQDMIVWATSNDFWSGVILSPTSLRKHFDKMAIQKNKRKQQN                                                           
fig|565665.3.peg.1281   Enterococcus faecium D344SRF       GWIALHRNIRDHWVYQ−−E−−KRVFSKYEAWLDLLMDANHQNNKFL−−FDGQLIEANRGEFITSVRQLCERWGW−−−−−−−−−SNTKVNRFLKMLEDDQMLIRKS−−−−−−−−−−−−−−DSKKT−−−VITIVNY−−DFYQRY−−−−−−−−−−−−−−−−−−ESKETTQKR−−−−−−−QQNDA−−−−−−−−−−−−−−−−−−−−−−EASQKHTN−−−−−−−NND−−−−−−−−KTM−−−−−−−−NNNVNNNNPR−−−−−−−TSRKKREYADDDPNKKLAILLLKLIRKNQNIKEP−−−DLDKWANT−−−−−−−−−−−−−−−−−−IRLTIE−−SDKRT−−−GKEVQDMIVWATSNDFWSGVILSPTSLRKHFDKMAIQKNKRTQQN                                                           
fig|565653.4.peg.1843   Enterococcus gallinarum EG2       GWVAIHRSIRDHWLYQ−−E−−KRVFSKYEAWLDLVMDANHKQNKFV−−FDGKLVEVERGQKITSIRQLSERWRW−−−−−−−−−SRTKVTDFLTLLEKDGMLVRKS−−−−−−−−−−−−−−DSKKT−−−VITIVNY−−DIYQNQ−−−−−−−−−−−−−−−−−−DNKKS−−−−−−−−−−−HSSDT−−−−−−−−−−−−−−−−−−−−−−EKPQKSTN−−−−−−−NND−−−−−−−−KTM−−−−−−−INNDNNNNSPR−−−−−−−NTRKKRVYADDDPNKILAKTLFKLIKKNQDIKEP−−−NLDDWANT−−−−−−−−−−−−−−−−−−IRLTIE−−SDKRS−−−GKEVQEMIVWATQHEFWGGVILSPSSLRKHYDKMKAQKENPMKKN                                                           
fig|399742.4.peg.1038   Enterobacter sp. 638       GHFSLFRSLLQTDW−−−−−−−AKDTAKMALWVRLLGEASYRVRTVE−−FAARQWELSTGQLVTTAAILARKLRDQDGKEK−−−SPQAVTRMLNFFVKEGMISTEG−−−−−−−−−−−−−−NRFGT−−−VITITNY−−ASYQVI−−−−−−−−−−−−−−−−−−LPDEPSDEPSDKARASNGAGLRLVG−−−−−−−−−DEPSDRPPDEQNKTLTNNTKN−−−NKTSTSENSDESSD−−−−−−−KPVKKSPLVKPDAAI−−−QSGGKWGTSED−−−LRCAEWLFSEVQRIAPSAKQP−−−TWATWAND−−−−−−−−−−−−−−−−−−IRLMRE−−KDGRS−−−HKEIAALFKWACNDSFWQGNVLCPDKLREKWTQLEIQRNK                                                                
fig|393123.7.peg.2374   Listeria monocytogenes FSL N1-017     MDGWIKLHRSILESETYNCLSLHQK−−−−−IIMIEILLRTNFTSGFWFDKKTGRKIKIKPGQLITSVNKIKIDWLKNEKQI−−−−SDKKIRNTLVKLQKLGFLSIQT−−−−−−−−−−−−−−TNAYT−−−LLTICKY−−SDYQQD−−−−−−−−−−−−−−−−−−ETKEGEHKD−−−−−−KQRANEGQAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GKQKASKGQQYKKE−−−−−−−KK−−−−−−−−−−−EK−−−NNSNPRTNKFDEIHLQIANTFVHEIKKNIPQFRQP−−−NLETWANN−−−−−−−−−−−−−−−−−−IRLMME−−KDNRT−−−QAQIEYLIKWVQQDDFEMGNVLSPVKLRKRFDALVLKAKNDYNKKNGSQS                                                      
fig|393125.10.peg.2701   Listeria monocytogenes FSL R2-503     MKGAFQMSREIFESDIWS−−D−−VIKF−−−RLFFYIVGNAVFSENGVM−−KGG−−IQIGRGQYLRSFRNLREDLLYYDNNAEKFYSLSTIKEKIDELVREERLEIET−−−−−−−−−−−−−−TKLGT−−−LFTVRNY−−ALYQDL−−−−−−−−−−−−−−−−−−NNYSGTSSE−−−−−−−RLPNSHRTA−−−−−−−−−−−−−−−−−−TEQPPNNK−−−−−−−KNV−−−−−−−−KKD−−−−−−−KN−−−−−−−−−−−DN−−−KDNNKRQNKFDEVHLSLAKLLFEMIKENNPEEREP−−−KLEKWAND−−−−−−−−−−−−−−−−−−IRIMIE−−QDNRD−−−TEKVKNAIIWSQKNDFWCGVIKSPSSLRRNYDKMATQRNKPVANKPAYGKYNKNQKQEVLPDWFDSEVKPQVS−−TSESESSGDLEKKVAEIKAKLAERDE
fig|393121.7.peg.3155   Listeria monocytogenes FSL J2-071     MDGYIALHRKIIDSWIWQ−−D−−PEFY−−−RLWSYCLIKASFKEREIF−−LGQQIVKLNPGQFVIGREKLEEAMNIGLKNKR−−−TAVTWWRRLQKLEKSQMLNIKS−−−−−−−−−−−−−−YNKFS−−−VVTIENW−−GFYQGS−−−−−−−−−−−−−−−−−−DIENEQQNE−−−−−−−QQTNNKCTT−−−−−−−−−−−−−−−−−−DVQQTITN−−−−−−−NKD−−−−−−−−NKE−−−−−−−KN−−−−−−−−−−−DN−−−KDNNKRQNKFDEVHLSLANLLFELIKKNNPEEREH−−−DLEKWAHD−−−−−−−−−−−−−−−−−−IRIMIE−−QDKRD−−−AEKVKNAIIWSQKNDFWCGVIKSPKSLRKNYDQMATQRNKPVANKPTFNKYNKQTKPEILPDWFDKEQKQTKQE−−TSTTESSENLEKKVAEIKAQLAARNE
fig|393117.11.peg.1633   Listeria monocytogenes FSL J1-194     MDGYIALHRKIIDSWIWQ−−D−−PEFY−−−RLWSYCLIKASFKEREIF−−LGQQIVKLNPGQFVIGREKLEEAMNIGLKNKR